BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18815472|gb|BM536226.1|BM536226 EST589248 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG71P24 5' end, mRNA sequence (133 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g43690.1 unknown protein / ; supported by cDNA: gi_17978984 71 1e-13 >At1g43690.1 unknown protein / ; supported by cDNA: gi_17978984 Length = 599 Score = 70.9 bits (172), Expect = 1e-13 Identities = 30/38 (78%), Positives = 34/38 (88%) Frame = +1 Query: 19 VEVGFITLLESLNFCKVGLHLKCPAWQ*WVVGSESHYT 132 V+VGF+TLLESLNFCKVG +LKCP W WV+GSESHYT Sbjct: 363 VDVGFLTLLESLNFCKVGQNLKCPKWPIWVIGSESHYT 400 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,723,913 Number of Sequences: 27288 Number of extensions: 30816 Number of successful extensions: 97 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 11,516,596 effective HSP length: 19 effective length of database: 10,998,124 effective search space used: 263954976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18815386|gb|BM536175.1|BM536175 EST589197 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG71B2 5' end, mRNA sequence (524 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g43640.1 putative signal recognition particle protein 14kD, A... 129 9e-31 >At2g43640.1 putative signal recognition particle protein 14kD, ATSRP14 / ; supported by full-length cDNA: Ceres: 97249. Length = 121 Score = 129 bits (324), Expect = 9e-31 Identities = 63/105 (60%), Positives = 76/105 (72%) Frame = +2 Query: 26 MVRLQPDPFLNELTSMFERTTEHGSVWVTLKHSSDKSKAQRNKMKTAGETLEFKCLIRAT 205 MV LQ DPFLNELTSMFE++ E GSVWVTLK SS KSK Q+ K+ + GE++E++CLIRAT Sbjct: 1 MVLLQLDPFLNELTSMFEKSKEKGSVWVTLKRSSLKSKVQKRKLSSVGESIEYRCLIRAT 60 Query: 206 DGKKNISTMVGAKDHQRFQASYXXXXXXXXXXXXXXXXXDKRKAT 340 DGKK +ST VGAKDHQRFQASY D++K+T Sbjct: 61 DGKKTVSTSVGAKDHQRFQASYATILKAHMTALKKRERKDRKKST 105 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,353,993 Number of Sequences: 27288 Number of extensions: 189952 Number of successful extensions: 488 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 487 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 727283772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18815158|gb|BM536049.1|BM536049 EST589071 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG71A12 5' end, mRNA sequence (661 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g63810.1 hypothetical protein / similar to hypothetical pr... 127 3e-54 >At1g63810.1 hypothetical protein / similar to hypothetical protein GB:CAA22881 [Schizosaccharomyces pombe] Length = 1026 Score = 127 bits (320), Expect(2) = 3e-54 Identities = 76/159 (47%), Positives = 94/159 (58%), Gaps = 18/159 (11%) Frame = +3 Query: 3 KTAFLLRIAE-------------SLQNNWGMMFTATEDDVDVLMSGYAFRLKISHERALG 143 K+AFLL+IAE +LQN G+ TATED+VDV + GYAFRL+I HER L Sbjct: 625 KSAFLLKIAERWVKLLFVTLQTINLQNVKGIPCTATEDNVDVFIGGYAFRLRILHERGLS 684 Query: 144 LVTGQSNNSRH-----QWSLSADRKLLLQHQHASKINALRGRYPIYGPIVRLAKRWVSAH 308 LV +S S + S D+ L ++ QHAS IN L+GR+P+Y P+ RLAKRWVSAH Sbjct: 685 LVKRESEFSSFGVDPVKHVSSTDKMLFIRSQHASMINGLQGRFPVYAPVARLAKRWVSAH 744 Query: 309 LLSTVLTEEAVELLVSNXXXXXXXXXXXXSRITGFFEVL 425 L S L EEA+ELLV+ SRI GF L Sbjct: 745 LFSGCLAEEAIELLVAYLFLTPLPLGVPSSRINGFLRFL 783 Score = 102 bits (253), Expect(2) = 3e-54 Identities = 48/83 (57%), Positives = 61/83 (72%) Frame = +1 Query: 412 FLRFLRLLSEYDWAFSPLIVDFDGDFSTEEKNKINENFMRSREEHEKDTQKSSPAMFLAT 591 FLRFLRLL++Y+W F PLIVD + DF ++ +IN+NFM SR+ +E+D Q S AMFLA Sbjct: 779 FLRFLRLLADYEWMFYPLIVDINNDFGRNDEKEINDNFMSSRKGYEEDKQNISSAMFLAA 838 Query: 592 KYDVASEAWTRSSPTTAELRRLV 660 YD ASEAWT +SP E +RLV Sbjct: 839 PYDKASEAWTSTSPNLLEQKRLV 861 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,588,433 Number of Sequences: 27288 Number of extensions: 251373 Number of successful extensions: 775 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 774 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1106605264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18814903|gb|BM535903.1|BM535903 EST588925 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG70I17 5' end, mRNA sequence (623 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13040.1 hypothetical protein / 108 3e-24 >At4g13040.1 hypothetical protein / Length = 196 Score = 108 bits (269), Expect = 3e-24 Identities = 52/61 (85%), Positives = 56/61 (91%), Gaps = 3/61 (4%) Frame = +1 Query: 448 NQEPCLMRGVYFKNMKWQAAIKVDKKQIHLGTVGTQEEAARL---AAFMCGKEPNFELSE 618 NQEPCLMRGVY+KNMKWQAAIKV+KKQIHLGT +QEEAARL AAFMCG+EPNFELSE Sbjct: 81 NQEPCLMRGVYYKNMKWQAAIKVEKKQIHLGTFSSQEEAARLYDRAAFMCGREPNFELSE 140 Query: 619 E 621 E Sbjct: 141 E 141 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,883,421 Number of Sequences: 27288 Number of extensions: 261800 Number of successful extensions: 660 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 659 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 999514432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18814463|gb|BM535648.1|BM535648 EST588670 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG67J13 5' end, mRNA sequence (589 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g07910.1 translation elongation factor EF-1 alpha / identi... 317 2e-87 >At1g07910.1 translation elongation factor EF-1 alpha / identical to GB:AAB07881 from [Arabidopsis thaliana] (Mol. Gen. Genet. 219 (1-2), 106-112 (1989)) Length = 1081 Score = 317 bits (813), Expect = 2e-87 Identities = 144/195 (73%), Positives = 175/195 (88%) Frame = +1 Query: 1 IAPSSPNISSKDMVSKNEGLIVFFPGIPGCAKSALCKEILNAPGGLEDDRPIHSLMGDLI 180 + P++P + K+ V K+EGLIVFFPGIPG AKSALCKE+LNAPGG DDRP+H+LMGDL+ Sbjct: 646 VTPATPEPAVKEAVQKDEGLIVFFPGIPGSAKSALCKELLNAPGGFGDDRPVHTLMGDLV 705 Query: 181 KGRYWQKVADERRRKPYSIMLADKNAPNEEVWKQIENMCLSTKASAIPVIPDSEGTEINP 360 KG+YW KVADERR+KP SIMLADKNAPNE+VW+QIE+MC T+ASA+P++ DSEGT+ NP Sbjct: 706 KGKYWPKVADERRKKPQSIMLADKNAPNEDVWRQIEDMCRRTRASAVPIVADSEGTDTNP 765 Query: 361 FSIDALAVFIFRVLQRVNHPGNLDKSSPNAGYVMLMFYHLYDGKSRQEFESELIERFGSL 540 +S+DALAVF+FRVLQRVNHPG LDK S NAGYV+LMFYHLY+GK+R EFESELIERFGSL Sbjct: 766 YSLDALAVFMFRVLQRVNHPGKLDKESSNAGYVLLMFYHLYEGKNRNEFESELIERFGSL 825 Query: 541 VRIPLLKPERSPLPD 585 +++PLLK +R+PLPD Sbjct: 826 IKMPLLKSDRTPLPD 840 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,386,338 Number of Sequences: 27288 Number of extensions: 257489 Number of successful extensions: 705 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 705 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 904103924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18814424|gb|BM535626.1|BM535626 EST588648 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG67F5 5' end, mRNA sequence (394 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46060.1 hypothetical protein / predicted by genscan; supp... 162 4e-41 >At2g46060.1 hypothetical protein / predicted by genscan; supported by cDNA: gi_18087618 Length = 766 Score = 162 bits (411), Expect = 4e-41 Identities = 80/136 (58%), Positives = 100/136 (72%), Gaps = 6/136 (4%) Frame = +1 Query: 4 LYDASDKSVSFYIIYARGGTWSFGLRH------PISNRHSSTVETTMSISLERCPAKCSS 165 LY++S + V FYI+YAR GTWSFGLR P ++R S T+ +S+SLERCP CSS Sbjct: 465 LYNSSKEMVDFYILYAREGTWSFGLRQLIDSNTPAASRGSPTL---VSLSLERCPRGCSS 521 Query: 166 HGACKSVLDSSGLTFYSFCDCDRRTGGFDCSVELVSSSGQMWQSISLIGSNAAALLPAYW 345 +G C+ D++GLT YSFC CDR GGFDCS+E+VS + QSI+LI SNAAALLPAYW Sbjct: 522 YGQCRYAFDANGLTSYSFCSCDRTHGGFDCSIEIVSHQEHIVQSIALIASNAAALLPAYW 581 Query: 346 ALRHKAFAEWVLYTSS 393 ALR + + EWVL+TSS Sbjct: 582 ALRQREYPEWVLFTSS 597 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,874,444 Number of Sequences: 27288 Number of extensions: 174499 Number of successful extensions: 485 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 483 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 382840584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18814313|gb|BM535565.1|BM535565 EST588587 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG67E18 5' end, mRNA sequence (246 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18250.1 putative protein / similar to unknown protein (db... 94 2e-20 At3g04040.1 hypothetical protein / predicted by genscan+ 84 1e-17 >At5g18250.1 putative protein / similar to unknown protein (dbj|BAA90342.1);supported by full-length cDNA: Ceres:1816. Length = 133 Score = 93.6 bits (231), Expect = 2e-20 Identities = 41/53 (77%), Positives = 46/53 (86%) Frame = +2 Query: 86 VRCPHCAGPLSKEMETSEWTVPPLIRDSFSMIGSAVGGTTSAFYGFNHVMPIV 244 +RC HCAGPL++ +ETS+WTV P IRDSFSMIGSAVGGT SAF GFNH MPIV Sbjct: 10 IRCHHCAGPLTRNLETSKWTVDPFIRDSFSMIGSAVGGTASAFIGFNHAMPIV 62 >At3g04040.1 hypothetical protein / predicted by genscan+ Length = 128 Score = 84.3 bits (207), Expect = 1e-17 Identities = 37/47 (78%), Positives = 41/47 (86%) Frame = +2 Query: 89 RCPHCAGPLSKEMETSEWTVPPLIRDSFSMIGSAVGGTTSAFYGFNH 229 RC HCAGPL+K +ET+EWTV P IRDSFSMIGSAVGGT SAF GF+H Sbjct: 11 RCHHCAGPLTKNLETNEWTVAPFIRDSFSMIGSAVGGTASAFIGFHH 57 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,129,330 Number of Sequences: 27288 Number of extensions: 87667 Number of successful extensions: 290 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 290 length of database: 11,516,596 effective HSP length: 57 effective length of database: 9,961,180 effective search space used: 239068320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18813883|gb|BM535323.1|BM535323 EST588345 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG65K16 5' end, mRNA sequence (573 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g63420.1 putative protein / ; supported by cDNA: gi_12034... 80 1e-15 >At3g63420.1 putative protein / ; supported by cDNA: gi_12034687_gb_AF283673.1_AF283673 Length = 98 Score = 79.7 bits (195), Expect = 1e-15 Identities = 38/80 (47%), Positives = 43/80 (53%) Frame = +1 Query: 64 GKHRISAELKRXXXXXXXXXXXXXXXXXXXKASAACKEMLSNVETRPDPLLPITHGPTNP 243 GKHRI AEL R S C+E+LS +E PDPLLP+T+GP N Sbjct: 19 GKHRILAELARVEQEVAFLEKELKEVENTDIVSTVCEELLSVIEKGPDPLLPLTNGPLNL 78 Query: 244 SWDRWFEGAQDASGCRCWIL 303 WDRWFEG GCRC IL Sbjct: 79 GWDRWFEGPNGGEGCRCLIL 98 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,856,216 Number of Sequences: 27288 Number of extensions: 198909 Number of successful extensions: 430 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 859346304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18813865|gb|BM535314.1|BM535314 EST588336 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG65I16 5' end, mRNA sequence (636 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g30145.1 bcnt-like protein / ; supported by full-length cD... 134 4e-32 >At5g30145.1 bcnt-like protein / ; supported by full-length cDNA: Ceres: 9811. Length = 236 Score = 134 bits (337), Expect = 4e-32 Identities = 66/124 (53%), Positives = 91/124 (73%), Gaps = 4/124 (3%) Frame = +1 Query: 220 ITEVRDFAGEDVEIKKYVDHNSAEASDKGK----GPAAPASAVDXXXXXXXXXXXXSVLD 387 ITEV+DFAG+++E+K+ V+ +S EA ++G +A SAVD SVLD Sbjct: 113 ITEVKDFAGQEIEVKRLVEADSKEALERGNKGSSSSSAAPSAVDAVLEQIKKKQKLSVLD 172 Query: 388 KTKKDWEGFKGENRGMEEELDAYKKSSNQYLDRVGFLERADYREFERERDARLGMHAKRK 567 KTKKDW +K E++G+E+ELD YKKSS+QYLD+VGFLERADYR+FE+ERDARL + +KR+ Sbjct: 173 KTKKDWGEYKEEHKGVEDELDKYKKSSDQYLDKVGFLERADYRQFEKERDARLALQSKRR 232 Query: 568 PESM 579 + + Sbjct: 233 HDDV 236 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,146,894 Number of Sequences: 27288 Number of extensions: 190585 Number of successful extensions: 710 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 686 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 709 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18813374|gb|BM535036.1|BM535036 EST588058 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG64G4 5' end, mRNA sequence (597 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g08780.1 hypothetical protein / predicted by genscan; supp... 165 1e-41 >At3g08780.1 hypothetical protein / predicted by genscan; supported by cDNA: gi_19310496 Length = 313 Score = 165 bits (418), Expect = 1e-41 Identities = 76/150 (50%), Positives = 111/150 (73%) Frame = +3 Query: 48 EQLIHTHEYKAFQYRISTDSFDPKSLDVINIGPSFRSHYGSFSPISPFPSMTCDLRGPNA 227 +Q IHTHEY+A+Q+R S +P+S+ ++NIGP+FR HYGSFSP S FP + C+L +A Sbjct: 161 DQCIHTHEYRAYQFRSSKQRLEPRSVGIVNIGPAFRGHYGSFSPKSGFPPLICELSS-SA 219 Query: 228 MAEDEKAETLVGIKRGLKDQKELDLCAEGFEIGRLSKLMGSDSSNYTAELEHLYDKMLLK 407 M+ D +L K+ KDQKE+D AEGF++G L +L+G++++NYT +E +Y++ML K Sbjct: 220 MSVDCDESSLSAKKQSAKDQKEIDALAEGFQVGELKRLVGAEAANYTGGIEEMYERMLAK 279 Query: 408 LDSLARSVETSSAKVLEQEKHNMKLRYKIA 497 ++SLA VE SSA+V +QEKHN KLR ++A Sbjct: 280 IESLASDVEKSSARVFQQEKHNRKLRNRVA 309 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,890,910 Number of Sequences: 27288 Number of extensions: 245202 Number of successful extensions: 703 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 668 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 930958496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18813251|gb|BM534973.1|BM534973 EST587995 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG64I15 5' end, mRNA sequence (724 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11980.1 putative protein / predicted protein W02G9.1 Caen... 267 1e-83 >At4g11980.1 putative protein / predicted protein W02G9.1 Caenorhabditis elegans cosmid W02G9, PID:g3165571; supported by cDNA: gi_15450340_gb_AY052271.1_ Length = 309 Score = 267 bits (683), Expect(2) = 1e-83 Identities = 134/191 (70%), Positives = 164/191 (85%) Frame = +2 Query: 11 KMSTTPPSQIADIINLPTQLDQPVSVVAAPGVSDTHFRNAIESSLFKQWLKNIQTETGLL 190 KMS++ S + I LP+Q ++PV V A G+S + FR+AI+SSLF+ WL+N+++E+G+L Sbjct: 35 KMSSSS-SSLTQSITLPSQPNEPVLVSATAGISSSDFRDAIDSSLFRNWLRNLESESGIL 93 Query: 191 ANGALSLKQVLIQGVDMFGERLGFLKFKADIIDKETGQKVPGIVFARGPAVAVLILLDYE 370 A+G+++LKQVLIQGVDMFG+R+GFLKFKADI DKETGQKVPGIVFARGPAVAVLILL+ + Sbjct: 94 ADGSMTLKQVLIQGVDMFGKRIGFLKFKADIFDKETGQKVPGIVFARGPAVAVLILLESD 153 Query: 371 GETYAVLTEQVRVPVGRLILELPAGMLDDDQGDFAGTAVREVEEETGIHLNVHDMVDLTA 550 GETYAVLTEQVRVP G+++LELPAGMLDDD+GDF GTAVREVEEE GI L DMVDLTA Sbjct: 154 GETYAVLTEQVRVPTGKIVLELPAGMLDDDKGDFVGTAVREVEEEIGIKLKKEDMVDLTA 213 Query: 551 FLDASTGGQSF 583 FLD STG + F Sbjct: 214 FLDPSTGYRIF 224 Score = 60.5 bits (145), Expect(2) = 1e-83 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 610 KMSLFLYRGNVSKEKIQQLQGKETGLRDHGELIKVHVV 723 +MS+FLYRG V KE I+QLQGKETGLR+HGE IKV ++ Sbjct: 233 EMSVFLYRGQVEKETIRQLQGKETGLREHGEFIKVRLI 270 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,508,869 Number of Sequences: 27288 Number of extensions: 365267 Number of successful extensions: 1254 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1193 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1253 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1268361380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18813232|gb|BM534963.1|BM534963 EST587985 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG64G13 5' end, mRNA sequence (767 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g49540.1 hypothetical protein / similar to hypothetical pr... 345 2e-95 At5g08560.1 WD-repeat protein-like / ; supported by cDNA: gi... 59 2e-09 At5g08390.1 katanin p80 subunit - like protein / katanin p80 ... 57 1e-08 At5g23430.1 putative protein / contains similarity to unknown... 57 1e-08 At3g49660.1 G-protein beta-subunit (transducin) family / beta... 56 2e-08 At4g02730.1 G-protein beta family / similar to C. elegans put... 55 5e-08 At1g18080.1 G-protein beta family / identical to WD-40 repeat... 53 2e-07 At1g61210.1 G-protein beta family / contains similarity to ka... 52 3e-07 At1g48630.1 guanine nucleotide-binding protein, putative / si... 51 8e-07 At5g25150.1 transcription initiation factor IID-associated facto... 51 8e-07 At2g26060.1 G-protein beta family / ;supported by full-length... 50 1e-06 At1g11160.1 hypothetical protein / similar to hypothetical pr... 50 2e-06 >At1g49540.1 hypothetical protein / similar to hypothetical protein GB:AAD43147 GI:5430747 from [Arabidopsis thaliana] Length = 840 Score = 345 bits (884), Expect = 2e-95 Identities = 164/254 (64%), Positives = 200/254 (78%), Gaps = 3/254 (1%) Frame = +2 Query: 14 EGFDTLETVPEAVPVVLTEPPIEEQLAWHTLWPESHKLYGHGNELFSLCCDHDGKLVASS 193 EG DT ETVPEA P L EPPIE+QLA+HTLWPESHKLYGHGNELFSLC DH G LVASS Sbjct: 559 EGLDTFETVPEAAPAELKEPPIEDQLAFHTLWPESHKLYGHGNELFSLCSDHKGNLVASS 618 Query: 194 CKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEFSHDNKYLLAVSRDRHFSVFQINH 373 CKAQSA +AEIWLW+VG+WK+VGRL+SHSLTVT +EFS+D+ LL+VSRDRHFSVF I Sbjct: 619 CKAQSASMAEIWLWEVGTWKAVGRLQSHSLTVTHLEFSYDDTLLLSVSRDRHFSVFSIQR 678 Query: 374 KGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGSRDKTVKIWAVGTETSVKLLLTLP 553 E+ ++L+AK EAHKRIIW+CSWNPFGH+FAT SRDKTVKIW+V + +K +L LP Sbjct: 679 TDNGEVSHKLMAKVEAHKRIIWACSWNPFGHQFATSSRDKTVKIWSVENDARIKQILVLP 738 Query: 554 PFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWN---LDSRGGDGHLSVQNASPAVKF 724 PF SSVTA++W LD + G +AVGME+GLIEL N +++ G + A+ A++ Sbjct: 739 PFGSSVTAVAWTGLDRNEKSGCVAVGMESGLIELSNVKIIETEEG----TTATAALALRL 794 Query: 725 DPFLCHVSTVQRLS 766 +PF+CHVS V RL+ Sbjct: 795 EPFMCHVSAVNRLA 808 >At5g08560.1 WD-repeat protein-like / ; supported by cDNA: gi_15450909_gb_AY054535.1_ Length = 589 Score = 59.3 bits (142), Expect = 2e-09 Identities = 50/169 (29%), Positives = 76/169 (44%), Gaps = 3/169 (1%) Frame = +2 Query: 170 DGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEFSHDNKYLLAVSRDRH 349 DGK + S CK + + +V RL +T S+DNKY+L ++ Sbjct: 414 DGKWLVSVCKDSVISLFD-------REATVERLIEEEDMITSFSLSNDNKYILVNLLNQE 466 Query: 350 FSVFQINHKGTDEIDYQLVAKQEAHKR---IIWSCSWNPFGHEFATGSRDKTVKIWAVGT 520 ++ I E D ++V++ + HKR II SC A+GS D V IW T Sbjct: 467 IRLWNI------EGDPKIVSRYKGHKRSRFIIRSCFGGYKQAFIASGSEDSQVYIWHRST 520 Query: 521 ETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNLD 667 KL++ LP +V +SW + H +LA ++G I +W LD Sbjct: 521 G---KLIVELPGHAGAVNCVSWSPTNLH----MLASASDDGTIRIWGLD 562 Score = 47.4 bits (111), Expect = 9e-06 Identities = 35/138 (25%), Positives = 67/138 (48%), Gaps = 2/138 (1%) Frame = +2 Query: 266 LRSHSLTVTQMEFSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSC 445 L SH+ V ++FSH+ KYL + S+D+ +++I+ G + + LV H + + + Sbjct: 270 LESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADGHISLKHTLV----GHHKPVIAI 325 Query: 446 SWNPFGHEFATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTALS--WLSLDNHSNHGL 619 W+P + T ++ ++ W V + V + K ++ +S W G+ Sbjct: 326 LWSPDDRQVLTCGAEEVIRRWDVDSGDCVHMY-----EKGGISPISCGWYP----DGQGI 376 Query: 620 LAVGMENGLIELWNLDSR 673 +A GM + I +W+LD R Sbjct: 377 IA-GMTDRSICMWDLDGR 393 >At5g08390.1 katanin p80 subunit - like protein / katanin p80 subunit, Strongylocentrotus purpuratus, EMBL:AF052433 Length = 871 Score = 57.0 bits (136), Expect = 1e-08 Identities = 49/182 (26%), Positives = 77/182 (41%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 LYGH + + S+ D LVA+ A I LW + K V L H + F Sbjct: 148 LYGHSSGIDSVTFDASEGLVAAG-----AASGTIKLWDLEEAKVVRTLTGHRSNCVSVNF 202 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 ++ + S D + ++ I KG + + H R + + P G +G Sbjct: 203 HPFGEFFASGSLDTNLKIWDIRKKGC-------IHTYKGHTRGVNVLRFTPDGRWIVSGG 255 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 D VK+W + T+ KLL FKS + SLD H + LLA G + ++ W+L Sbjct: 256 EDNVVKVWDL---TAGKLL---HEFKSHEGKIQ--SLDFHPHEFLLATGSADKTVKFWDL 307 Query: 665 DS 670 ++ Sbjct: 308 ET 309 >At5g23430.1 putative protein / contains similarity to unknown protein (gb|AAB71474.1) Length = 922 Score = 57.0 bits (136), Expect = 1e-08 Identities = 46/182 (25%), Positives = 76/182 (41%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 LYGH + + S+ D LVA+ A I LW + K V L H ++F Sbjct: 55 LYGHSSGIDSVTFDASEVLVAAG-----AASGTIKLWDLEEAKIVRTLTGHRSNCISVDF 109 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 ++ + S D + ++ I KG + + H R + + P G +G Sbjct: 110 HPFGEFFASGSLDTNLKIWDIRKKGC-------IHTYKGHTRGVNVLRFTPDGRWVVSGG 162 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 D VK+W + T+ KLL + + SLD H + LLA G + ++ W+L Sbjct: 163 EDNIVKVWDL---TAGKLLTEFKSHEGQIQ-----SLDFHPHEFLLATGSADRTVKFWDL 214 Query: 665 DS 670 ++ Sbjct: 215 ET 216 >At3g49660.1 G-protein beta-subunit (transducin) family / beta-transducin, Schizosaccharomyces pombe, EMBL:CAA17803 Length = 317 Score = 55.8 bits (133), Expect = 2e-08 Identities = 50/214 (23%), Positives = 90/214 (41%), Gaps = 3/214 (1%) Frame = +2 Query: 101 TLWPESHKLYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHS 280 T + S L H + S+ DG+L+AS+ ++ I + V H Sbjct: 12 TPYVHSQTLTSHNRAVSSVKFSSDGRLLASASADKTIRTYTINTINDPIAEPVQEFTGHE 71 Query: 281 LTVTQMEFSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPF 460 ++ + FS D +++++ S D+ ++ + L+ H + ++NP Sbjct: 72 NGISDVAFSSDARFIVSASDDKTLKLWDVETGS-------LIKTLIGHTNYAFCVNFNPQ 124 Query: 461 GHEFATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMEN 640 + +GS D+TV+IW V T+ K L LP VTA +D + + L+ + Sbjct: 125 SNMIVSGSFDETVRIWDV---TTGKCLKVLPAHSDPVTA-----VDFNRDGSLIVSSSYD 176 Query: 641 GLIELWNLDSRGGDGH---LSVQNASPAVKFDPF 733 GL +W+ G GH + + +P V F F Sbjct: 177 GLCRIWD----SGTGHCVKTLIDDENPPVSFVRF 206 >At4g02730.1 G-protein beta family / similar to C. elegans putative WD-repeat protein C14B1.4, GenBank accession number Q17963;supported by full-length cDNA: Ceres:41490. Length = 333 Score = 54.7 bits (130), Expect = 5e-08 Identities = 44/203 (21%), Positives = 89/203 (43%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 L GH + + +DG L+AS+ ++ + LW ++ + R HS ++ + + Sbjct: 39 LEGHTAAISCVKFSNDGNLLASASVDKT-----MILWSATNYSLIHRYEGHSSGISDLAW 93 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 S D+ Y + S D ++ Y+ + H ++ ++NP + +GS Sbjct: 94 SSDSHYTCSASDDCTLRIWDARSP------YECLKVLRGHTNFVFCVNFNPPSNLIVSGS 147 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 D+T++IW V T V+++ K+ +S S+ + + L+ +G ++W+ Sbjct: 148 FDETIRIWEVKTGKCVRMI------KAHSMPIS--SVHFNRDGSLIVSASHDGSCKIWDA 199 Query: 665 DSRGGDGHLSVQNASPAVKFDPF 733 G + + SPAV F F Sbjct: 200 -KEGTCLKTLIDDKSPAVSFAKF 221 >At1g18080.1 G-protein beta family / identical to WD-40 repeat protein GI:2289095 from (Arabidopsis thaliana);supported by full-length cDNA: Ceres:7026. Length = 327 Score = 52.8 bits (125), Expect = 2e-07 Identities = 50/184 (27%), Positives = 83/184 (44%), Gaps = 3/184 (1%) Frame = +2 Query: 122 KLYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQME 301 +L GH + + + DG+ S E+ LW + + S R H+ V + Sbjct: 58 RLTGHSHFVEDVVLSSDGQFALSGSWD-----GELRLWDLAAGVSTRRFVGHTKDVLSVA 112 Query: 302 FSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSC---SWNPFGHEF 472 FS DN+ +++ SRDR ++ E Y + E H+ + SC S N Sbjct: 113 FSLDNRQIVSASRDRTIKLWNT----LGECKYTISEGGEGHRDWV-SCVRFSPNTLQPTI 167 Query: 473 ATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIE 652 + S DKTVK+W + ++ KL TL V+ ++ +S D L A G ++G++ Sbjct: 168 VSASWDKTVKVWNL---SNCKLRSTLAGHTGYVSTVA-VSPDG----SLCASGGKDGVVL 219 Query: 653 LWNL 664 LW+L Sbjct: 220 LWDL 223 >At1g61210.1 G-protein beta family / contains similarity to katanin p80 subunit GI:3005601 from [Strongylocentrotus purpuratus] Length = 282 Score = 52.4 bits (124), Expect = 3e-07 Identities = 46/182 (25%), Positives = 75/182 (40%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 L GH + + S+ D LV + + I LW V K V H + +EF Sbjct: 84 LCGHTSAVDSVAFDSAEVLVLAGASS-----GVIKLWDVEEAKMVRAFTGHRSNCSAVEF 138 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 ++L + S D + ++ I KG + + H R I + + P G +G Sbjct: 139 HPFGEFLASGSSDANLKIWDIRKKG-------CIQTYKGHSRGISTIRFTPDGRWVVSGG 191 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 D VK+W + T+ KLL + + SLD H LLA G + ++ W+L Sbjct: 192 LDNVVKVWDL---TAGKLLHEFKFHEGPIR-----SLDFHPLEFLLATGSADRTVKFWDL 243 Query: 665 DS 670 ++ Sbjct: 244 ET 245 >At1g48630.1 guanine nucleotide-binding protein, putative / similar to guanine nucleotide-binding protein GI:9294068 from (Arabidopsis thaliana); supported by cDNA: 38966. Length = 326 Score = 50.8 bits (120), Expect = 8e-07 Identities = 49/184 (26%), Positives = 84/184 (45%), Gaps = 3/184 (1%) Frame = +2 Query: 122 KLYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQME 301 ++ GH + + + DG+ S E+ LW + + +S R H+ V + Sbjct: 58 RMTGHSHFVQDVVLSSDGQFALSGSWD-----GELRLWDLATGESTRRFVGHTKDVLSVA 112 Query: 302 FSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSC---SWNPFGHEF 472 FS DN+ +++ SRDR ++ E Y +++ + HK + SC S N Sbjct: 113 FSTDNRQIVSASRDRTIKLWNT----LGECKY-TISEADGHKEWV-SCVRFSPNTLVPTI 166 Query: 473 ATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIE 652 + S DKTVK+W + + KL TL + ++ +S D L A G ++G+I Sbjct: 167 VSASWDKTVKVWNL---QNCKLRNTLAGHSGYLNTVA-VSPDG----SLCASGGKDGVIL 218 Query: 653 LWNL 664 LW+L Sbjct: 219 LWDL 222 >At5g25150.1 transcription initiation factor IID-associated factor-like protein / 100 kDa subunit of Pol II transcription factor - Homo sapiens, EMBL:X95525 Length = 700 Score = 50.8 bits (120), Expect = 8e-07 Identities = 46/187 (24%), Positives = 77/187 (40%), Gaps = 19/187 (10%) Frame = +2 Query: 167 HDGKLVASSCKAQSAPVAEIW-LWQVGSW------------------KSVGRLRSHSLTV 289 HDG LVA S V ++ + Q GS +S L HS V Sbjct: 362 HDGSLVAGGFSDSSIKVWDMAKIGQAGSGALQAENDSSDQSIGPNGRRSYTLLLGHSGPV 421 Query: 290 TQMEFSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHE 469 FS ++L+ S D ++ + +++ LV + H +W ++PFGH Sbjct: 422 YSATFSPPGDFVLSSSADTTIRLW------STKLNANLVC-YKGHNYPVWDAQFSPFGHY 474 Query: 470 FATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLI 649 FA+ S D+T +IW++ + P + LS +D H N +A G + + Sbjct: 475 FASCSHDRTARIWSMD---------RIQPLRIMAGHLS--DVDWHPNCNYIATGSSDKTV 523 Query: 650 ELWNLDS 670 LW++ + Sbjct: 524 RLWDVQT 530 Score = 49.7 bits (117), Expect = 2e-06 Identities = 47/182 (25%), Positives = 76/182 (40%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 L GH ++S G V SS + I LW ++ + H+ V +F Sbjct: 414 LLGHSGPVYSATFSPPGDFVLSSSADTT-----IRLWSTKLNANLVCYKGHNYPVWDAQF 468 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 S Y + S DR ++ ++ Q + H + W+P + ATGS Sbjct: 469 SPFGHYFASCSHDRTARIWSMDR-------IQPLRIMAGH---LSDVDWHPNCNYIATGS 518 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 DKTV++W V T V++ + +S V LSL + +A G E+G I +W+L Sbjct: 519 SDKTVRLWDVQTGECVRIFI---GHRSMV-----LSLAMSPDGRYMASGDEDGTIMMWDL 570 Query: 665 DS 670 + Sbjct: 571 ST 572 >At2g26060.1 G-protein beta family / ;supported by full-length cDNA: Ceres:142426. Length = 352 Score = 50.1 bits (118), Expect = 1e-06 Identities = 36/135 (26%), Positives = 59/135 (43%), Gaps = 7/135 (5%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQV---GSWKSVGRLRSHSLTVTQ 295 L GH NE+ S+ + G +A+ + +S +W+W+V + L H+ V Sbjct: 114 LEGHENEVKSVSWNASGSCLATCSRDKS-----VWIWEVLEGNEYDCAAVLTGHTQDVKM 168 Query: 296 MEFSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVA----KQEAHKRIIWSCSWNPFG 463 +++ L + S D V+ D+ +YQ V H +WS S+N G Sbjct: 169 VQWHPTMDVLFSCSYDNTIKVWWSED---DDGEYQCVQTLGESNNGHSSTVWSISFNAAG 225 Query: 464 HEFATGSRDKTVKIW 508 + T S D T+KIW Sbjct: 226 DKMVTCSDDLTLKIW 240 >At1g11160.1 hypothetical protein / similar to hypothetical protein GB:AAD49999 GI:5734734 from [Arabidopsis thaliana] Length = 974 Score = 49.7 bits (117), Expect = 2e-06 Identities = 44/182 (24%), Positives = 76/182 (41%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 L GH + + S+ + + LV + + I LW + K V H + +EF Sbjct: 3 LCGHTSPVDSVAFNSEEVLVLAGASS-----GVIKLWDLEESKMVRAFTGHRSNCSAVEF 57 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 ++L + S D + V+ KG + + H R I + ++P G +G Sbjct: 58 HPFGEFLASGSSDTNLRVWDTRKKG-------CIQTYKGHTRGISTIEFSPDGRWVVSGG 110 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 D VK+W + T+ KLL + + SLD H LLA G + ++ W+L Sbjct: 111 LDNVVKVWDL---TAGKLLHEFKCHEGPIR-----SLDFHPLEFLLATGSADRTVKFWDL 162 Query: 665 DS 670 ++ Sbjct: 163 ET 164 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,361,611 Number of Sequences: 27288 Number of extensions: 384960 Number of successful extensions: 1545 Number of sequences better than 1.0e-05: 34 Number of HSP's better than 0.0 without gapping: 1194 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1454 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1401406280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18265080|gb|BM413450.1|BM413450 EST587777 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG63I20 5' end, mRNA sequence (744 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g71860.1 protein tyrosine phosphatase / identical to GB:C... 350 5e-97 >At1g71860.1 protein tyrosine phosphatase / identical to GB:CAA06978 GI:3413425 from [Arabidopsis thaliana] (Plant Mol. Biol. 39 (3), 593-605 (1999)); supported by cDNA: gi_3800745_gb_AF055635.1_AF055635 Length = 340 Score = 350 bits (898), Expect = 5e-97 Identities = 168/245 (68%), Positives = 200/245 (81%), Gaps = 3/245 (1%) Frame = +2 Query: 17 RCHSPDKIASEFSTLQENRLKASEMKSRCLVALDSTNISKNRYTDVIPFDNNRVVLDPCK 196 + +PD IA EF+ LQ NR+ SE+ VA++S N+ KNRY+DV+PFD NR+VL+PCK Sbjct: 51 KIQNPDSIAHEFTGLQANRMWPSELLLNSTVAMNSVNVEKNRYSDVVPFDKNRIVLNPCK 110 Query: 197 DYRPSAKGYINASFIEISEG--VSRFVATQGPLAHTFEDFWEMIIQQRCPVIVMLTRLVD 370 D SAKGY+NAS I+ SE +S+F+ATQGPL HT EDFWEM+IQQ CP+IVMLTRLVD Sbjct: 111 D--SSAKGYVNASLIKTSESESISQFIATQGPLPHTMEDFWEMVIQQHCPIIVMLTRLVD 168 Query: 371 NYKMVKCGDYFQAEDGPRTFGNICIVTKYM-TSDASLVLRTLEVNYIESEEPPLCVLHIQ 547 N + VKCGDYFQ EDGPR FGNI + TK++ T+D SL+LR LEVNY E+E+ P+ VLHIQ Sbjct: 169 NNRTVKCGDYFQDEDGPREFGNISLTTKWIKTTDTSLMLRNLEVNYKETEDQPMSVLHIQ 228 Query: 548 YPEWPDHGVPRDTLAVREILKRTYNLPLGLGPIVVHCSAGIGRTGTYCTIHNTIQRILGG 727 YPEWPDHGVP+DT+AVREILKR Y +P LGPI+VHCSAGIGRTGTYC IHNTIQRIL G Sbjct: 229 YPEWPDHGVPKDTVAVREILKRLYQVPPSLGPIIVHCSAGIGRTGTYCAIHNTIQRILAG 288 Query: 728 DMSAL 742 DMSAL Sbjct: 289 DMSAL 293 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,486,735 Number of Sequences: 27288 Number of extensions: 394163 Number of successful extensions: 1143 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1140 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1330449000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264914|gb|BM413284.1|BM413284 EST587611 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62H12 5' end, mRNA sequence (656 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g53645.1 Expressed protein / ; supported by full-length cD... 228 2e-60 >At1g53645.1 Expressed protein / ; supported by full-length cDNA: Ceres: 41453. Length = 523 Score = 228 bits (582), Expect = 2e-60 Identities = 106/142 (74%), Positives = 124/142 (86%) Frame = +2 Query: 8 TNMMIECEPEYLMGDFESNPDIDETPPIPLRDALEKMKPFLMAYEGIKDQEEWEEVIKET 187 TN+MIECEPEY+M DF SNPDIDE PP+ LR+ LEK+KPF++AYEGIKDQEEWEE I E Sbjct: 382 TNLMIECEPEYIMPDFGSNPDIDEKPPMSLRECLEKVKPFIVAYEGIKDQEEWEEAINEA 441 Query: 188 METVPLMKEIVDYYSGPDRVTAKQQQQELERVAKTLPESAPNSVKRFTERAVLSLQSNPG 367 M PLMKEIVD+YSGPDRVTAK+Q +EL+R+A TLP SAP+SVKRF +RA L+L+SNPG Sbjct: 442 MTQAPLMKEIVDHYSGPDRVTAKKQNEELDRIATTLPASAPDSVKRFADRAALTLKSNPG 501 Query: 368 WGFDKKCQFMDKVVMEVSQHYK 433 WGFDKK QFMDK+V+EVSQ YK Sbjct: 502 WGFDKKYQFMDKLVLEVSQSYK 523 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,785,858 Number of Sequences: 27288 Number of extensions: 248676 Number of successful extensions: 853 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 851 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1097681028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264842|gb|BM413212.1|BM413212 EST587539 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62J13 5' end, mRNA sequence (785 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g50100.1 putative protein / similar to unknown protein (pi... 239 1e-63 >At5g50100.1 putative protein / similar to unknown protein (pir||S75732);supported by full-length cDNA: Ceres:35710. Length = 214 Score = 239 bits (610), Expect = 1e-63 Identities = 116/174 (66%), Positives = 142/174 (80%), Gaps = 5/174 (2%) Frame = +1 Query: 160 GPRYSIRAISGTT----VAPNKDINEEKSPENWKIKMLYDGECPLCMREVDMLRERNKSY 327 G +Y +RAI GT+ + P K+ EE P+NWKIKMLYDG+CPLCMREV+ML ERN+ + Sbjct: 42 GFKYQVRAIQGTSTDPVITPLKN-REEPKPQNWKIKMLYDGDCPLCMREVNMLMERNEKH 100 Query: 328 GTIKFLDISSDEYRPDENEGLDYETVMGRIHAILSDGTVVTDVEAFRRLYEAVGLGWVYA 507 GTIKF+DISS++Y P++N+GLDY+TVMG+IHAI SDG VV VEAFRRLYE VGLGWVY Sbjct: 101 GTIKFVDISSNDYSPEDNQGLDYKTVMGQIHAIQSDGNVVKGVEAFRRLYEEVGLGWVYT 160 Query: 508 ITKYEPIATIADAVYGVWAKYRLQVTGRPSLEEVLKARRK-KEEMCKDSKACKM 666 ITK+EPI +AD VY VWAKYRLQVTGRPS+E +L+AR+K K E C +SK CK+ Sbjct: 161 ITKFEPIGKLADVVYDVWAKYRLQVTGRPSIEAILEARKKDKVETCGESKNCKI 214 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,396,550 Number of Sequences: 27288 Number of extensions: 342634 Number of successful extensions: 1030 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1027 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264811|gb|BM413181.1|BM413181 EST587508 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62D15 5' end, mRNA sequence (741 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72550.1 putative phenylalanyl-tRNA synthetase beta-subunit; ... 368 e-102 >At1g72550.1 putative phenylalanyl-tRNA synthetase beta-subunit; PheHB / similar to phenylalanyl-tRNA synthetase beta-subunit (PheHB) GB:5032011 [Homo sapiens]; supported by cDNA: gi_17065261 Length = 598 Score = 368 bits (945), Expect = e-102 Identities = 178/244 (72%), Positives = 211/244 (85%) Frame = +3 Query: 3 TYEALPPAEINFVPLKQTKNFRADELMEFYKSDLKLKKFLHIIENSPVYPVIYDCKRTVL 182 TYEALPP +INFVPLKQTK+FRADEL+EFYKSD+KLKKFLHIIENSPV+PV+YD KRTVL Sbjct: 173 TYEALPPTDINFVPLKQTKSFRADELIEFYKSDMKLKKFLHIIENSPVFPVLYDSKRTVL 232 Query: 183 SLPPIINGAHSAISLKTKNVFIECTATDLTKANIVLNTMVTMFSVYCERKFEVEPVKVTY 362 SLPPIINGAHSAI+L+TKNVFIECTATDLTKA IVLNTMVT FS +C RKFE+EPV+VTY Sbjct: 233 SLPPIINGAHSAITLQTKNVFIECTATDLTKAKIVLNTMVTTFSEFCARKFEIEPVEVTY 292 Query: 363 PDGRSYVCPDLSIYNMNVPLSYITGIIGVQLPEDKVASLLHKMQLRAEKSVSEDKEVKFV 542 DG+SY+ PDL++Y+M VPLS+IT IGV L ++V SLL +MQL+AE++ S D + Sbjct: 293 DDGKSYIYPDLAVYDMEVPLSFITDSIGVSLKVEQVTSLLTRMQLQAEQAKSSDNQCAIK 352 Query: 543 VSVPPTRSDVLHPCDVTEDVAIAYGYHEIPKRKPASLNPLPLSQFSDLIRTEIAMTGYTE 722 V VPP+RSDVLHPCDV EDVAIAYG++ IP RKPAS+ PL L++ +DL+R EIAM YTE Sbjct: 353 VHVPPSRSDVLHPCDVMEDVAIAYGFNNIPTRKPASIKPLTLNELTDLLRIEIAMCVYTE 412 Query: 723 VLTW 734 V+TW Sbjct: 413 VVTW 416 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,522,606 Number of Sequences: 27288 Number of extensions: 329588 Number of successful extensions: 1001 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1001 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1321579340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264791|gb|BM413161.1|BM413161 EST587488 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62O16 5' end, mRNA sequence (702 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56040.1 putative protein / predicted protein, Arabidopsis... 237 4e-63 >At3g56040.1 putative protein / predicted protein, Arabidopsis thaliana; supported by cDNA: gi_14596046_gb_AY042811.1_ Length = 883 Score = 237 bits (605), Expect = 4e-63 Identities = 101/171 (59%), Positives = 141/171 (82%) Frame = +2 Query: 2 LGPLWEVIRQKFYRGSISKGSELLIEVAEFLWRDVQLDGSLIILAENVLGSPRIDENGET 181 LGPLWEV RQKF GSIS SEL +E+AEF W +VQ+DGSLI+ AEN +GS ++NGE Sbjct: 703 LGPLWEVSRQKFKGGSISSCSELQLEIAEFSWNNVQVDGSLIVTAENAMGSTTPNDNGEP 762 Query: 182 VLHYGKRCGRCKLENVKILNDGIDWNARENLYWKHDVQRFEAVKVILHGNAEFEAVDVIL 361 +L YG RCG+CKL NV ++N GIDWN++ N+YW++DV R E K+ILHGNAEFEA +V + Sbjct: 763 ILQYGLRCGKCKLHNVNVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEFEASNVTI 822 Query: 362 QGNHVFEVPDGYKMKITTGDSGLAVELKPIENKLMESGSWFWNYKIMGNHV 514 +G+HVFEVPDG+K+KIT+G++GL++ L+ ++ ++ME+GSW+WNY++ G+H+ Sbjct: 823 EGHHVFEVPDGHKLKITSGNAGLSINLEALKEEVMETGSWYWNYQLNGSHI 873 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,065,691 Number of Sequences: 27288 Number of extensions: 323810 Number of successful extensions: 935 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 886 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 935 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1218881876 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264727|gb|BM413097.1|BM413097 EST587424 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62A18 5' end, mRNA sequence (807 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g46450.1 SEC14 cytosolic factor, putative / supported by c... 270 5e-73 At4g36640.1 putative protein / 58 5e-09 At3g24840.1 phosphatidylinositol transfer protein, putative / ... 58 7e-09 At4g39180.1 SEC14 - like protein / phosphatidylinositol-phosp... 57 9e-09 At4g08690.1 putative phosphoglyceride transfer protein / simi... 57 2e-08 At4g36490.1 expressed protein / ; supported by cDNA: gi_15215... 56 2e-08 At5g47510.1 SEC14 cytosolic factor, putative / contains simil... 56 2e-08 At2g21540.1 putative phosphatidylinositol phophatidylcholine tra... 56 3e-08 At1g75170.1 unknown protein / ; supported by cDNA: gi_17979168 55 3e-08 At1g75370.1 sec14 cytosolic factor, putative / similar to SP:... 54 8e-08 At2g18180.1 putative phosphatidylinositol/phophatidylcholine tra... 54 1e-07 At2g21520.1 putative phosphatidylinositol/phosphatidylcholine tr... 53 2e-07 >At3g46450.1 SEC14 cytosolic factor, putative / supported by cDNA: gi_20453103 Length = 486 Score = 270 bits (691), Expect = 5e-73 Identities = 124/254 (48%), Positives = 177/254 (68%) Frame = +2 Query: 2 SDQSSSTGETTPNDFHHSQAYPQARSHDEVQDDGYPQRWLLELHKELREESISVPERLND 181 ++ +S+ + +D Q+ R DE Q WL +L++EL ++ +S+PERLN+ Sbjct: 145 TNSHASSESESQSDSQTLQSPSDIRIEDEAPLPVISQDWLRKLYEELEKQRLSLPERLNE 204 Query: 182 DELRQFYAAANGDFARLLSSVKKTIKWRQNYTFLSPEELKAWSPFIFWHGHDANQRPCLI 361 DEL +FY +NGDF LLSS+KKTI WR+ Y LS EEL+ WS +FWHG+D NQRPCLI Sbjct: 205 DELHRFYRVSNGDFTSLLSSIKKTIHWRETYRILSEEELETWSSLLFWHGYDKNQRPCLI 264 Query: 362 IRLGLACSNLRSNGKSLLIKAVVSQIEHGILRMVNVEHPQITVLMDCEGLSPFGFPIHMM 541 +RLGLA L S+ + +A++SQ+EHG+L ++ E+ ++TVL+DCEGLSP P+ MM Sbjct: 265 VRLGLAFLKLPSHERPRFAQAIISQVEHGVLHLLTPENSELTVLVDCEGLSPLRIPMQMM 324 Query: 542 RSCAMLLQDHYPNRLSSLIIVRLPQVAQIIMQTFFQVLKPSTRQKVRIIGRNHLEFLSNH 721 RSC+ +LQDH+PNRL L I+RLP V ++I QTF Q+L+P+TR+K+RI G LS + Sbjct: 325 RSCSSILQDHFPNRLGCLFIIRLPPVVRVISQTFIQILRPTTRKKLRIEGETFHRVLSEY 384 Query: 722 LNSIPPFLGGNCSC 763 L ++P +LG NC+C Sbjct: 385 LQTLPSYLGSNCNC 398 >At4g36640.1 putative protein / Length = 294 Score = 58.2 bits (139), Expect = 5e-09 Identities = 60/260 (23%), Positives = 110/260 (42%), Gaps = 16/260 (6%) Frame = +2 Query: 62 YPQARSHDEVQDDGYPQRWLLELHKELREESISVPERLNDDELRQFYAAANGDFARLLSS 241 + + +H DD + EL + S +D LR+F A N D + Sbjct: 2 FRRRNAHQLDNDDSQQDNKVRELKSAIGPLSGHSLVFCSDASLRRFLDARNWDVEKAKKM 61 Query: 242 VKKTIKWRQNYTFLSPEELKAWSPFIFWHG----------HDANQRPCLIIRLGLACSNL 391 +++T+KWR Y P+E++ W+ + G HD R LI+R + S Sbjct: 62 IQETLKWRSTY---KPQEIR-WNQ-VAHEGETGKASRASFHDRQGRVVLIMRPAMQNSTS 116 Query: 392 RSNGKSLLIKAVVSQIEHGILRMVNVEHPQITVLMDCEGLS-PFGFPIHMMRSCAMLLQD 568 + I+ +V +E+ I+ + + Q++ L+D G S P+ R +LQ+ Sbjct: 117 QEGN----IRHLVYLLENAIINLPKGQ-KQMSWLIDFTGWSMAVNPPMKTTREIIHILQN 171 Query: 569 HYPNRLSSLIIVRLPQVAQIIMQTFFQVLKPSTRQKVRII---GRNHLEFLSNH--LNSI 733 +YP RL + P++ Q + + L P T +KV+ + + E ++ H + ++ Sbjct: 172 YYPERLGIAFLYNPPRLFQAVYRAAKYFLDPRTAEKVKFVYPKDKASDELMTTHFDVENL 231 Query: 734 PPFLGGNCSCSNAQTDGCRK 793 P GG + D R+ Sbjct: 232 PKEFGGEATLEYDHEDFSRQ 251 >At3g24840.1 phosphatidylinositol transfer protein, putative / similar to SEC14 CYTOSOLIC FACTOR (PHOSPHATIDYLINOSITOL/PHOSPHATIDYLCHOLINE TRANSFER PROTEIN) GB:P46250 from [Candida albicans] (Yeast (1996) 12(11), 1097-1105) Length = 535 Score = 57.8 bits (138), Expect = 7e-09 Identities = 56/241 (23%), Positives = 101/241 (41%), Gaps = 30/241 (12%) Frame = +2 Query: 161 VPERLND-DELRQFYAAANGDFARLLSSVKKTIKWR---------QNYTFLSPEELKAWS 310 +P R +D + +F A D + + ++ +KWR Q++ + EE++ + Sbjct: 99 LPPRHDDYHTMLRFLKARRFDLEKTVQMWEEMLKWRKENGVDTIIQDFVYDEYEEVQQYY 158 Query: 311 PFIFWHGHDANQRPCLIIRLGLACSNLRSNGKSLLIKAVVSQIEH---GILRMVNVEHP- 478 P + HG D RP I RLG GK + + + + + G + + + P Sbjct: 159 PHGY-HGVDREGRPVYIERLGKI-----DPGKLMKVTTLERFLRYHVQGFEKTFSEKFPA 212 Query: 479 ----------QITVLMDCEGLSPFGFPIHMMRSCAMLLQ----DHYPNRLSSLIIVRLPQ 616 T ++D G+S F + + M +Q D+YP L+ + I+ Sbjct: 213 CSIAAKRHINSSTTIIDVHGVSWMSFR-KLAQDLVMRMQKIDGDNYPETLNQMYIINAGN 271 Query: 617 VAQIIMQTFFQVLKPSTRQKVRIIGRNHLEFLSNHL--NSIPPFLGGNCSCSNAQTDGCR 790 +++ T L P T K+ ++G + L + + +P FLGGNC C A GC Sbjct: 272 GFKLVWNTVKGFLDPKTTSKIHVLGNKYRSHLLEIIDPSELPEFLGGNCKC--AHEGGCM 329 Query: 791 K 793 + Sbjct: 330 R 330 >At4g39180.1 SEC14 - like protein / phosphatidylinositol-phosphatidylcholine transfer protein SEC14, Yarrowia lipolytica, PIR2:S43745 Length = 550 Score = 57.4 bits (137), Expect = 9e-09 Identities = 58/241 (24%), Positives = 98/241 (40%), Gaps = 30/241 (12%) Frame = +2 Query: 161 VPERLNDDELR-QFYAAANGDFARLLSSVKKTIKWRQNY---------TFLSPEELKAWS 310 +P + +D + +F A D + + WR+ Y F EE+ + Sbjct: 87 LPSKHDDHHMMLRFLRARKFDLEKAKQMWSDMLNWRKEYGADTIMEDFDFKEIEEVVKYY 146 Query: 311 PFIFWHGHDANQRPCLIIRLGL--ACSNLRSNGKSLLIKAVVSQIEHGILRMVNVEHP-- 478 P + HG D RP I RLG A ++ +K V + E + NV+ P Sbjct: 147 PQGY-HGVDKEGRPIYIERLGQVDATKLMKVTTIDRYVKYHVKEFE----KTFNVKFPAC 201 Query: 479 ---------QITVLMDCEGLSPFGF---PIHMMRSCAMLLQDHYPNRLSSLIIVRLPQVA 622 Q T ++D +G+ F +++S + D+YP L+ + I+ Sbjct: 202 SIAAKRHIDQSTTILDVQGVGLSNFNKAAKDLLQSIQKIDNDNYPETLNRMFIINAGCGF 261 Query: 623 QIIMQTFFQVLKPSTRQKVRIIGRNH----LEFLSNHLNSIPPFLGGNCSCSNAQTDGCR 790 +++ T L P T K+ ++G + LE + N +P FLGG C+C A GC Sbjct: 262 RLLWNTVKSFLDPKTTAKIHVLGNKYQTKLLEIID--ANELPEFLGGKCTC--ADKGGCM 317 Query: 791 K 793 + Sbjct: 318 R 318 >At4g08690.1 putative phosphoglyceride transfer protein / similar to SEC14-like protein of D. discoideum, GenBank accession number U82515 Length = 301 Score = 56.6 bits (135), Expect = 2e-08 Identities = 48/195 (24%), Positives = 87/195 (44%), Gaps = 10/195 (5%) Frame = +2 Query: 134 KELREESISVPERLN----DDELRQFYAAANGDFARLLSSVKKTIKWRQNYTFLSPEELK 301 +E+R+ +PE+L+ DD + ++ A N + +K+T+KWR Y PEE+ Sbjct: 24 EEVRKLLGPLPEKLSSFCSDDAVLRYLRARNWHVKKATKMLKETLKWRVQY---KPEEI- 79 Query: 302 AWSPFIFWHGHDANQRPCLIIRLGLACSNLRSNGKSLLIKAVVSQIEHGILRMVNVEH-- 475 W R + +LG +R + ++ K+V QI + + M N Sbjct: 80 CWEEVAGEAETGKIYRSSCVDKLGRPVLIMRPSVENS--KSVKGQIRYLVYCMENAVQNL 137 Query: 476 ----PQITVLMDCEGLSPFGFPIHMMRSCAMLLQDHYPNRLSSLIIVRLPQVAQIIMQTF 643 Q+ ++D G S + + A +LQ+HYP RL+ ++ P+ + + Sbjct: 138 PPGEEQMVWMIDFHGYSLANVSLRTTKETAHVLQEHYPERLAFAVLYNPPKFFEPFWKVA 197 Query: 644 FQVLKPSTRQKVRII 688 L+P TR KV+ + Sbjct: 198 RPFLEPKTRNKVKFV 212 >At4g36490.1 expressed protein / ; supported by cDNA: gi_15215779_gb_AY050419.1_ Length = 543 Score = 56.2 bits (134), Expect = 2e-08 Identities = 57/242 (23%), Positives = 101/242 (41%), Gaps = 31/242 (12%) Frame = +2 Query: 161 VPERLNDDELR-QFYAAANGDFARLLSSVKKTIKWRQNY---TFLSPEELKAWSPFIFW- 325 +PE+ +D + +F A D + + ++WR+ + T + + K + + Sbjct: 69 LPEKHDDYHMMLRFLKARKFDLEKTKQMWTEMLRWRKEFGADTVMEEFDFKEIDEVLKYY 128 Query: 326 ----HGHDANQRPCLIIRLGLACSNLRSNGKSLLIKAVVSQIEHGIL---RMVNVEHP-- 478 HG D RP I RLGL S K + + + + + ++ R NV+ P Sbjct: 129 PQGHHGVDKEGRPVYIERLGLVDST-----KLMQVTTMDRYVNYHVMEFERTFNVKFPAC 183 Query: 479 ---------QITVLMDCEGLSPFGFPIHMMRSCAMLLQ----DHYPNRLSSLIIVRLPQV 619 Q T ++D +G+ F R LQ D+YP L+ + I+ Sbjct: 184 SIAAKKHIDQSTTILDVQGVGLKNFN-KAARDLITRLQKVDGDNYPETLNRMFIINAGSG 242 Query: 620 AQIIMQTFFQVLKPSTRQKVRIIGRNH----LEFLSNHLNSIPPFLGGNCSCSNAQTDGC 787 +++ T L P T K+ ++G + LE + + +P FLGG+C+C A GC Sbjct: 243 FRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDE--SELPEFLGGSCTC--ADNGGC 298 Query: 788 RK 793 + Sbjct: 299 MR 300 >At5g47510.1 SEC14 cytosolic factor, putative / contains similarity to phosphatidylinositol/phosphatidylcholine transfer protein Length = 403 Score = 56.2 bits (134), Expect = 2e-08 Identities = 65/248 (26%), Positives = 107/248 (42%), Gaps = 29/248 (11%) Frame = +2 Query: 113 RWLLELHKELREESISVPERLND-DELRQFYAAANGDFARLLSSVKKTIKWR-------- 265 R LL LH L P++ D + LR+F + D + + +KWR Sbjct: 32 RNLLLLHGHL-------PDKHGDHNTLRRFLKMRDFDLEKSKEAFLNYMKWRVDYKVDLI 84 Query: 266 -QNYTFLSPEELKAWSPFIFWHGHDANQRPCLIIRLGLACSNLRSNGKSLLIKAVVSQIE 442 Q + F E+K P F H D RP I RLG+ ++L + K+ I+ V+ Sbjct: 85 SQKFKFEEYGEVKKHYPHGF-HKVDKTGRPIYIERLGM--TDLNAFLKATTIERYVNYHI 141 Query: 443 HGILRMVNVEHPQITVLMDCE-------------GLSPFGFPIHMMRSCAMLLQ----DH 571 + +++ +P ++ D G+S F P RS M +Q ++ Sbjct: 142 KEQEKTMSLRYPACSIASDKHVSSTTTILDVSGVGMSNFSKPA---RSLFMEIQKIDSNY 198 Query: 572 YPNRLSSLIIVRLPQVAQIIMQTFFQVLKPSTRQKVRIIGRNHLEFLSNHL--NSIPPFL 745 YP L L +V +++ L T KV+++G N+L L + +++P FL Sbjct: 199 YPETLHRLFVVNASSGFRMLWLALKTFLDARTLAKVQVLGPNYLGELLEAIEPSNLPTFL 258 Query: 746 GGNCSCSN 769 GGNC+CS+ Sbjct: 259 GGNCTCSD 266 >At2g21540.1 putative phosphatidylinositol phophatidylcholine transfer protein / ; supported by cDNA: gi_16209641_gb_AY057587.1_ Length = 548 Score = 55.8 bits (133), Expect = 3e-08 Identities = 56/241 (23%), Positives = 101/241 (41%), Gaps = 30/241 (12%) Frame = +2 Query: 161 VPERLNDDELR-QFYAAANGDFARLLSSVKKTIKWR---------QNYTFLSPEELKAWS 310 +P + +D + +F A D + I WR +++ F +E+ + Sbjct: 86 LPSKHDDHHMMLRFLRARKFDLEKAKQMWTDMIHWRKEFGVDTIMEDFDFKEIDEVLKYY 145 Query: 311 PFIFWHGHDANQRPCLIIRLGL--ACSNLRSNGKSLLIKAVVSQIEHGILRMVNVEHP-- 478 P + HG D + RP I RLG A ++ +K V + E + N++ P Sbjct: 146 PQGY-HGVDKDGRPVYIERLGQVDATKLMQVTTIDRYVKYHVREFE----KTFNIKLPAC 200 Query: 479 ---------QITVLMDCEGLSPFGFPI---HMMRSCAMLLQDHYPNRLSSLIIVRLPQVA 622 Q T ++D +G+ F +++ + D+YP L+ + I+ Sbjct: 201 SIAAKKHIDQSTTILDVQGVGLKSFSKAARDLLQRIQKIDSDNYPETLNRMFIINAGSGF 260 Query: 623 QIIMQTFFQVLKPSTRQKVRIIGRNH----LEFLSNHLNSIPPFLGGNCSCSNAQTDGCR 790 +++ T L P T K+ ++G + LE + + N +P FLGGNC+C A GC Sbjct: 261 RLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDS--NELPEFLGGNCTC--ADKGGCM 316 Query: 791 K 793 + Sbjct: 317 R 317 >At1g75170.1 unknown protein / ; supported by cDNA: gi_17979168 Length = 296 Score = 55.5 bits (132), Expect = 3e-08 Identities = 55/209 (26%), Positives = 98/209 (46%), Gaps = 17/209 (8%) Frame = +2 Query: 176 NDDELRQFYAAANGDFARLLSSVKKTIKWRQNYTFLSPEELKAWSPF--------IFWHG 331 +D L+++ A N + + +++T+KWR ++ PEE++ W+ ++ G Sbjct: 43 SDACLKRYLEARNWNVGKAKKMLEETLKWRSSF---KPEEIR-WNEVSGEGETGKVYKAG 98 Query: 332 -HDANQRPCLIIRLGLACSNLRSNGKSL--LIKAVVSQIEHGILRMVNVEHPQITVLMDC 502 HD + R LI+R GL N KSL +K +V IE+ IL + + Q++ L+D Sbjct: 99 FHDRHGRTVLILRPGL------QNTKSLENQMKHLVYLIENAILNLPE-DQEQMSWLIDF 151 Query: 503 EGLS-PFGFPIHMMRSCAMLLQDHYPNRLSSLIIVRLPQVAQIIMQTFFQVLKPSTRQKV 679 G S PI R +LQ+HYP RL+ + P++ + + + T KV Sbjct: 152 TGWSMSTSVPIKSARETINILQNHYPERLAVAFLYNPPRLFEAFWKIVKYFIDAKTFVKV 211 Query: 680 RII---GRNHLEFLSNHLN--SIPPFLGG 751 + + +E +S + ++P GG Sbjct: 212 KFVYPKNSESVELMSTFFDEENLPTEFGG 240 >At1g75370.1 sec14 cytosolic factor, putative / similar to SP:P24859 from [Kluyveromyces lactis] Length = 530 Score = 54.3 bits (129), Expect = 8e-08 Identities = 56/231 (24%), Positives = 95/231 (40%), Gaps = 31/231 (13%) Frame = +2 Query: 194 QFYAAANGDFARLLSSVKKTIKWR---------QNYTFLSPEELKAWSPFIFWHGHDANQ 346 +F A D + IKWR +++ F +E+ + P + HG D Sbjct: 3 RFLKARKFDIGKTKLMWSNMIKWRKDFGTDTIFEDFEFEEFDEVLKYYPHGY-HGVDKEG 61 Query: 347 RPCLIIRLGLACSNLRSNGKSLLIKAVVSQIEHGIL---RMVNVEHPQI----------- 484 RP I RLGL K + + V I + + + VN++ P Sbjct: 62 RPVYIERLGLV-----DPAKLMQVTTVERFIRYHVREFEKTVNIKLPACCIAAKRHIDSS 116 Query: 485 TVLMDCEGLSPFGFPIHMMRSCAMLLQ------DHYPNRLSSLIIVRLPQVAQIIMQTFF 646 T ++D +G+ GF + +++Q D+YP L + I+ +++ T Sbjct: 117 TTILDVQGV---GFKNFSKPARDLIIQLQKIDNDNYPETLHRMFIINGGSGFKLVWATVK 173 Query: 647 QVLKPSTRQKVRIIGRNHLEFLSNHLNS--IPPFLGGNCSCSNAQTDGCRK 793 Q L P T K+ +IG + L +++ +P FLGG C+C A GC + Sbjct: 174 QFLDPKTVTKIHVIGNKYQNKLLEIIDASQLPDFLGGTCTC--ADRGGCMR 222 >At2g18180.1 putative phosphatidylinositol/phophatidylcholine transfer protein / Length = 558 Score = 53.5 bits (127), Expect = 1e-07 Identities = 55/240 (22%), Positives = 99/240 (40%), Gaps = 29/240 (12%) Frame = +2 Query: 161 VPERLNDDELR-QFYAAANGDFARLLSSVKKTIKWRQNY---TFLSPEELKAWSPFIFW- 325 +P++ +D + +F A D + ++WR+ + T + E K + + Sbjct: 72 LPDKHDDYHMMLRFLKARKFDLEKTNQMWSDMLRWRKEFGADTVMEDFEFKEIDEVLKYY 131 Query: 326 ----HGHDANQRPCLIIRLGLACSNLRSNGKSLLIKAVVSQIEHGIL---RMVNVEHP-- 478 HG D RP I RLG S K + + + + + ++ R NV+ P Sbjct: 132 PQGHHGVDKEGRPVYIERLGQVDST-----KLMQVTTMDRYVNYHVMEFERTFNVKFPAC 186 Query: 479 ---------QITVLMDCEGLSPFGFPIHMMRSCAMLLQ----DHYPNRLSSLIIVRLPQV 619 Q T ++D +G+ F R LQ D+YP L+ + I+ Sbjct: 187 SIAAKKHIDQSTTILDVQGVGLKNFN-KAARDLITRLQKVDGDNYPETLNRMFIINAGSG 245 Query: 620 AQIIMQTFFQVLKPSTRQKVRIIGRNHLEFLSNHLNS--IPPFLGGNCSCSNAQTDGCRK 793 +++ T L P T K+ ++G + L +++ +P FLGG+C+C A GC + Sbjct: 246 FRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELPEFLGGSCTC--ADNGGCMR 303 >At2g21520.1 putative phosphatidylinositol/phosphatidylcholine transfer protein / Length = 531 Score = 53.1 bits (126), Expect = 2e-07 Identities = 57/238 (23%), Positives = 94/238 (38%), Gaps = 29/238 (12%) Frame = +2 Query: 161 VPERLNDDELR-QFYAAANGDFARLLSSVKKTIKWR---------QNYTFLSPEELKAWS 310 +P+R +D + +F A D + I+WR Q++ F E+ Sbjct: 5 LPDRHDDYHMMLRFLKARKFDVEKAKQMWADMIQWRKEFGTDTIIQDFDFEEINEVLKHY 64 Query: 311 PFIFWHGHDANQRPCLIIRLGLACSN--LRSNGKSLLIKAVVSQIEHGILRMVNVEHPQI 484 P + HG D RP I RLG N ++ ++ V + E + ++ P Sbjct: 65 PQCY-HGVDKEGRPIYIERLGKVDPNRLMQVTSMDRYVRYHVKEFERSFM----IKFPSC 119 Query: 485 TV-----------LMDCEGLSPFGFPIHMMRSCAMLLQ----DHYPNRLSSLIIVRLPQV 619 T+ ++D +G+ F R LQ D+YP L + I+ Sbjct: 120 TISAKRHIDSSTTILDVQGVGLKNFN-KSARDLITRLQKIDGDNYPETLHQMFIINAGPG 178 Query: 620 AQIIMQTFFQVLKPSTRQKVRIIGRNHLEFLSN--HLNSIPPFLGGNCSCSNAQTDGC 787 +++ T L P T K+ ++G +L L +N +P FLGG C+C A GC Sbjct: 179 FRLLWNTVKSFLDPKTSAKIHVLGYKYLSKLLEVIDVNELPEFLGGACTC--ADQGGC 234 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,943,986 Number of Sequences: 27288 Number of extensions: 360014 Number of successful extensions: 1117 Number of sequences better than 1.0e-05: 32 Number of HSP's better than 0.0 without gapping: 1051 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1093 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1503203240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264702|gb|BM413072.1|BM413072 EST587399 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62K15 5' end, mRNA sequence (775 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g08640.1 expressed protein / ;supported by full-length cDN... 207 9e-55 >At1g08640.1 expressed protein / ;supported by full-length cDNA: Ceres:35718. Length = 294 Score = 207 bits (526), Expect(2) = 9e-55 Identities = 96/135 (71%), Positives = 114/135 (84%) Frame = +1 Query: 271 NPYEVLGVNPIEGFDMVKAAYARRRKDAERRGDEATLAQLEKAYDKIMMSQLTKRKQGVT 450 NPYEVLGVNPIEGFD +K Y R+ KDA+R GDEAT A LEKAYDK+M +QL RK+GVT Sbjct: 74 NPYEVLGVNPIEGFDKIKQTYGRKLKDAQRSGDEATAALLEKAYDKLMYAQLMNRKKGVT 133 Query: 451 FGSFKVSKEVRYADKQPILPWGPRFTKSDDKDIKINLAISAVFIAWVFINRNAEWKPLQF 630 FGSFKVSK+++YADKQPI+PWGPRF++S D+ INLAIS VF AW+ I RN E+KPLQF Sbjct: 134 FGSFKVSKDIKYADKQPIIPWGPRFSRSSKNDMLINLAISVVFSAWIAIKRNVEYKPLQF 193 Query: 631 LAFAFVYRIFEKLKA 675 ++F FVYRIFEKLK+ Sbjct: 194 MSFVFVYRIFEKLKS 208 Score = 24.6 bits (52), Expect(2) = 9e-55 Identities = 11/12 (91%), Positives = 12/12 (99%) Frame = +3 Query: 738 GKRLLRSLALVF 773 GKRLLRSL+LVF Sbjct: 231 GKRLLRSLSLVF 242 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,306,759 Number of Sequences: 27288 Number of extensions: 274719 Number of successful extensions: 696 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264689|gb|BM413059.1|BM413059 EST587386 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62G23 5' end, mRNA sequence (784 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01220.1 hypothetical protein / similar to unknown protein... 244 e-100 >At1g01220.1 hypothetical protein / similar to unknown protein GB:AAF32477 GI:6957733 from [Arabidopsis thaliana] Length = 1055 Score = 244 bits (622), Expect(2) = e-100 Identities = 122/159 (76%), Positives = 135/159 (84%) Frame = +3 Query: 3 KIELPVRVDFVGGWSDTPPWSLERAGCVLNMAITLEDSLPIGTVIEIEKGTGIFISDDVG 182 K+ELPVRVDFVGGWSDTPPWSLERAG VLNMAITLE SLPIGT+IE GI I DD G Sbjct: 714 KVELPVRVDFVGGWSDTPPWSLERAGYVLNMAITLEGSLPIGTIIETTNQMGISIQDDAG 773 Query: 183 NQLSIEDLSSIALPFEISDPFRLVKSALLVTSVIHEKILQSVALQIRTWANVPRGSGLGT 362 N+L IED SI PFE++DPFRLVKSALLVT ++ E + S L I+TWANVPRGSGLGT Sbjct: 774 NELHIEDPISIKTPFEVNDPFRLVKSALLVTGIVQENFVDSTGLAIKTWANVPRGSGLGT 833 Query: 363 SSILAAAVVKGLLRITDGDESNENVTRLVLVLEQLMGTG 479 SSILAAAVVKGLL+I++GDESNEN+ RLVLVLEQLMGTG Sbjct: 834 SSILAAAVVKGLLQISNGDESNENIARLVLVLEQLMGTG 872 Score = 139 bits (349), Expect(2) = e-100 Identities = 71/101 (70%), Positives = 80/101 (78%) Frame = +1 Query: 478 GGGWQDQIGGLYAGIKFTASFPGIPLRLQVIPLLASPQLIKELQQRLSCSFHWSSSTCTP 657 GGGWQDQIGGLY GIKFT+SFPGIP+RLQV+PLLASPQLI EL+QRL F Sbjct: 872 GGGWQDQIGGLYPGIKFTSSFPGIPMRLQVVPLLASPQLISELEQRLLVVF-TGQVRLAH 930 Query: 658 GACIRVVTRYLQRDNLLVSSIKRLTELAKIAREAFMSCDID 780 +VVTRYLQRDNLL+SSIKRLTELAK REA M+C++D Sbjct: 931 QVLHKVVTRYLQRDNLLISSIKRLTELAKSGREALMNCEVD 971 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,609,263 Number of Sequences: 27288 Number of extensions: 365459 Number of successful extensions: 1137 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1076 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1134 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1445754580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264667|gb|BM413037.1|BM413037 EST587364 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62C23 5' end, mRNA sequence (803 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18420.1 putative protein / non-consensus GC donor splice ... 225 2e-59 >At5g18420.1 putative protein / non-consensus GC donor splice site at exon 1, unknown (C40) protein, Homo sapiens, EMBL:AF103798 Length = 441 Score = 225 bits (573), Expect = 2e-59 Identities = 112/235 (47%), Positives = 160/235 (67%), Gaps = 1/235 (0%) Frame = +2 Query: 26 EESNMLLTMLKAGDHRPFDEIVADFISSFPPHRQFYTCFSLALIL-DEKLLKPAQRLVAF 202 EES ++L++LK+ D RP ++++++F S F R C SL+++L D+++ K +RL+AF Sbjct: 12 EESAIVLSLLKS-DLRPMEDVLSEFDSKFESARYLSVCNSLSMMLQDQQMFKNTERLIAF 70 Query: 203 AILLQVYSSQEPSSNPFISLLVNAACDEGAEQCERAFILQLLXXXXXXXXREVLKQSATD 382 I+ Q YSSQ+PS NPF+S +++AAC+E E+ ERAF+L LL +E+LK SA D Sbjct: 71 GIIYQCYSSQKPSFNPFLSEMISAACNEQLEKSERAFLLHLLQWNSYNNVKEILKLSAVD 130 Query: 383 YMKMFDTSQLSFPQREQLQQQYGSKALPEEFQCLIGNNSVKNSIPDPDVPRGCDSNSLEF 562 Y++ FD S FP+ +LQ++YG KA P + + S+K + DPDVPRGCD NS EF Sbjct: 131 YIRSFDPSTHDFPELGELQREYGDKADPGPSSHIFADYSLKKLLHDPDVPRGCDPNSPEF 190 Query: 563 DLLPGSKPKIGSGDVDETITGLLSNLSFEGLGPQWIRPHPPRLPVLDGELVWLTP 727 D+ G P+IGSGD DE ++G L NL+ GLGP+WIRP PPR PV EL+W+ P Sbjct: 191 DVQAGVNPRIGSGDRDEALSGFLGNLTMGGLGPRWIRPCPPRYPVHQSELLWIDP 245 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,053,013 Number of Sequences: 27288 Number of extensions: 373919 Number of successful extensions: 1046 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1046 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1494360868 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264578|gb|BM412948.1|BM412948 EST587275 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61B12 5' end, mRNA sequence (682 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50000.1 hypothetical protein / predicted by genemark.hmm 243 5e-65 >At1g50000.1 hypothetical protein / predicted by genemark.hmm Length = 277 Score = 243 bits (621), Expect = 5e-65 Identities = 119/170 (70%), Positives = 142/170 (83%) Frame = +2 Query: 125 VVRVKGDEFWHMTRVLRLRIHDRVELFDGKGGLVEGCIQNIDQNGLDIVALENPKSVSPH 304 VVRV+G EFWHM +VLRL+ DRVELF+GKGGLVEGCIQ+ID+ G+D +A E+ K + P Sbjct: 51 VVRVQGSEFWHMAKVLRLKQEDRVELFNGKGGLVEGCIQSIDKTGVDFIAQEDQKVILPQ 110 Query: 305 NTQWHVYAAFGTLKGGRADWLVEKCTELGACSVTPLLTDRSPSISENRVDRLQRVNLAAA 484 QW V+AAFGTLKGGRADWL+EKCTELGA SVTPLLT+RSP ISENRVDRL+RV+ AAA Sbjct: 111 GMQWQVFAAFGTLKGGRADWLIEKCTELGASSVTPLLTERSPIISENRVDRLERVSFAAA 170 Query: 485 KQCQRLHEMVLNPPIKIGGLLPLVKNSKLSFIATAEAKPVFSALSSIKKD 634 KQCQRLH+MVLNPPIK G LL +SKL +ATAEAKP+ +A++S K+ Sbjct: 171 KQCQRLHQMVLNPPIKFGTLL---DHSKLCLVATAEAKPLLNAVNSSAKE 217 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,786,536 Number of Sequences: 27288 Number of extensions: 319549 Number of successful extensions: 830 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 829 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1156603240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264527|gb|BM412897.1|BM412897 EST587224 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61F3 5' end, mRNA sequence (750 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01760.1 double-stranded RNA-specific editase, putative / ... 121 1e-48 >At1g01760.1 double-stranded RNA-specific editase, putative / similar to double-stranded RNA-specific editase GB:AAF69673 GI:7770275 from [Danio rerio] Length = 325 Score = 121 bits (304), Expect(3) = 1e-48 Identities = 57/72 (79%), Positives = 62/72 (85%) Frame = +3 Query: 402 SFHLW*PLVFVASIPPEEFQHSETALTTLTCGYSICWNNSGLHEVILGTTGRKQGTSAKG 581 SF L PL FVA +PP EFQHSETA TLTCGYS+CWN SGLHEVILGTTGRKQGTSAKG Sbjct: 254 SFRLNKPLFFVAPVPPSEFQHSETAQATLTCGYSLCWNYSGLHEVILGTTGRKQGTSAKG 313 Query: 582 AMSPSTESSLCK 617 A+ PST+SS+CK Sbjct: 314 ALYPSTQSSICK 325 Score = 58.2 bits (139), Expect(3) = 1e-48 Identities = 27/58 (46%), Positives = 42/58 (71%) Frame = +1 Query: 163 RGALLSYFLEPIYISSVTIGQSHIASKTSIIEDEVMRATYERILPLSNKLMDPFQVNK 336 +GALL L+P+YIS++T+GQS + + D + R+ YERILPLS++L+ F++NK Sbjct: 202 QGALLYQVLQPVYISTITVGQSLHSPDNFSLADHLRRSLYERILPLSDELLTSFRLNK 259 Score = 52.4 bits (124), Expect(3) = 1e-48 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 92 VMRKPGRGDTTLSVSCSDKIARWNV 166 V RKPGRG+TTLSVSCSDKIARWNV Sbjct: 174 VQRKPGRGETTLSVSCSDKIARWNV 198 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,201,089 Number of Sequences: 27288 Number of extensions: 393849 Number of successful extensions: 1106 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1106 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264514|gb|BM412884.1|BM412884 EST587211 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61B15 5' end, mRNA sequence (735 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g46220.1 putative protein / KIAA0776 protein, Homo sapiens... 269 1e-72 >At3g46220.1 putative protein / KIAA0776 protein, Homo sapiens, EMBL:AB018319; supported by cDNA: gi_14334491_gb_AY034937.1_ Length = 530 Score = 269 bits (687), Expect = 1e-72 Identities = 137/215 (63%), Positives = 173/215 (79%), Gaps = 1/215 (0%) Frame = +1 Query: 70 DESFLNMQLYEKALDLFEDEPSTSVLLHKHLLRTTGTSIVDTXXXXXXXXXXXXXGVPVE 249 DESFLNMQLYEKALDLFED+ ST+V+LH+HLLRTT +I DT G VE Sbjct: 280 DESFLNMQLYEKALDLFEDDQSTAVVLHRHLLRTTAATIADTLLHGLDIHNKMKNGTEVE 339 Query: 250 PQAPES-ILLSPGDRSALAKSLTGSMSAKAIATVEALEGKRVESFMSALREVAEESGLAL 426 + +LL +R+ALAK+L GS+S KA+A VEALEGKRV++FM R++AEESGL L Sbjct: 340 ESKTQDLVLLDSSERTALAKNLNGSLSKKALALVEALEGKRVDTFMVTFRDLAEESGLVL 399 Query: 427 KKLDKKLERTLLHSYRKDLTSQVSAETDPVSLLPQVISLLYVQVHGKALQAPGRAISAAV 606 KKLDKKLERTLLHSYRKDL SQVS E+DP++LL +V+SLL++++H KALQAPGRAI+AA+ Sbjct: 400 KKLDKKLERTLLHSYRKDLISQVSTESDPIALLAKVVSLLFIKIHNKALQAPGRAIAAAI 459 Query: 607 SRLKDKLDDSAFKTLVDYQSGTVSVLALMAAATGE 711 S LK+KLD+SA+KTL DYQ+ TV++LALM+A++GE Sbjct: 460 SHLKEKLDESAYKTLTDYQTATVTLLALMSASSGE 494 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.131 0.346 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,769,455 Number of Sequences: 27288 Number of extensions: 284599 Number of successful extensions: 726 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264458|gb|BM412828.1|BM412828 EST587155 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61C22 5' end, mRNA sequence (621 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28200.1 putative protein / hypothetical protein - Schizos... 275 1e-74 >At4g28200.1 putative protein / hypothetical protein - Schizosaccharomyces pombe, PID:e1295810; supported by cDNA: gi_18252168 Length = 648 Score = 275 bits (704), Expect = 1e-74 Identities = 131/212 (61%), Positives = 162/212 (75%), Gaps = 6/212 (2%) Frame = +3 Query: 3 EIYRLATTRFKGDIELWFQYLEFCRERRNGRMKKALAQVIRFHPKVPGVWIYAAAWEFDX 182 EIYRLAT R+KGDI LWF+YLEFC+++R+GRMKKALAQ IRFHPKV GVWIYAA+WEFD Sbjct: 98 EIYRLATMRYKGDINLWFRYLEFCKQKRHGRMKKALAQAIRFHPKVAGVWIYAASWEFDR 157 Query: 183 XXXXXXXXXXMHSGLRACPTSEDLWVEYLRMELTYLNKLKARKVVLGEDEGTLARSGNSA 362 M +GLR C SEDLWVEYLRMELT+LNKLKARKV LGED+G+L R + Sbjct: 158 NLNVTAARALMLNGLRVCSNSEDLWVEYLRMELTFLNKLKARKVALGEDKGSLVRDTKTV 217 Query: 363 KEEQWRDENKELFIVLDDKREEDKLSNLHDG------DSKEKLDLFRKQGLSVLQTVYGG 524 ++EQW+DENKELF+ LD+K +K N D D EK+D +++G +VLQT+Y G Sbjct: 218 EDEQWKDENKELFMSLDEKEGNEKEENDEDSIVEDVEDVTEKVDFLKEKGSNVLQTIYSG 277 Query: 525 SIRALPSSFSLRTKFLDILEATDLCHSEDMRN 620 ++ A+PSSF LR +FL+ILEATDL HS++MRN Sbjct: 278 AVEAIPSSFDLRKRFLEILEATDLAHSDEMRN 309 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,719,472 Number of Sequences: 27288 Number of extensions: 265100 Number of successful extensions: 852 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 848 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 990590196 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264438|gb|BM412808.1|BM412808 EST587135 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61O17 5' end, mRNA sequence (763 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g48050.1 regulatory protein, putative / contains Pfam prof... 248 2e-84 >At1g48050.1 regulatory protein, putative / contains Pfam profile: PF02197 Regulatory subunit of type II PKA R-subunit; supported by cDNA: gi_12006421_gb_AF283758.1_AF283758 Length = 680 Score = 248 bits (632), Expect(3) = 2e-84 Identities = 109/178 (61%), Positives = 148/178 (82%) Frame = +2 Query: 53 PTSLLGALRTRNISPVTIYRGDLEISAQLKIKVWVYKKTSEEKFPTLKKYSERTPTTDKF 232 P SLLG+L+TR ++PVT++RGDLEI+ +KIKVWVYKK +EE+ PTLK YS++ P TDKF Sbjct: 201 PLSLLGSLKTRRVAPVTLFRGDLEINPTMKIKVWVYKKVAEERLPTLKMYSDKAPPTDKF 260 Query: 233 GAHDIKVEYENKIIEDPNKVVPPEQRIKGFQYGPQVVPISSAELEAVKFKPEKSVKLLGF 412 H++KV+Y+ K+ + +V+ PE+RIKGF+YGPQV+PIS ++E +KFK +K +KLLGF Sbjct: 261 AKHEVKVDYDYKVTAESTEVIAPEERIKGFRYGPQVIPISPDQIETLKFKTDKGMKLLGF 320 Query: 413 TDSSNIMRHYYLKDVNIFIAEPGNKNAILALSALARAMKEMNKVAIVRCVWRQGQGNV 586 T++SNI+RHYY+KDVNI + +P + ++LA+SA+AR MKE NKVAIVRCVWR GQGNV Sbjct: 321 TEASNILRHYYMKDVNIVVPDPSKEKSVLAVSAIAREMKETNKVAIVRCVWRNGQGNV 378 Score = 66.2 bits (160), Expect(3) = 2e-84 Identities = 29/39 (74%), Positives = 34/39 (86%) Frame = +3 Query: 591 VGVLTPNVSDKDNTPDSFYFNILPFAEDVRGFPVSFFQQ 707 VGVLTPNVS++D+TPDSFYFN+LPFAEDVR FP F + Sbjct: 380 VGVLTPNVSERDDTPDSFYFNVLPFAEDVREFPFPSFNK 418 Score = 37.7 bits (86), Expect(3) = 2e-84 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = +1 Query: 682 DFQFPSFSNLPSSMQPNEKQQDAADKL 762 +F FPSF+ LPSS +P+E+QQ AD L Sbjct: 410 EFPFPSFNKLPSSWKPDEQQQAVADNL 436 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,064,150 Number of Sequences: 27288 Number of extensions: 351372 Number of successful extensions: 972 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 972 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1383666960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264423|gb|BM412793.1|BM412793 EST587120 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61M9 5' end, mRNA sequence (736 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g07950.1 expressed protein / ;supported by full-length cD... 275 1e-74 >At3g07950.1 expressed protein / ;supported by full-length cDNA: Ceres:13017. Length = 304 Score = 275 bits (704), Expect = 1e-74 Identities = 128/202 (63%), Positives = 160/202 (78%) Frame = +3 Query: 6 TVYGAIISTIGLLFLGKLLEPIWGSREFLKFIFIVNFLTSVFVFITAISLYYVTRLEIYL 185 +VYG + ST+ LLF+GK LEP+WGS EFLKFIF+VNFLT + VF+TAI+LYY+TRLE+YL Sbjct: 63 SVYGVVFSTVSLLFMGKFLEPVWGSTEFLKFIFVVNFLTYLCVFVTAIALYYITRLEVYL 122 Query: 186 YMPISGFQGVLSGFLVGVKQIMPDQELSILKLKAKWLPSLALLFSIAISFFTADSVSYLP 365 YMP +GF GVL+G LVG+KQI+PDQE+ +LK+KAKWLPS+ L+ SIA SFFT DS +YLP Sbjct: 123 YMPFAGFHGVLAGLLVGIKQIIPDQEILLLKIKAKWLPSIMLILSIASSFFTLDSAAYLP 182 Query: 366 TIVFGTYLGWIYLRYWQKKPETKLKGXXXXXXXXXXXXXXXLRPVIDPIATIFERMLCGR 545 T++FGTY+GW+YLRY Q++PETKL+G LRPVIDPIA IF RMLCGR Sbjct: 183 TLIFGTYMGWLYLRYLQRRPETKLRGDPSDDFAFSTFFPELLRPVIDPIALIFHRMLCGR 242 Query: 546 RSETSNEERGYTLGGSTLPGSD 611 + TS E+ Y+ G+ LPGSD Sbjct: 243 SNATS-EDHDYSTSGAPLPGSD 263 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,049,441 Number of Sequences: 27288 Number of extensions: 303233 Number of successful extensions: 894 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 871 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 894 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264401|gb|BM412771.1|BM412771 EST587098 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61G19 5' end, mRNA sequence (593 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04780.1 hypothetical protein / 160 4e-40 >At4g04780.1 hypothetical protein / Length = 381 Score = 160 bits (406), Expect = 4e-40 Identities = 88/121 (72%), Positives = 94/121 (76%), Gaps = 1/121 (0%) Frame = +2 Query: 2 NTFGTLQRDAPPVRLS-XXXXXXXXXXXTEDSANVAEQPKQMSAAFVKAAKQQFDVLVAA 178 N FGTLQRDAPPV+LS T+D+ EQPKQ+SA VKAAK QFD LVAA Sbjct: 262 NAFGTLQRDAPPVQLSPNYPEPPATTTVTDDATPFPEQPKQLSAGLVKAAK-QFDALVAA 320 Query: 179 LPLSDGSEEAQLKRIAELQAENDAVGQELQKQLEAAEKELKQVQELFNQATDNCLNLKKP 358 LPLS+G E AQLKRIAELQ END VGQELQKQLEAAEKELKQVQELF QA DNCLN+KKP Sbjct: 321 LPLSEGGEGAQLKRIAELQVENDLVGQELQKQLEAAEKELKQVQELFGQAADNCLNMKKP 380 Query: 359 E 361 E Sbjct: 381 E 381 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,208,095 Number of Sequences: 27288 Number of extensions: 203439 Number of successful extensions: 571 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 922006972 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264365|gb|BM412735.1|BM412735 EST587062 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61A11 5' end, mRNA sequence (627 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g28120.1 expressed protein / ;supported by full-length cDN... 262 9e-71 >At1g28120.1 expressed protein / ;supported by full-length cDNA: Ceres:106626. Length = 306 Score = 262 bits (670), Expect = 9e-71 Identities = 125/195 (64%), Positives = 158/195 (80%) Frame = +3 Query: 42 LKLMTGKKYKDDDIMQQHSAIQAEQAVKVPFLGDKEPLSSLEAEYHLGNSIVLEKIKVLS 221 + + G+++ + ++ + Q E+A KVP++GDKEPLSSL AEY G+ I+LEKIK+L Sbjct: 18 ISAIKGEEWGNCSSVEDQPSFQEEEAAKVPYVGDKEPLSSLAAEYQSGSPILLEKIKILD 77 Query: 222 EQYAAIRRTRGDGNCFFRSFMFGYLEHILESQDHNEVQHIKSNIEECKKTLQSLGYAEFT 401 QY IRRTRGDGNCFFRSFMF YLEHILESQD EV IK N+E+C+KTLQ+LGY +FT Sbjct: 78 SQYIGIRRTRGDGNCFFRSFMFSYLEHILESQDRAEVDRIKVNVEKCRKTLQNLGYTDFT 137 Query: 402 FEDFFALFLEQLDSVLSGSEDSISHDELLCRSRDPSISDYGVMFFRFVTSGEIRKRSEFF 581 FEDFFALFLEQLD +L G+E+SIS+DEL+ RSRD S+SDY VMFFRFVT+G+IR R++FF Sbjct: 138 FEDFFALFLEQLDDILQGTEESISYDELVNRSRDQSVSDYIVMFFRFVTAGDIRTRADFF 197 Query: 582 EPFILRLNNTSVEQF 626 EPFI L+N +V+QF Sbjct: 198 EPFITGLSNATVDQF 212 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,967,515 Number of Sequences: 27288 Number of extensions: 264705 Number of successful extensions: 828 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 828 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1008438668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264348|gb|BM412729.1|BM412729 EST587045 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG60N20 5' end, mRNA sequence (751 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39690.1 putative protein / ; supported by cDNA: gi_13605... 215 2e-56 >At4g39690.1 putative protein / ; supported by cDNA: gi_13605658_gb_AF361810.1_AF361810 Length = 650 Score = 215 bits (547), Expect(2) = 2e-56 Identities = 118/238 (49%), Positives = 140/238 (58%) Frame = +2 Query: 2 YISKDGKLVLDVLQVIHETESRQAELDARLFAXXXXXXXXXXXXXXXDARARELMYAERE 181 Y+++DGKLVLD L IH E +QA LDA++FA D RARELM E Sbjct: 318 YMTEDGKLVLDFLAAIHAAEKQQAHLDAQVFAEELRALKEKYENELRDLRARELMRIEEA 377 Query: 182 ALLDKELKKERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLDAAIA 361 A+LDKELK+ER ++ + IA Sbjct: 378 AILDKELKRERTKAAAAIKAIQERMEDKLKAELEQKETEAQLALSKAEELAKAEMISTIA 437 Query: 362 SEKASQIEKMAEANLHINALCMAFYARSEEVRQTHSVHKLALGVLALEDALSRGLPIQKE 541 EKA+QIEKMAEA+L+I AL MAFYARSEE RQ+HSVHKLALG LAL+D LS+GLP+QKE Sbjct: 438 KEKAAQIEKMAEADLNIKALSMAFYARSEEARQSHSVHKLALGALALDDTLSKGLPVQKE 497 Query: 542 LENLHTSLEGIXXXXXXXXXXXXXPEETQRYGSDTVLQLNHKFDTLKGTLRHFSLIPP 715 ++ L T LEG PEE + G+DTVLQLN KFDTLKGTLRHFSLIPP Sbjct: 498 IDTLQTYLEGTHKDSILGLVLSSLPEEARSNGTDTVLQLNQKFDTLKGTLRHFSLIPP 555 Score = 22.3 bits (46), Expect(2) = 2e-56 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 721 GGGILTHSLA 750 GGGIL HSLA Sbjct: 557 GGGILAHSLA 566 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,256,594 Number of Sequences: 27288 Number of extensions: 276801 Number of successful extensions: 668 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264301|gb|BM412671.1|BM412671 EST586998 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG60F2 5' end, mRNA sequence (637 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g17690.1 expressed protein / ; supported by cDNA: gi_15810... 298 1e-81 >At1g17690.1 expressed protein / ; supported by cDNA: gi_15810522_gb_AY056300.1_ Length = 754 Score = 298 bits (764), Expect = 1e-81 Identities = 141/213 (66%), Positives = 176/213 (82%), Gaps = 4/213 (1%) Frame = +3 Query: 9 YLDGQAPFYRQSIILSSHINPDINGLFNHHCLNHEGKVKLASEYKGVLPKVVLQIRQIYE 188 YLDG A FYRQSIILSS++ P++N LF HCLN++GK+K+A EYKGVL KV+L +RQIYE Sbjct: 527 YLDGHARFYRQSIILSSYLTPEMNSLFGRHCLNYKGKMKMACEYKGVLEKVLLPVRQIYE 586 Query: 189 RFDANTAEDADDARFDYFTKKVFPKIKDSTQGGIMLFISSYFEFIRVRNFLKSQEASFCL 368 RFDA + DDAR +YFTKK+FPKIKDS QGG+M+FI SYFEF+R+RNFL +Q SFCL Sbjct: 587 RFDAASITQVDDARLEYFTKKIFPKIKDSVQGGVMIFIHSYFEFVRLRNFLNTQNTSFCL 646 Query: 369 LGEYTEQSDISRARGWFFDGKKKIMLYTERAHFYHRYKIRGIQNLIIYSLPERKEFYPEV 548 LG+Y + +DISRAR FF G +KIMLYTERA+FY RYKIRGI+NLI+YSLPERKEFYPE+ Sbjct: 647 LGDYAKNADISRAREQFFVGSRKIMLYTERAYFYKRYKIRGIKNLILYSLPERKEFYPEI 706 Query: 549 VNLLQGSA----CTVLFSRYDQLRLDRIVGTAA 635 +N+L+ + T LFSR+D L+L+RIVG+ + Sbjct: 707 MNMLEEGSHDMMSTALFSRFDMLQLERIVGSTS 739 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,421,768 Number of Sequences: 27288 Number of extensions: 277068 Number of successful extensions: 711 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264265|gb|BM412635.1|BM412635 EST586962 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG60N15 5' end, mRNA sequence (785 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g42990.1 bZIP family transcription factor / contains Pfam ... 114 6e-26 At2g40950.1 bZIP family transcription factor / similar to Atb... 50 1e-06 At3g17610.1 bZIP family transcription factor / similar to TGA... 47 9e-06 >At1g42990.1 bZIP family transcription factor / contains Pfam profile: PF00170: bZIP transcription factor; supported by cDNA: gi_15028322_gb_AY045964.1_ Length = 295 Score = 114 bits (285), Expect = 6e-26 Identities = 86/247 (34%), Positives = 120/247 (47%), Gaps = 16/247 (6%) Frame = +2 Query: 11 EQLLMNDDDFGLVS----DPQFAAESLSDFLVXXXXXXXXXXXXAEQAIGFSDPKVSSAD 178 E LMND++ S D Q ++ ++D LV A + D ++ D Sbjct: 47 ENQLMNDENHQEESFVELDQQSVSDFIADLLVDYPTSDSGSVDLAADKVLTVDSPAAADD 106 Query: 179 QDKH--------KVSQSPS---DGDDELNNHDPVDKKRKRQLRNRDAAVRSRERKKLYVR 325 K K + S S D DDE + D V KKR+R++RNRDAAVRSRERKK YV+ Sbjct: 107 SGKENSDLVVEKKSNDSGSEIHDDDDEEGDDDAVAKKRRRRVRNRDAAVRSRERKKEYVQ 166 Query: 326 DLELKSRYFESECKRLGFVLQCCLAENQALRFSLHNSSANGVS-MTKQESAVXXXXXXXX 502 DLE KS+Y E EC RLG +L+C +AENQ+LR+ L + N + M+KQESAV Sbjct: 167 DLEKKSKYLERECLRLGRMLECFVAENQSLRYCLQKGNGNNTTMMSKQESAVLLLESLLL 226 Query: 503 XXXXXXXXITCLLILPSQTWSVPEESQGSRNHGLLVPIKEGKKTSRILLFLSFMMSKRCK 682 + + + P + + + +L + K S +S+RCK Sbjct: 227 GSLLWLLGVNFICLFPYMSHTKCCLLRPEPEKLVLNGLGSSSKPSYT------GVSRRCK 280 Query: 683 ASRSRMK 703 SR RMK Sbjct: 281 GSRPRMK 287 >At2g40950.1 bZIP family transcription factor / similar to AtbZIP transcription factor GI:17065880 from [Arabidopsis thaliana]; contains Pfam profile: bZIP transcription factor PF00170 Length = 721 Score = 50.1 bits (118), Expect = 1e-06 Identities = 31/79 (39%), Positives = 41/79 (51%) Frame = +2 Query: 191 KVSQSPSDGDDELNNHDPVDKKRKRQLRNRDAAVRSRERKKLYVRDLELKSRYFESECKR 370 K +S D D + +KKR R +RNR++A SR+RKK YV +LE K R S Sbjct: 210 KYRRSGEDADASAVTGEEDEKKRARLMRNRESAQLSRQRKKHYVEELEEKVRNMHSTITD 269 Query: 371 LGFVLQCCLAENQALRFSL 427 L + +AEN LR L Sbjct: 270 LNGKISYFMAENATLRQQL 288 >At3g17610.1 bZIP family transcription factor / similar to TGACG-motif binding factor GI:2934884 from [Glycine max]; contains Pfam profile: PF00170 bZIP transcription factor; supported by full-length cDNA: Ceres: 35429. Length = 135 Score = 47.4 bits (111), Expect = 9e-06 Identities = 38/116 (32%), Positives = 54/116 (45%), Gaps = 26/116 (22%) Frame = +2 Query: 167 SSADQDKHKVSQSP-----SDGDDELNN------------------HDPVDKKR---KRQ 268 SS+ KHK + S DD +NN +PVDK+ KR Sbjct: 12 SSSSHKKHKTAAGSTCVLSSSADDGVNNPELDQTQNGVSTAKRRRGRNPVDKEYRSLKRL 71 Query: 269 LRNRDAAVRSRERKKLYVRDLELKSRYFESECKRLGFVLQCCLAENQALRFSLHNS 436 LRNR +A ++RERKK+YV DLE ++ ++ +L + EN LR L N+ Sbjct: 72 LRNRVSAQQARERKKVYVSDLESRANELQNNNDQLEEKISTLTNENTMLRKMLINT 127 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,771,245 Number of Sequences: 27288 Number of extensions: 317901 Number of successful extensions: 1232 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 1157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1225 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264249|gb|BM412619.1|BM412619 EST586946 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG60J23 5' end, mRNA sequence (658 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18410.1 putative protein / p53 inducible protein PIR121, ... 337 4e-93 >At5g18410.1 putative protein / p53 inducible protein PIR121, Homo sapiens, EMBL:AF160973 Length = 1235 Score = 337 bits (863), Expect = 4e-93 Identities = 165/218 (75%), Positives = 191/218 (86%) Frame = +1 Query: 1 LGLIPGADGQILHSQEGGDSPMVTLFKSATTATMSNPNCTNPTSFHTISRQAEAADLLYK 180 LGLIPGA+GQI+++Q+G +SP+V L KSAT+A +S+P C NP +F+T+S+QAEAADLLYK Sbjct: 989 LGLIPGAEGQIVNAQDG-ESPLVNLLKSATSAVVSSPGCLNPAAFYTMSKQAEAADLLYK 1047 Query: 181 ANINTGSVLEYALAFTSAALDKYCSKWSAAPKTGFIDITTSKDFYRIFSGLQIEYLEESI 360 AN+N GSVLEY LAFTSA+LDKYCSKWSA PKTGF+DITTSKDFYRI+ GLQI YLEE Sbjct: 1048 ANMNGGSVLEYTLAFTSASLDKYCSKWSAPPKTGFVDITTSKDFYRIYGGLQIGYLEEIT 1107 Query: 361 QLQSNTYEMLGDSVAWGGCTIIYLLGQQLHFELFDFSHQVLNVAEVESVAISPTQKNPNF 540 QS +E+LGDS+AWGGCTIIYLLGQQLHFELFDFS+QVLNV+EVE+V+ S T +NP Sbjct: 1108 APQSAQHEVLGDSIAWGGCTIIYLLGQQLHFELFDFSYQVLNVSEVETVSASHTHRNPQI 1167 Query: 541 LQGIEGLLEAMKKARRLNNHVFSMLKARCPLEDKQACA 654 QG EGLLE MKKARRLNNHVFSMLKARCPLEDK ACA Sbjct: 1168 HQGWEGLLEGMKKARRLNNHVFSMLKARCPLEDKTACA 1205 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,591,775 Number of Sequences: 27288 Number of extensions: 307124 Number of successful extensions: 737 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 735 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1097681028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264154|gb|BM412524.1|BM412524 EST586851 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG60G20 5' end, mRNA sequence (763 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g15140.1 expressed protein / Contains a PF|00175 Oxidoredu... 272 2e-73 >At1g15140.1 expressed protein / Contains a PF|00175 Oxidoreductase FAD/NADH-binding domain. ESTs gb|H76345 and gb|AA651465 come from this gene; supported by cDNA: gi_15451091_gb_AY054626.1_ Length = 295 Score = 272 bits (695), Expect(2) = 2e-73 Identities = 130/190 (68%), Positives = 153/190 (80%) Frame = +1 Query: 157 QDTNLWTTAPLVTVSPAAESLFHVTIDVSDYPDLANSHTKAGQYLQLRIPDVEKXXXXXX 336 QD +LWT APL + AAESLFH++ID+S+ PDL S+T+ GQYLQ+R+PDVEK Sbjct: 53 QDASLWTPAPLSLIESAAESLFHISIDISNAPDLVASYTRPGQYLQIRVPDVEKPSFMAI 112 Query: 337 XXXXXXXXXKGVFEFLVKSISGSTAELLCGLQKGDVVELSQVMGKGFDLDQISPAEEYQT 516 +G FEFLVKSI+GSTAE+LCGL+KG+ VELS VMG GF++D I P EEY T Sbjct: 113 ASPPSLASSRGAFEFLVKSIAGSTAEILCGLKKGETVELSSVMGNGFNIDLIDPPEEYPT 172 Query: 517 VVIFATGSGISPIRSLIEAGFGADRRSDVRVYYGARNLKRMAYQDKFENWASSGVKVVPV 696 V+IFATGSGISPIRSLIE+GFGADRRSDVR+YYGARNL RMAYQ+KF+ W S+GVKVVPV Sbjct: 173 VLIFATGSGISPIRSLIESGFGADRRSDVRLYYGARNLNRMAYQEKFKEWESAGVKVVPV 232 Query: 697 LSQPDDAWKG 726 LSQPDD WKG Sbjct: 233 LSQPDDGWKG 242 Score = 21.9 bits (45), Expect(2) = 2e-73 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 735 GYVQAAFAR 761 GYVQAAFAR Sbjct: 245 GYVQAAFAR 253 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,058,584 Number of Sequences: 27288 Number of extensions: 342291 Number of successful extensions: 1081 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1018 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1078 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1383666960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264015|gb|BM412385.1|BM412385 EST586712 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG59L20 5' end, mRNA sequence (721 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g17930.1 expressed protein / ;supported by full-length cDN... 105 2e-23 >At3g17930.1 expressed protein / ;supported by full-length cDNA: Ceres:20484. Length = 190 Score = 105 bits (262), Expect = 2e-23 Identities = 60/141 (42%), Positives = 76/141 (53%), Gaps = 1/141 (0%) Frame = +3 Query: 144 VSHNMSMKKVPRMITRASSEPSGSSDGALGQNKT-PFGYTRKDXXXXXXXXXXXXXXXKS 320 +S ++ + RM R SS + + D + + KT PFGYTRKD +S Sbjct: 49 LSSSVEKGEKQRMRCRVSSNSTETEDDSATKTKTTPFGYTRKDVILIGVGVTALGIGLES 108 Query: 321 GLEFLGFDPXXXXXXXXXXXXXXXXXXWISTYIFRVSNKEMTYAQQLRDYESKVMEKRLE 500 GLE++G DP WISTYIFRV NKEMTYAQQLRDYES+VM+KRLE Sbjct: 109 GLEYVGVDPLQAGNAVQLILVLGLTLGWISTYIFRVGNKEMTYAQQLRDYESQVMQKRLE 168 Query: 501 SLTEAXXXXXXXXXXXXKTRL 563 SL+EA KT++ Sbjct: 169 SLSEAELEALMAQVDEEKTKV 189 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,669,912 Number of Sequences: 27288 Number of extensions: 313509 Number of successful extensions: 899 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 895 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1272263564 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263890|gb|BM412260.1|BM412260 EST586587 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG59B7 5' end, mRNA sequence (724 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g18340.1 expressed protein / similar to hypothetical prote... 308 2e-84 >At1g18340.1 expressed protein / similar to hypothetical protein GB:AAF25986 GI:6714290 from [Arabidopsis thaliana];supported by full-length cDNA: Ceres:126051. Length = 301 Score = 308 bits (788), Expect = 2e-84 Identities = 163/240 (67%), Positives = 193/240 (79%), Gaps = 13/240 (5%) Frame = +1 Query: 43 MTPVSSKLYADDVSLLMVLVDTNPYFWSSMKNTAFTFPKFISHVLAFLNSILLLNQMNQV 222 M ++SK Y+DDVSLL++L+DTNP FWS+ T+ TF +F+SHVLAFLN++L LNQ+NQV Sbjct: 1 MPAIASKQYSDDVSLLVLLLDTNPLFWST---TSITFSQFLSHVLAFLNAVLGLNQLNQV 57 Query: 223 VVIATGYNSCDYVFDSS-TSSMQRAEC-----------LLEKLEDFVDKDESLSQED-SV 363 VVIATGY+SCDY++DSS TS+ E LL+KLE+FV KDE LS+E+ S Sbjct: 58 VVIATGYSSCDYIYDSSLTSNHGNFESNGTGMPAIFGSLLKKLEEFVTKDEELSKEEVSE 117 Query: 364 DGVGFSLLSGALSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAVMNSIFSAQRS 543 D + LLSG+LSMALCYIQRVFRSG LHPQPRILCL GSPDGP QYVAVMNSIFSAQR Sbjct: 118 DRIPSCLLSGSLSMALCYIQRVFRSGHLHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRL 177 Query: 544 MVPIDSCVIGSQHSAFLQQASYITGGVYLKPQVSDGLFQYLSTVFATDLHSRSFLALPRP 723 MVPIDSC IG Q+SAFLQQASYITGGV+ P+ DGLFQYL+T+FATDLHSR F+ LP+P Sbjct: 178 MVPIDSCYIGVQNSAFLQQASYITGGVHHTPKQLDGLFQYLTTIFATDLHSRGFVQLPKP 237 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,789,851