BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18815472|gb|BM536226.1|BM536226 EST589248 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG71P24 5' end, mRNA sequence (133 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g43690.1 unknown protein / ; supported by cDNA: gi_17978984 71 1e-13 >At1g43690.1 unknown protein / ; supported by cDNA: gi_17978984 Length = 599 Score = 70.9 bits (172), Expect = 1e-13 Identities = 30/38 (78%), Positives = 34/38 (88%) Frame = +1 Query: 19 VEVGFITLLESLNFCKVGLHLKCPAWQ*WVVGSESHYT 132 V+VGF+TLLESLNFCKVG +LKCP W WV+GSESHYT Sbjct: 363 VDVGFLTLLESLNFCKVGQNLKCPKWPIWVIGSESHYT 400 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,723,913 Number of Sequences: 27288 Number of extensions: 30816 Number of successful extensions: 97 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 11,516,596 effective HSP length: 19 effective length of database: 10,998,124 effective search space used: 263954976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18815386|gb|BM536175.1|BM536175 EST589197 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG71B2 5' end, mRNA sequence (524 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g43640.1 putative signal recognition particle protein 14kD, A... 129 9e-31 >At2g43640.1 putative signal recognition particle protein 14kD, ATSRP14 / ; supported by full-length cDNA: Ceres: 97249. Length = 121 Score = 129 bits (324), Expect = 9e-31 Identities = 63/105 (60%), Positives = 76/105 (72%) Frame = +2 Query: 26 MVRLQPDPFLNELTSMFERTTEHGSVWVTLKHSSDKSKAQRNKMKTAGETLEFKCLIRAT 205 MV LQ DPFLNELTSMFE++ E GSVWVTLK SS KSK Q+ K+ + GE++E++CLIRAT Sbjct: 1 MVLLQLDPFLNELTSMFEKSKEKGSVWVTLKRSSLKSKVQKRKLSSVGESIEYRCLIRAT 60 Query: 206 DGKKNISTMVGAKDHQRFQASYXXXXXXXXXXXXXXXXXDKRKAT 340 DGKK +ST VGAKDHQRFQASY D++K+T Sbjct: 61 DGKKTVSTSVGAKDHQRFQASYATILKAHMTALKKRERKDRKKST 105 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,353,993 Number of Sequences: 27288 Number of extensions: 189952 Number of successful extensions: 488 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 487 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 727283772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18815158|gb|BM536049.1|BM536049 EST589071 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG71A12 5' end, mRNA sequence (661 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g63810.1 hypothetical protein / similar to hypothetical pr... 127 3e-54 >At1g63810.1 hypothetical protein / similar to hypothetical protein GB:CAA22881 [Schizosaccharomyces pombe] Length = 1026 Score = 127 bits (320), Expect(2) = 3e-54 Identities = 76/159 (47%), Positives = 94/159 (58%), Gaps = 18/159 (11%) Frame = +3 Query: 3 KTAFLLRIAE-------------SLQNNWGMMFTATEDDVDVLMSGYAFRLKISHERALG 143 K+AFLL+IAE +LQN G+ TATED+VDV + GYAFRL+I HER L Sbjct: 625 KSAFLLKIAERWVKLLFVTLQTINLQNVKGIPCTATEDNVDVFIGGYAFRLRILHERGLS 684 Query: 144 LVTGQSNNSRH-----QWSLSADRKLLLQHQHASKINALRGRYPIYGPIVRLAKRWVSAH 308 LV +S S + S D+ L ++ QHAS IN L+GR+P+Y P+ RLAKRWVSAH Sbjct: 685 LVKRESEFSSFGVDPVKHVSSTDKMLFIRSQHASMINGLQGRFPVYAPVARLAKRWVSAH 744 Query: 309 LLSTVLTEEAVELLVSNXXXXXXXXXXXXSRITGFFEVL 425 L S L EEA+ELLV+ SRI GF L Sbjct: 745 LFSGCLAEEAIELLVAYLFLTPLPLGVPSSRINGFLRFL 783 Score = 102 bits (253), Expect(2) = 3e-54 Identities = 48/83 (57%), Positives = 61/83 (72%) Frame = +1 Query: 412 FLRFLRLLSEYDWAFSPLIVDFDGDFSTEEKNKINENFMRSREEHEKDTQKSSPAMFLAT 591 FLRFLRLL++Y+W F PLIVD + DF ++ +IN+NFM SR+ +E+D Q S AMFLA Sbjct: 779 FLRFLRLLADYEWMFYPLIVDINNDFGRNDEKEINDNFMSSRKGYEEDKQNISSAMFLAA 838 Query: 592 KYDVASEAWTRSSPTTAELRRLV 660 YD ASEAWT +SP E +RLV Sbjct: 839 PYDKASEAWTSTSPNLLEQKRLV 861 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,588,433 Number of Sequences: 27288 Number of extensions: 251373 Number of successful extensions: 775 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 774 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1106605264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18814903|gb|BM535903.1|BM535903 EST588925 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG70I17 5' end, mRNA sequence (623 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13040.1 hypothetical protein / 108 3e-24 >At4g13040.1 hypothetical protein / Length = 196 Score = 108 bits (269), Expect = 3e-24 Identities = 52/61 (85%), Positives = 56/61 (91%), Gaps = 3/61 (4%) Frame = +1 Query: 448 NQEPCLMRGVYFKNMKWQAAIKVDKKQIHLGTVGTQEEAARL---AAFMCGKEPNFELSE 618 NQEPCLMRGVY+KNMKWQAAIKV+KKQIHLGT +QEEAARL AAFMCG+EPNFELSE Sbjct: 81 NQEPCLMRGVYYKNMKWQAAIKVEKKQIHLGTFSSQEEAARLYDRAAFMCGREPNFELSE 140 Query: 619 E 621 E Sbjct: 141 E 141 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,883,421 Number of Sequences: 27288 Number of extensions: 261800 Number of successful extensions: 660 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 659 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 999514432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18814463|gb|BM535648.1|BM535648 EST588670 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG67J13 5' end, mRNA sequence (589 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g07910.1 translation elongation factor EF-1 alpha / identi... 317 2e-87 >At1g07910.1 translation elongation factor EF-1 alpha / identical to GB:AAB07881 from [Arabidopsis thaliana] (Mol. Gen. Genet. 219 (1-2), 106-112 (1989)) Length = 1081 Score = 317 bits (813), Expect = 2e-87 Identities = 144/195 (73%), Positives = 175/195 (88%) Frame = +1 Query: 1 IAPSSPNISSKDMVSKNEGLIVFFPGIPGCAKSALCKEILNAPGGLEDDRPIHSLMGDLI 180 + P++P + K+ V K+EGLIVFFPGIPG AKSALCKE+LNAPGG DDRP+H+LMGDL+ Sbjct: 646 VTPATPEPAVKEAVQKDEGLIVFFPGIPGSAKSALCKELLNAPGGFGDDRPVHTLMGDLV 705 Query: 181 KGRYWQKVADERRRKPYSIMLADKNAPNEEVWKQIENMCLSTKASAIPVIPDSEGTEINP 360 KG+YW KVADERR+KP SIMLADKNAPNE+VW+QIE+MC T+ASA+P++ DSEGT+ NP Sbjct: 706 KGKYWPKVADERRKKPQSIMLADKNAPNEDVWRQIEDMCRRTRASAVPIVADSEGTDTNP 765 Query: 361 FSIDALAVFIFRVLQRVNHPGNLDKSSPNAGYVMLMFYHLYDGKSRQEFESELIERFGSL 540 +S+DALAVF+FRVLQRVNHPG LDK S NAGYV+LMFYHLY+GK+R EFESELIERFGSL Sbjct: 766 YSLDALAVFMFRVLQRVNHPGKLDKESSNAGYVLLMFYHLYEGKNRNEFESELIERFGSL 825 Query: 541 VRIPLLKPERSPLPD 585 +++PLLK +R+PLPD Sbjct: 826 IKMPLLKSDRTPLPD 840 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,386,338 Number of Sequences: 27288 Number of extensions: 257489 Number of successful extensions: 705 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 705 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 904103924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18814424|gb|BM535626.1|BM535626 EST588648 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG67F5 5' end, mRNA sequence (394 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46060.1 hypothetical protein / predicted by genscan; supp... 162 4e-41 >At2g46060.1 hypothetical protein / predicted by genscan; supported by cDNA: gi_18087618 Length = 766 Score = 162 bits (411), Expect = 4e-41 Identities = 80/136 (58%), Positives = 100/136 (72%), Gaps = 6/136 (4%) Frame = +1 Query: 4 LYDASDKSVSFYIIYARGGTWSFGLRH------PISNRHSSTVETTMSISLERCPAKCSS 165 LY++S + V FYI+YAR GTWSFGLR P ++R S T+ +S+SLERCP CSS Sbjct: 465 LYNSSKEMVDFYILYAREGTWSFGLRQLIDSNTPAASRGSPTL---VSLSLERCPRGCSS 521 Query: 166 HGACKSVLDSSGLTFYSFCDCDRRTGGFDCSVELVSSSGQMWQSISLIGSNAAALLPAYW 345 +G C+ D++GLT YSFC CDR GGFDCS+E+VS + QSI+LI SNAAALLPAYW Sbjct: 522 YGQCRYAFDANGLTSYSFCSCDRTHGGFDCSIEIVSHQEHIVQSIALIASNAAALLPAYW 581 Query: 346 ALRHKAFAEWVLYTSS 393 ALR + + EWVL+TSS Sbjct: 582 ALRQREYPEWVLFTSS 597 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,874,444 Number of Sequences: 27288 Number of extensions: 174499 Number of successful extensions: 485 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 483 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 382840584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18814313|gb|BM535565.1|BM535565 EST588587 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG67E18 5' end, mRNA sequence (246 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18250.1 putative protein / similar to unknown protein (db... 94 2e-20 At3g04040.1 hypothetical protein / predicted by genscan+ 84 1e-17 >At5g18250.1 putative protein / similar to unknown protein (dbj|BAA90342.1);supported by full-length cDNA: Ceres:1816. Length = 133 Score = 93.6 bits (231), Expect = 2e-20 Identities = 41/53 (77%), Positives = 46/53 (86%) Frame = +2 Query: 86 VRCPHCAGPLSKEMETSEWTVPPLIRDSFSMIGSAVGGTTSAFYGFNHVMPIV 244 +RC HCAGPL++ +ETS+WTV P IRDSFSMIGSAVGGT SAF GFNH MPIV Sbjct: 10 IRCHHCAGPLTRNLETSKWTVDPFIRDSFSMIGSAVGGTASAFIGFNHAMPIV 62 >At3g04040.1 hypothetical protein / predicted by genscan+ Length = 128 Score = 84.3 bits (207), Expect = 1e-17 Identities = 37/47 (78%), Positives = 41/47 (86%) Frame = +2 Query: 89 RCPHCAGPLSKEMETSEWTVPPLIRDSFSMIGSAVGGTTSAFYGFNH 229 RC HCAGPL+K +ET+EWTV P IRDSFSMIGSAVGGT SAF GF+H Sbjct: 11 RCHHCAGPLTKNLETNEWTVAPFIRDSFSMIGSAVGGTASAFIGFHH 57 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,129,330 Number of Sequences: 27288 Number of extensions: 87667 Number of successful extensions: 290 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 290 length of database: 11,516,596 effective HSP length: 57 effective length of database: 9,961,180 effective search space used: 239068320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18813883|gb|BM535323.1|BM535323 EST588345 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG65K16 5' end, mRNA sequence (573 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g63420.1 putative protein / ; supported by cDNA: gi_12034... 80 1e-15 >At3g63420.1 putative protein / ; supported by cDNA: gi_12034687_gb_AF283673.1_AF283673 Length = 98 Score = 79.7 bits (195), Expect = 1e-15 Identities = 38/80 (47%), Positives = 43/80 (53%) Frame = +1 Query: 64 GKHRISAELKRXXXXXXXXXXXXXXXXXXXKASAACKEMLSNVETRPDPLLPITHGPTNP 243 GKHRI AEL R S C+E+LS +E PDPLLP+T+GP N Sbjct: 19 GKHRILAELARVEQEVAFLEKELKEVENTDIVSTVCEELLSVIEKGPDPLLPLTNGPLNL 78 Query: 244 SWDRWFEGAQDASGCRCWIL 303 WDRWFEG GCRC IL Sbjct: 79 GWDRWFEGPNGGEGCRCLIL 98 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,856,216 Number of Sequences: 27288 Number of extensions: 198909 Number of successful extensions: 430 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 859346304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18813865|gb|BM535314.1|BM535314 EST588336 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG65I16 5' end, mRNA sequence (636 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g30145.1 bcnt-like protein / ; supported by full-length cD... 134 4e-32 >At5g30145.1 bcnt-like protein / ; supported by full-length cDNA: Ceres: 9811. Length = 236 Score = 134 bits (337), Expect = 4e-32 Identities = 66/124 (53%), Positives = 91/124 (73%), Gaps = 4/124 (3%) Frame = +1 Query: 220 ITEVRDFAGEDVEIKKYVDHNSAEASDKGK----GPAAPASAVDXXXXXXXXXXXXSVLD 387 ITEV+DFAG+++E+K+ V+ +S EA ++G +A SAVD SVLD Sbjct: 113 ITEVKDFAGQEIEVKRLVEADSKEALERGNKGSSSSSAAPSAVDAVLEQIKKKQKLSVLD 172 Query: 388 KTKKDWEGFKGENRGMEEELDAYKKSSNQYLDRVGFLERADYREFERERDARLGMHAKRK 567 KTKKDW +K E++G+E+ELD YKKSS+QYLD+VGFLERADYR+FE+ERDARL + +KR+ Sbjct: 173 KTKKDWGEYKEEHKGVEDELDKYKKSSDQYLDKVGFLERADYRQFEKERDARLALQSKRR 232 Query: 568 PESM 579 + + Sbjct: 233 HDDV 236 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,146,894 Number of Sequences: 27288 Number of extensions: 190585 Number of successful extensions: 710 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 686 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 709 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18813374|gb|BM535036.1|BM535036 EST588058 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG64G4 5' end, mRNA sequence (597 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g08780.1 hypothetical protein / predicted by genscan; supp... 165 1e-41 >At3g08780.1 hypothetical protein / predicted by genscan; supported by cDNA: gi_19310496 Length = 313 Score = 165 bits (418), Expect = 1e-41 Identities = 76/150 (50%), Positives = 111/150 (73%) Frame = +3 Query: 48 EQLIHTHEYKAFQYRISTDSFDPKSLDVINIGPSFRSHYGSFSPISPFPSMTCDLRGPNA 227 +Q IHTHEY+A+Q+R S +P+S+ ++NIGP+FR HYGSFSP S FP + C+L +A Sbjct: 161 DQCIHTHEYRAYQFRSSKQRLEPRSVGIVNIGPAFRGHYGSFSPKSGFPPLICELSS-SA 219 Query: 228 MAEDEKAETLVGIKRGLKDQKELDLCAEGFEIGRLSKLMGSDSSNYTAELEHLYDKMLLK 407 M+ D +L K+ KDQKE+D AEGF++G L +L+G++++NYT +E +Y++ML K Sbjct: 220 MSVDCDESSLSAKKQSAKDQKEIDALAEGFQVGELKRLVGAEAANYTGGIEEMYERMLAK 279 Query: 408 LDSLARSVETSSAKVLEQEKHNMKLRYKIA 497 ++SLA VE SSA+V +QEKHN KLR ++A Sbjct: 280 IESLASDVEKSSARVFQQEKHNRKLRNRVA 309 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,890,910 Number of Sequences: 27288 Number of extensions: 245202 Number of successful extensions: 703 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 668 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 930958496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18813251|gb|BM534973.1|BM534973 EST587995 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG64I15 5' end, mRNA sequence (724 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11980.1 putative protein / predicted protein W02G9.1 Caen... 267 1e-83 >At4g11980.1 putative protein / predicted protein W02G9.1 Caenorhabditis elegans cosmid W02G9, PID:g3165571; supported by cDNA: gi_15450340_gb_AY052271.1_ Length = 309 Score = 267 bits (683), Expect(2) = 1e-83 Identities = 134/191 (70%), Positives = 164/191 (85%) Frame = +2 Query: 11 KMSTTPPSQIADIINLPTQLDQPVSVVAAPGVSDTHFRNAIESSLFKQWLKNIQTETGLL 190 KMS++ S + I LP+Q ++PV V A G+S + FR+AI+SSLF+ WL+N+++E+G+L Sbjct: 35 KMSSSS-SSLTQSITLPSQPNEPVLVSATAGISSSDFRDAIDSSLFRNWLRNLESESGIL 93 Query: 191 ANGALSLKQVLIQGVDMFGERLGFLKFKADIIDKETGQKVPGIVFARGPAVAVLILLDYE 370 A+G+++LKQVLIQGVDMFG+R+GFLKFKADI DKETGQKVPGIVFARGPAVAVLILL+ + Sbjct: 94 ADGSMTLKQVLIQGVDMFGKRIGFLKFKADIFDKETGQKVPGIVFARGPAVAVLILLESD 153 Query: 371 GETYAVLTEQVRVPVGRLILELPAGMLDDDQGDFAGTAVREVEEETGIHLNVHDMVDLTA 550 GETYAVLTEQVRVP G+++LELPAGMLDDD+GDF GTAVREVEEE GI L DMVDLTA Sbjct: 154 GETYAVLTEQVRVPTGKIVLELPAGMLDDDKGDFVGTAVREVEEEIGIKLKKEDMVDLTA 213 Query: 551 FLDASTGGQSF 583 FLD STG + F Sbjct: 214 FLDPSTGYRIF 224 Score = 60.5 bits (145), Expect(2) = 1e-83 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 610 KMSLFLYRGNVSKEKIQQLQGKETGLRDHGELIKVHVV 723 +MS+FLYRG V KE I+QLQGKETGLR+HGE IKV ++ Sbjct: 233 EMSVFLYRGQVEKETIRQLQGKETGLREHGEFIKVRLI 270 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,508,869 Number of Sequences: 27288 Number of extensions: 365267 Number of successful extensions: 1254 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1193 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1253 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1268361380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18813232|gb|BM534963.1|BM534963 EST587985 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG64G13 5' end, mRNA sequence (767 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g49540.1 hypothetical protein / similar to hypothetical pr... 345 2e-95 At5g08560.1 WD-repeat protein-like / ; supported by cDNA: gi... 59 2e-09 At5g08390.1 katanin p80 subunit - like protein / katanin p80 ... 57 1e-08 At5g23430.1 putative protein / contains similarity to unknown... 57 1e-08 At3g49660.1 G-protein beta-subunit (transducin) family / beta... 56 2e-08 At4g02730.1 G-protein beta family / similar to C. elegans put... 55 5e-08 At1g18080.1 G-protein beta family / identical to WD-40 repeat... 53 2e-07 At1g61210.1 G-protein beta family / contains similarity to ka... 52 3e-07 At1g48630.1 guanine nucleotide-binding protein, putative / si... 51 8e-07 At5g25150.1 transcription initiation factor IID-associated facto... 51 8e-07 At2g26060.1 G-protein beta family / ;supported by full-length... 50 1e-06 At1g11160.1 hypothetical protein / similar to hypothetical pr... 50 2e-06 >At1g49540.1 hypothetical protein / similar to hypothetical protein GB:AAD43147 GI:5430747 from [Arabidopsis thaliana] Length = 840 Score = 345 bits (884), Expect = 2e-95 Identities = 164/254 (64%), Positives = 200/254 (78%), Gaps = 3/254 (1%) Frame = +2 Query: 14 EGFDTLETVPEAVPVVLTEPPIEEQLAWHTLWPESHKLYGHGNELFSLCCDHDGKLVASS 193 EG DT ETVPEA P L EPPIE+QLA+HTLWPESHKLYGHGNELFSLC DH G LVASS Sbjct: 559 EGLDTFETVPEAAPAELKEPPIEDQLAFHTLWPESHKLYGHGNELFSLCSDHKGNLVASS 618 Query: 194 CKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEFSHDNKYLLAVSRDRHFSVFQINH 373 CKAQSA +AEIWLW+VG+WK+VGRL+SHSLTVT +EFS+D+ LL+VSRDRHFSVF I Sbjct: 619 CKAQSASMAEIWLWEVGTWKAVGRLQSHSLTVTHLEFSYDDTLLLSVSRDRHFSVFSIQR 678 Query: 374 KGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGSRDKTVKIWAVGTETSVKLLLTLP 553 E+ ++L+AK EAHKRIIW+CSWNPFGH+FAT SRDKTVKIW+V + +K +L LP Sbjct: 679 TDNGEVSHKLMAKVEAHKRIIWACSWNPFGHQFATSSRDKTVKIWSVENDARIKQILVLP 738 Query: 554 PFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWN---LDSRGGDGHLSVQNASPAVKF 724 PF SSVTA++W LD + G +AVGME+GLIEL N +++ G + A+ A++ Sbjct: 739 PFGSSVTAVAWTGLDRNEKSGCVAVGMESGLIELSNVKIIETEEG----TTATAALALRL 794 Query: 725 DPFLCHVSTVQRLS 766 +PF+CHVS V RL+ Sbjct: 795 EPFMCHVSAVNRLA 808 >At5g08560.1 WD-repeat protein-like / ; supported by cDNA: gi_15450909_gb_AY054535.1_ Length = 589 Score = 59.3 bits (142), Expect = 2e-09 Identities = 50/169 (29%), Positives = 76/169 (44%), Gaps = 3/169 (1%) Frame = +2 Query: 170 DGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEFSHDNKYLLAVSRDRH 349 DGK + S CK + + +V RL +T S+DNKY+L ++ Sbjct: 414 DGKWLVSVCKDSVISLFD-------REATVERLIEEEDMITSFSLSNDNKYILVNLLNQE 466 Query: 350 FSVFQINHKGTDEIDYQLVAKQEAHKR---IIWSCSWNPFGHEFATGSRDKTVKIWAVGT 520 ++ I E D ++V++ + HKR II SC A+GS D V IW T Sbjct: 467 IRLWNI------EGDPKIVSRYKGHKRSRFIIRSCFGGYKQAFIASGSEDSQVYIWHRST 520 Query: 521 ETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNLD 667 KL++ LP +V +SW + H +LA ++G I +W LD Sbjct: 521 G---KLIVELPGHAGAVNCVSWSPTNLH----MLASASDDGTIRIWGLD 562 Score = 47.4 bits (111), Expect = 9e-06 Identities = 35/138 (25%), Positives = 67/138 (48%), Gaps = 2/138 (1%) Frame = +2 Query: 266 LRSHSLTVTQMEFSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSC 445 L SH+ V ++FSH+ KYL + S+D+ +++I+ G + + LV H + + + Sbjct: 270 LESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADGHISLKHTLV----GHHKPVIAI 325 Query: 446 SWNPFGHEFATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTALS--WLSLDNHSNHGL 619 W+P + T ++ ++ W V + V + K ++ +S W G+ Sbjct: 326 LWSPDDRQVLTCGAEEVIRRWDVDSGDCVHMY-----EKGGISPISCGWYP----DGQGI 376 Query: 620 LAVGMENGLIELWNLDSR 673 +A GM + I +W+LD R Sbjct: 377 IA-GMTDRSICMWDLDGR 393 >At5g08390.1 katanin p80 subunit - like protein / katanin p80 subunit, Strongylocentrotus purpuratus, EMBL:AF052433 Length = 871 Score = 57.0 bits (136), Expect = 1e-08 Identities = 49/182 (26%), Positives = 77/182 (41%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 LYGH + + S+ D LVA+ A I LW + K V L H + F Sbjct: 148 LYGHSSGIDSVTFDASEGLVAAG-----AASGTIKLWDLEEAKVVRTLTGHRSNCVSVNF 202 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 ++ + S D + ++ I KG + + H R + + P G +G Sbjct: 203 HPFGEFFASGSLDTNLKIWDIRKKGC-------IHTYKGHTRGVNVLRFTPDGRWIVSGG 255 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 D VK+W + T+ KLL FKS + SLD H + LLA G + ++ W+L Sbjct: 256 EDNVVKVWDL---TAGKLL---HEFKSHEGKIQ--SLDFHPHEFLLATGSADKTVKFWDL 307 Query: 665 DS 670 ++ Sbjct: 308 ET 309 >At5g23430.1 putative protein / contains similarity to unknown protein (gb|AAB71474.1) Length = 922 Score = 57.0 bits (136), Expect = 1e-08 Identities = 46/182 (25%), Positives = 76/182 (41%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 LYGH + + S+ D LVA+ A I LW + K V L H ++F Sbjct: 55 LYGHSSGIDSVTFDASEVLVAAG-----AASGTIKLWDLEEAKIVRTLTGHRSNCISVDF 109 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 ++ + S D + ++ I KG + + H R + + P G +G Sbjct: 110 HPFGEFFASGSLDTNLKIWDIRKKGC-------IHTYKGHTRGVNVLRFTPDGRWVVSGG 162 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 D VK+W + T+ KLL + + SLD H + LLA G + ++ W+L Sbjct: 163 EDNIVKVWDL---TAGKLLTEFKSHEGQIQ-----SLDFHPHEFLLATGSADRTVKFWDL 214 Query: 665 DS 670 ++ Sbjct: 215 ET 216 >At3g49660.1 G-protein beta-subunit (transducin) family / beta-transducin, Schizosaccharomyces pombe, EMBL:CAA17803 Length = 317 Score = 55.8 bits (133), Expect = 2e-08 Identities = 50/214 (23%), Positives = 90/214 (41%), Gaps = 3/214 (1%) Frame = +2 Query: 101 TLWPESHKLYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHS 280 T + S L H + S+ DG+L+AS+ ++ I + V H Sbjct: 12 TPYVHSQTLTSHNRAVSSVKFSSDGRLLASASADKTIRTYTINTINDPIAEPVQEFTGHE 71 Query: 281 LTVTQMEFSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPF 460 ++ + FS D +++++ S D+ ++ + L+ H + ++NP Sbjct: 72 NGISDVAFSSDARFIVSASDDKTLKLWDVETGS-------LIKTLIGHTNYAFCVNFNPQ 124 Query: 461 GHEFATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMEN 640 + +GS D+TV+IW V T+ K L LP VTA +D + + L+ + Sbjct: 125 SNMIVSGSFDETVRIWDV---TTGKCLKVLPAHSDPVTA-----VDFNRDGSLIVSSSYD 176 Query: 641 GLIELWNLDSRGGDGH---LSVQNASPAVKFDPF 733 GL +W+ G GH + + +P V F F Sbjct: 177 GLCRIWD----SGTGHCVKTLIDDENPPVSFVRF 206 >At4g02730.1 G-protein beta family / similar to C. elegans putative WD-repeat protein C14B1.4, GenBank accession number Q17963;supported by full-length cDNA: Ceres:41490. Length = 333 Score = 54.7 bits (130), Expect = 5e-08 Identities = 44/203 (21%), Positives = 89/203 (43%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 L GH + + +DG L+AS+ ++ + LW ++ + R HS ++ + + Sbjct: 39 LEGHTAAISCVKFSNDGNLLASASVDKT-----MILWSATNYSLIHRYEGHSSGISDLAW 93 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 S D+ Y + S D ++ Y+ + H ++ ++NP + +GS Sbjct: 94 SSDSHYTCSASDDCTLRIWDARSP------YECLKVLRGHTNFVFCVNFNPPSNLIVSGS 147 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 D+T++IW V T V+++ K+ +S S+ + + L+ +G ++W+ Sbjct: 148 FDETIRIWEVKTGKCVRMI------KAHSMPIS--SVHFNRDGSLIVSASHDGSCKIWDA 199 Query: 665 DSRGGDGHLSVQNASPAVKFDPF 733 G + + SPAV F F Sbjct: 200 -KEGTCLKTLIDDKSPAVSFAKF 221 >At1g18080.1 G-protein beta family / identical to WD-40 repeat protein GI:2289095 from (Arabidopsis thaliana);supported by full-length cDNA: Ceres:7026. Length = 327 Score = 52.8 bits (125), Expect = 2e-07 Identities = 50/184 (27%), Positives = 83/184 (44%), Gaps = 3/184 (1%) Frame = +2 Query: 122 KLYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQME 301 +L GH + + + DG+ S E+ LW + + S R H+ V + Sbjct: 58 RLTGHSHFVEDVVLSSDGQFALSGSWD-----GELRLWDLAAGVSTRRFVGHTKDVLSVA 112 Query: 302 FSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSC---SWNPFGHEF 472 FS DN+ +++ SRDR ++ E Y + E H+ + SC S N Sbjct: 113 FSLDNRQIVSASRDRTIKLWNT----LGECKYTISEGGEGHRDWV-SCVRFSPNTLQPTI 167 Query: 473 ATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIE 652 + S DKTVK+W + ++ KL TL V+ ++ +S D L A G ++G++ Sbjct: 168 VSASWDKTVKVWNL---SNCKLRSTLAGHTGYVSTVA-VSPDG----SLCASGGKDGVVL 219 Query: 653 LWNL 664 LW+L Sbjct: 220 LWDL 223 >At1g61210.1 G-protein beta family / contains similarity to katanin p80 subunit GI:3005601 from [Strongylocentrotus purpuratus] Length = 282 Score = 52.4 bits (124), Expect = 3e-07 Identities = 46/182 (25%), Positives = 75/182 (40%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 L GH + + S+ D LV + + I LW V K V H + +EF Sbjct: 84 LCGHTSAVDSVAFDSAEVLVLAGASS-----GVIKLWDVEEAKMVRAFTGHRSNCSAVEF 138 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 ++L + S D + ++ I KG + + H R I + + P G +G Sbjct: 139 HPFGEFLASGSSDANLKIWDIRKKG-------CIQTYKGHSRGISTIRFTPDGRWVVSGG 191 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 D VK+W + T+ KLL + + SLD H LLA G + ++ W+L Sbjct: 192 LDNVVKVWDL---TAGKLLHEFKFHEGPIR-----SLDFHPLEFLLATGSADRTVKFWDL 243 Query: 665 DS 670 ++ Sbjct: 244 ET 245 >At1g48630.1 guanine nucleotide-binding protein, putative / similar to guanine nucleotide-binding protein GI:9294068 from (Arabidopsis thaliana); supported by cDNA: 38966. Length = 326 Score = 50.8 bits (120), Expect = 8e-07 Identities = 49/184 (26%), Positives = 84/184 (45%), Gaps = 3/184 (1%) Frame = +2 Query: 122 KLYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQME 301 ++ GH + + + DG+ S E+ LW + + +S R H+ V + Sbjct: 58 RMTGHSHFVQDVVLSSDGQFALSGSWD-----GELRLWDLATGESTRRFVGHTKDVLSVA 112 Query: 302 FSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSC---SWNPFGHEF 472 FS DN+ +++ SRDR ++ E Y +++ + HK + SC S N Sbjct: 113 FSTDNRQIVSASRDRTIKLWNT----LGECKY-TISEADGHKEWV-SCVRFSPNTLVPTI 166 Query: 473 ATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIE 652 + S DKTVK+W + + KL TL + ++ +S D L A G ++G+I Sbjct: 167 VSASWDKTVKVWNL---QNCKLRNTLAGHSGYLNTVA-VSPDG----SLCASGGKDGVIL 218 Query: 653 LWNL 664 LW+L Sbjct: 219 LWDL 222 >At5g25150.1 transcription initiation factor IID-associated factor-like protein / 100 kDa subunit of Pol II transcription factor - Homo sapiens, EMBL:X95525 Length = 700 Score = 50.8 bits (120), Expect = 8e-07 Identities = 46/187 (24%), Positives = 77/187 (40%), Gaps = 19/187 (10%) Frame = +2 Query: 167 HDGKLVASSCKAQSAPVAEIW-LWQVGSW------------------KSVGRLRSHSLTV 289 HDG LVA S V ++ + Q GS +S L HS V Sbjct: 362 HDGSLVAGGFSDSSIKVWDMAKIGQAGSGALQAENDSSDQSIGPNGRRSYTLLLGHSGPV 421 Query: 290 TQMEFSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHE 469 FS ++L+ S D ++ + +++ LV + H +W ++PFGH Sbjct: 422 YSATFSPPGDFVLSSSADTTIRLW------STKLNANLVC-YKGHNYPVWDAQFSPFGHY 474 Query: 470 FATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLI 649 FA+ S D+T +IW++ + P + LS +D H N +A G + + Sbjct: 475 FASCSHDRTARIWSMD---------RIQPLRIMAGHLS--DVDWHPNCNYIATGSSDKTV 523 Query: 650 ELWNLDS 670 LW++ + Sbjct: 524 RLWDVQT 530 Score = 49.7 bits (117), Expect = 2e-06 Identities = 47/182 (25%), Positives = 76/182 (40%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 L GH ++S G V SS + I LW ++ + H+ V +F Sbjct: 414 LLGHSGPVYSATFSPPGDFVLSSSADTT-----IRLWSTKLNANLVCYKGHNYPVWDAQF 468 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 S Y + S DR ++ ++ Q + H + W+P + ATGS Sbjct: 469 SPFGHYFASCSHDRTARIWSMDR-------IQPLRIMAGH---LSDVDWHPNCNYIATGS 518 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 DKTV++W V T V++ + +S V LSL + +A G E+G I +W+L Sbjct: 519 SDKTVRLWDVQTGECVRIFI---GHRSMV-----LSLAMSPDGRYMASGDEDGTIMMWDL 570 Query: 665 DS 670 + Sbjct: 571 ST 572 >At2g26060.1 G-protein beta family / ;supported by full-length cDNA: Ceres:142426. Length = 352 Score = 50.1 bits (118), Expect = 1e-06 Identities = 36/135 (26%), Positives = 59/135 (43%), Gaps = 7/135 (5%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQV---GSWKSVGRLRSHSLTVTQ 295 L GH NE+ S+ + G +A+ + +S +W+W+V + L H+ V Sbjct: 114 LEGHENEVKSVSWNASGSCLATCSRDKS-----VWIWEVLEGNEYDCAAVLTGHTQDVKM 168 Query: 296 MEFSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVA----KQEAHKRIIWSCSWNPFG 463 +++ L + S D V+ D+ +YQ V H +WS S+N G Sbjct: 169 VQWHPTMDVLFSCSYDNTIKVWWSED---DDGEYQCVQTLGESNNGHSSTVWSISFNAAG 225 Query: 464 HEFATGSRDKTVKIW 508 + T S D T+KIW Sbjct: 226 DKMVTCSDDLTLKIW 240 >At1g11160.1 hypothetical protein / similar to hypothetical protein GB:AAD49999 GI:5734734 from [Arabidopsis thaliana] Length = 974 Score = 49.7 bits (117), Expect = 2e-06 Identities = 44/182 (24%), Positives = 76/182 (41%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 L GH + + S+ + + LV + + I LW + K V H + +EF Sbjct: 3 LCGHTSPVDSVAFNSEEVLVLAGASS-----GVIKLWDLEESKMVRAFTGHRSNCSAVEF 57 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 ++L + S D + V+ KG + + H R I + ++P G +G Sbjct: 58 HPFGEFLASGSSDTNLRVWDTRKKG-------CIQTYKGHTRGISTIEFSPDGRWVVSGG 110 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 D VK+W + T+ KLL + + SLD H LLA G + ++ W+L Sbjct: 111 LDNVVKVWDL---TAGKLLHEFKCHEGPIR-----SLDFHPLEFLLATGSADRTVKFWDL 162 Query: 665 DS 670 ++ Sbjct: 163 ET 164 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,361,611 Number of Sequences: 27288 Number of extensions: 384960 Number of successful extensions: 1545 Number of sequences better than 1.0e-05: 34 Number of HSP's better than 0.0 without gapping: 1194 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1454 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1401406280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18265080|gb|BM413450.1|BM413450 EST587777 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG63I20 5' end, mRNA sequence (744 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g71860.1 protein tyrosine phosphatase / identical to GB:C... 350 5e-97 >At1g71860.1 protein tyrosine phosphatase / identical to GB:CAA06978 GI:3413425 from [Arabidopsis thaliana] (Plant Mol. Biol. 39 (3), 593-605 (1999)); supported by cDNA: gi_3800745_gb_AF055635.1_AF055635 Length = 340 Score = 350 bits (898), Expect = 5e-97 Identities = 168/245 (68%), Positives = 200/245 (81%), Gaps = 3/245 (1%) Frame = +2 Query: 17 RCHSPDKIASEFSTLQENRLKASEMKSRCLVALDSTNISKNRYTDVIPFDNNRVVLDPCK 196 + +PD IA EF+ LQ NR+ SE+ VA++S N+ KNRY+DV+PFD NR+VL+PCK Sbjct: 51 KIQNPDSIAHEFTGLQANRMWPSELLLNSTVAMNSVNVEKNRYSDVVPFDKNRIVLNPCK 110 Query: 197 DYRPSAKGYINASFIEISEG--VSRFVATQGPLAHTFEDFWEMIIQQRCPVIVMLTRLVD 370 D SAKGY+NAS I+ SE +S+F+ATQGPL HT EDFWEM+IQQ CP+IVMLTRLVD Sbjct: 111 D--SSAKGYVNASLIKTSESESISQFIATQGPLPHTMEDFWEMVIQQHCPIIVMLTRLVD 168 Query: 371 NYKMVKCGDYFQAEDGPRTFGNICIVTKYM-TSDASLVLRTLEVNYIESEEPPLCVLHIQ 547 N + VKCGDYFQ EDGPR FGNI + TK++ T+D SL+LR LEVNY E+E+ P+ VLHIQ Sbjct: 169 NNRTVKCGDYFQDEDGPREFGNISLTTKWIKTTDTSLMLRNLEVNYKETEDQPMSVLHIQ 228 Query: 548 YPEWPDHGVPRDTLAVREILKRTYNLPLGLGPIVVHCSAGIGRTGTYCTIHNTIQRILGG 727 YPEWPDHGVP+DT+AVREILKR Y +P LGPI+VHCSAGIGRTGTYC IHNTIQRIL G Sbjct: 229 YPEWPDHGVPKDTVAVREILKRLYQVPPSLGPIIVHCSAGIGRTGTYCAIHNTIQRILAG 288 Query: 728 DMSAL 742 DMSAL Sbjct: 289 DMSAL 293 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,486,735 Number of Sequences: 27288 Number of extensions: 394163 Number of successful extensions: 1143 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1140 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1330449000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264914|gb|BM413284.1|BM413284 EST587611 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62H12 5' end, mRNA sequence (656 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g53645.1 Expressed protein / ; supported by full-length cD... 228 2e-60 >At1g53645.1 Expressed protein / ; supported by full-length cDNA: Ceres: 41453. Length = 523 Score = 228 bits (582), Expect = 2e-60 Identities = 106/142 (74%), Positives = 124/142 (86%) Frame = +2 Query: 8 TNMMIECEPEYLMGDFESNPDIDETPPIPLRDALEKMKPFLMAYEGIKDQEEWEEVIKET 187 TN+MIECEPEY+M DF SNPDIDE PP+ LR+ LEK+KPF++AYEGIKDQEEWEE I E Sbjct: 382 TNLMIECEPEYIMPDFGSNPDIDEKPPMSLRECLEKVKPFIVAYEGIKDQEEWEEAINEA 441 Query: 188 METVPLMKEIVDYYSGPDRVTAKQQQQELERVAKTLPESAPNSVKRFTERAVLSLQSNPG 367 M PLMKEIVD+YSGPDRVTAK+Q +EL+R+A TLP SAP+SVKRF +RA L+L+SNPG Sbjct: 442 MTQAPLMKEIVDHYSGPDRVTAKKQNEELDRIATTLPASAPDSVKRFADRAALTLKSNPG 501 Query: 368 WGFDKKCQFMDKVVMEVSQHYK 433 WGFDKK QFMDK+V+EVSQ YK Sbjct: 502 WGFDKKYQFMDKLVLEVSQSYK 523 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,785,858 Number of Sequences: 27288 Number of extensions: 248676 Number of successful extensions: 853 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 851 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1097681028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264842|gb|BM413212.1|BM413212 EST587539 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62J13 5' end, mRNA sequence (785 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g50100.1 putative protein / similar to unknown protein (pi... 239 1e-63 >At5g50100.1 putative protein / similar to unknown protein (pir||S75732);supported by full-length cDNA: Ceres:35710. Length = 214 Score = 239 bits (610), Expect = 1e-63 Identities = 116/174 (66%), Positives = 142/174 (80%), Gaps = 5/174 (2%) Frame = +1 Query: 160 GPRYSIRAISGTT----VAPNKDINEEKSPENWKIKMLYDGECPLCMREVDMLRERNKSY 327 G +Y +RAI GT+ + P K+ EE P+NWKIKMLYDG+CPLCMREV+ML ERN+ + Sbjct: 42 GFKYQVRAIQGTSTDPVITPLKN-REEPKPQNWKIKMLYDGDCPLCMREVNMLMERNEKH 100 Query: 328 GTIKFLDISSDEYRPDENEGLDYETVMGRIHAILSDGTVVTDVEAFRRLYEAVGLGWVYA 507 GTIKF+DISS++Y P++N+GLDY+TVMG+IHAI SDG VV VEAFRRLYE VGLGWVY Sbjct: 101 GTIKFVDISSNDYSPEDNQGLDYKTVMGQIHAIQSDGNVVKGVEAFRRLYEEVGLGWVYT 160 Query: 508 ITKYEPIATIADAVYGVWAKYRLQVTGRPSLEEVLKARRK-KEEMCKDSKACKM 666 ITK+EPI +AD VY VWAKYRLQVTGRPS+E +L+AR+K K E C +SK CK+ Sbjct: 161 ITKFEPIGKLADVVYDVWAKYRLQVTGRPSIEAILEARKKDKVETCGESKNCKI 214 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,396,550 Number of Sequences: 27288 Number of extensions: 342634 Number of successful extensions: 1030 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1027 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264811|gb|BM413181.1|BM413181 EST587508 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62D15 5' end, mRNA sequence (741 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72550.1 putative phenylalanyl-tRNA synthetase beta-subunit; ... 368 e-102 >At1g72550.1 putative phenylalanyl-tRNA synthetase beta-subunit; PheHB / similar to phenylalanyl-tRNA synthetase beta-subunit (PheHB) GB:5032011 [Homo sapiens]; supported by cDNA: gi_17065261 Length = 598 Score = 368 bits (945), Expect = e-102 Identities = 178/244 (72%), Positives = 211/244 (85%) Frame = +3 Query: 3 TYEALPPAEINFVPLKQTKNFRADELMEFYKSDLKLKKFLHIIENSPVYPVIYDCKRTVL 182 TYEALPP +INFVPLKQTK+FRADEL+EFYKSD+KLKKFLHIIENSPV+PV+YD KRTVL Sbjct: 173 TYEALPPTDINFVPLKQTKSFRADELIEFYKSDMKLKKFLHIIENSPVFPVLYDSKRTVL 232 Query: 183 SLPPIINGAHSAISLKTKNVFIECTATDLTKANIVLNTMVTMFSVYCERKFEVEPVKVTY 362 SLPPIINGAHSAI+L+TKNVFIECTATDLTKA IVLNTMVT FS +C RKFE+EPV+VTY Sbjct: 233 SLPPIINGAHSAITLQTKNVFIECTATDLTKAKIVLNTMVTTFSEFCARKFEIEPVEVTY 292 Query: 363 PDGRSYVCPDLSIYNMNVPLSYITGIIGVQLPEDKVASLLHKMQLRAEKSVSEDKEVKFV 542 DG+SY+ PDL++Y+M VPLS+IT IGV L ++V SLL +MQL+AE++ S D + Sbjct: 293 DDGKSYIYPDLAVYDMEVPLSFITDSIGVSLKVEQVTSLLTRMQLQAEQAKSSDNQCAIK 352 Query: 543 VSVPPTRSDVLHPCDVTEDVAIAYGYHEIPKRKPASLNPLPLSQFSDLIRTEIAMTGYTE 722 V VPP+RSDVLHPCDV EDVAIAYG++ IP RKPAS+ PL L++ +DL+R EIAM YTE Sbjct: 353 VHVPPSRSDVLHPCDVMEDVAIAYGFNNIPTRKPASIKPLTLNELTDLLRIEIAMCVYTE 412 Query: 723 VLTW 734 V+TW Sbjct: 413 VVTW 416 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,522,606 Number of Sequences: 27288 Number of extensions: 329588 Number of successful extensions: 1001 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1001 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1321579340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264791|gb|BM413161.1|BM413161 EST587488 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62O16 5' end, mRNA sequence (702 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56040.1 putative protein / predicted protein, Arabidopsis... 237 4e-63 >At3g56040.1 putative protein / predicted protein, Arabidopsis thaliana; supported by cDNA: gi_14596046_gb_AY042811.1_ Length = 883 Score = 237 bits (605), Expect = 4e-63 Identities = 101/171 (59%), Positives = 141/171 (82%) Frame = +2 Query: 2 LGPLWEVIRQKFYRGSISKGSELLIEVAEFLWRDVQLDGSLIILAENVLGSPRIDENGET 181 LGPLWEV RQKF GSIS SEL +E+AEF W +VQ+DGSLI+ AEN +GS ++NGE Sbjct: 703 LGPLWEVSRQKFKGGSISSCSELQLEIAEFSWNNVQVDGSLIVTAENAMGSTTPNDNGEP 762 Query: 182 VLHYGKRCGRCKLENVKILNDGIDWNARENLYWKHDVQRFEAVKVILHGNAEFEAVDVIL 361 +L YG RCG+CKL NV ++N GIDWN++ N+YW++DV R E K+ILHGNAEFEA +V + Sbjct: 763 ILQYGLRCGKCKLHNVNVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEFEASNVTI 822 Query: 362 QGNHVFEVPDGYKMKITTGDSGLAVELKPIENKLMESGSWFWNYKIMGNHV 514 +G+HVFEVPDG+K+KIT+G++GL++ L+ ++ ++ME+GSW+WNY++ G+H+ Sbjct: 823 EGHHVFEVPDGHKLKITSGNAGLSINLEALKEEVMETGSWYWNYQLNGSHI 873 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,065,691 Number of Sequences: 27288 Number of extensions: 323810 Number of successful extensions: 935 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 886 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 935 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1218881876 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264727|gb|BM413097.1|BM413097 EST587424 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62A18 5' end, mRNA sequence (807 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g46450.1 SEC14 cytosolic factor, putative / supported by c... 270 5e-73 At4g36640.1 putative protein / 58 5e-09 At3g24840.1 phosphatidylinositol transfer protein, putative / ... 58 7e-09 At4g39180.1 SEC14 - like protein / phosphatidylinositol-phosp... 57 9e-09 At4g08690.1 putative phosphoglyceride transfer protein / simi... 57 2e-08 At4g36490.1 expressed protein / ; supported by cDNA: gi_15215... 56 2e-08 At5g47510.1 SEC14 cytosolic factor, putative / contains simil... 56 2e-08 At2g21540.1 putative phosphatidylinositol phophatidylcholine tra... 56 3e-08 At1g75170.1 unknown protein / ; supported by cDNA: gi_17979168 55 3e-08 At1g75370.1 sec14 cytosolic factor, putative / similar to SP:... 54 8e-08 At2g18180.1 putative phosphatidylinositol/phophatidylcholine tra... 54 1e-07 At2g21520.1 putative phosphatidylinositol/phosphatidylcholine tr... 53 2e-07 >At3g46450.1 SEC14 cytosolic factor, putative / supported by cDNA: gi_20453103 Length = 486 Score = 270 bits (691), Expect = 5e-73 Identities = 124/254 (48%), Positives = 177/254 (68%) Frame = +2 Query: 2 SDQSSSTGETTPNDFHHSQAYPQARSHDEVQDDGYPQRWLLELHKELREESISVPERLND 181 ++ +S+ + +D Q+ R DE Q WL +L++EL ++ +S+PERLN+ Sbjct: 145 TNSHASSESESQSDSQTLQSPSDIRIEDEAPLPVISQDWLRKLYEELEKQRLSLPERLNE 204 Query: 182 DELRQFYAAANGDFARLLSSVKKTIKWRQNYTFLSPEELKAWSPFIFWHGHDANQRPCLI 361 DEL +FY +NGDF LLSS+KKTI WR+ Y LS EEL+ WS +FWHG+D NQRPCLI Sbjct: 205 DELHRFYRVSNGDFTSLLSSIKKTIHWRETYRILSEEELETWSSLLFWHGYDKNQRPCLI 264 Query: 362 IRLGLACSNLRSNGKSLLIKAVVSQIEHGILRMVNVEHPQITVLMDCEGLSPFGFPIHMM 541 +RLGLA L S+ + +A++SQ+EHG+L ++ E+ ++TVL+DCEGLSP P+ MM Sbjct: 265 VRLGLAFLKLPSHERPRFAQAIISQVEHGVLHLLTPENSELTVLVDCEGLSPLRIPMQMM 324 Query: 542 RSCAMLLQDHYPNRLSSLIIVRLPQVAQIIMQTFFQVLKPSTRQKVRIIGRNHLEFLSNH 721 RSC+ +LQDH+PNRL L I+RLP V ++I QTF Q+L+P+TR+K+RI G LS + Sbjct: 325 RSCSSILQDHFPNRLGCLFIIRLPPVVRVISQTFIQILRPTTRKKLRIEGETFHRVLSEY 384 Query: 722 LNSIPPFLGGNCSC 763 L ++P +LG NC+C Sbjct: 385 LQTLPSYLGSNCNC 398 >At4g36640.1 putative protein / Length = 294 Score = 58.2 bits (139), Expect = 5e-09 Identities = 60/260 (23%), Positives = 110/260 (42%), Gaps = 16/260 (6%) Frame = +2 Query: 62 YPQARSHDEVQDDGYPQRWLLELHKELREESISVPERLNDDELRQFYAAANGDFARLLSS 241 + + +H DD + EL + S +D LR+F A N D + Sbjct: 2 FRRRNAHQLDNDDSQQDNKVRELKSAIGPLSGHSLVFCSDASLRRFLDARNWDVEKAKKM 61 Query: 242 VKKTIKWRQNYTFLSPEELKAWSPFIFWHG----------HDANQRPCLIIRLGLACSNL 391 +++T+KWR Y P+E++ W+ + G HD R LI+R + S Sbjct: 62 IQETLKWRSTY---KPQEIR-WNQ-VAHEGETGKASRASFHDRQGRVVLIMRPAMQNSTS 116 Query: 392 RSNGKSLLIKAVVSQIEHGILRMVNVEHPQITVLMDCEGLS-PFGFPIHMMRSCAMLLQD 568 + I+ +V +E+ I+ + + Q++ L+D G S P+ R +LQ+ Sbjct: 117 QEGN----IRHLVYLLENAIINLPKGQ-KQMSWLIDFTGWSMAVNPPMKTTREIIHILQN 171 Query: 569 HYPNRLSSLIIVRLPQVAQIIMQTFFQVLKPSTRQKVRII---GRNHLEFLSNH--LNSI 733 +YP RL + P++ Q + + L P T +KV+ + + E ++ H + ++ Sbjct: 172 YYPERLGIAFLYNPPRLFQAVYRAAKYFLDPRTAEKVKFVYPKDKASDELMTTHFDVENL 231 Query: 734 PPFLGGNCSCSNAQTDGCRK 793 P GG + D R+ Sbjct: 232 PKEFGGEATLEYDHEDFSRQ 251 >At3g24840.1 phosphatidylinositol transfer protein, putative / similar to SEC14 CYTOSOLIC FACTOR (PHOSPHATIDYLINOSITOL/PHOSPHATIDYLCHOLINE TRANSFER PROTEIN) GB:P46250 from [Candida albicans] (Yeast (1996) 12(11), 1097-1105) Length = 535 Score = 57.8 bits (138), Expect = 7e-09 Identities = 56/241 (23%), Positives = 101/241 (41%), Gaps = 30/241 (12%) Frame = +2 Query: 161 VPERLND-DELRQFYAAANGDFARLLSSVKKTIKWR---------QNYTFLSPEELKAWS 310 +P R +D + +F A D + + ++ +KWR Q++ + EE++ + Sbjct: 99 LPPRHDDYHTMLRFLKARRFDLEKTVQMWEEMLKWRKENGVDTIIQDFVYDEYEEVQQYY 158 Query: 311 PFIFWHGHDANQRPCLIIRLGLACSNLRSNGKSLLIKAVVSQIEH---GILRMVNVEHP- 478 P + HG D RP I RLG GK + + + + + G + + + P Sbjct: 159 PHGY-HGVDREGRPVYIERLGKI-----DPGKLMKVTTLERFLRYHVQGFEKTFSEKFPA 212 Query: 479 ----------QITVLMDCEGLSPFGFPIHMMRSCAMLLQ----DHYPNRLSSLIIVRLPQ 616 T ++D G+S F + + M +Q D+YP L+ + I+ Sbjct: 213 CSIAAKRHINSSTTIIDVHGVSWMSFR-KLAQDLVMRMQKIDGDNYPETLNQMYIINAGN 271 Query: 617 VAQIIMQTFFQVLKPSTRQKVRIIGRNHLEFLSNHL--NSIPPFLGGNCSCSNAQTDGCR 790 +++ T L P T K+ ++G + L + + +P FLGGNC C A GC Sbjct: 272 GFKLVWNTVKGFLDPKTTSKIHVLGNKYRSHLLEIIDPSELPEFLGGNCKC--AHEGGCM 329 Query: 791 K 793 + Sbjct: 330 R 330 >At4g39180.1 SEC14 - like protein / phosphatidylinositol-phosphatidylcholine transfer protein SEC14, Yarrowia lipolytica, PIR2:S43745 Length = 550 Score = 57.4 bits (137), Expect = 9e-09 Identities = 58/241 (24%), Positives = 98/241 (40%), Gaps = 30/241 (12%) Frame = +2 Query: 161 VPERLNDDELR-QFYAAANGDFARLLSSVKKTIKWRQNY---------TFLSPEELKAWS 310 +P + +D + +F A D + + WR+ Y F EE+ + Sbjct: 87 LPSKHDDHHMMLRFLRARKFDLEKAKQMWSDMLNWRKEYGADTIMEDFDFKEIEEVVKYY 146 Query: 311 PFIFWHGHDANQRPCLIIRLGL--ACSNLRSNGKSLLIKAVVSQIEHGILRMVNVEHP-- 478 P + HG D RP I RLG A ++ +K V + E + NV+ P Sbjct: 147 PQGY-HGVDKEGRPIYIERLGQVDATKLMKVTTIDRYVKYHVKEFE----KTFNVKFPAC 201 Query: 479 ---------QITVLMDCEGLSPFGF---PIHMMRSCAMLLQDHYPNRLSSLIIVRLPQVA 622 Q T ++D +G+ F +++S + D+YP L+ + I+ Sbjct: 202 SIAAKRHIDQSTTILDVQGVGLSNFNKAAKDLLQSIQKIDNDNYPETLNRMFIINAGCGF 261 Query: 623 QIIMQTFFQVLKPSTRQKVRIIGRNH----LEFLSNHLNSIPPFLGGNCSCSNAQTDGCR 790 +++ T L P T K+ ++G + LE + N +P FLGG C+C A GC Sbjct: 262 RLLWNTVKSFLDPKTTAKIHVLGNKYQTKLLEIID--ANELPEFLGGKCTC--ADKGGCM 317 Query: 791 K 793 + Sbjct: 318 R 318 >At4g08690.1 putative phosphoglyceride transfer protein / similar to SEC14-like protein of D. discoideum, GenBank accession number U82515 Length = 301 Score = 56.6 bits (135), Expect = 2e-08 Identities = 48/195 (24%), Positives = 87/195 (44%), Gaps = 10/195 (5%) Frame = +2 Query: 134 KELREESISVPERLN----DDELRQFYAAANGDFARLLSSVKKTIKWRQNYTFLSPEELK 301 +E+R+ +PE+L+ DD + ++ A N + +K+T+KWR Y PEE+ Sbjct: 24 EEVRKLLGPLPEKLSSFCSDDAVLRYLRARNWHVKKATKMLKETLKWRVQY---KPEEI- 79 Query: 302 AWSPFIFWHGHDANQRPCLIIRLGLACSNLRSNGKSLLIKAVVSQIEHGILRMVNVEH-- 475 W R + +LG +R + ++ K+V QI + + M N Sbjct: 80 CWEEVAGEAETGKIYRSSCVDKLGRPVLIMRPSVENS--KSVKGQIRYLVYCMENAVQNL 137 Query: 476 ----PQITVLMDCEGLSPFGFPIHMMRSCAMLLQDHYPNRLSSLIIVRLPQVAQIIMQTF 643 Q+ ++D G S + + A +LQ+HYP RL+ ++ P+ + + Sbjct: 138 PPGEEQMVWMIDFHGYSLANVSLRTTKETAHVLQEHYPERLAFAVLYNPPKFFEPFWKVA 197 Query: 644 FQVLKPSTRQKVRII 688 L+P TR KV+ + Sbjct: 198 RPFLEPKTRNKVKFV 212 >At4g36490.1 expressed protein / ; supported by cDNA: gi_15215779_gb_AY050419.1_ Length = 543 Score = 56.2 bits (134), Expect = 2e-08 Identities = 57/242 (23%), Positives = 101/242 (41%), Gaps = 31/242 (12%) Frame = +2 Query: 161 VPERLNDDELR-QFYAAANGDFARLLSSVKKTIKWRQNY---TFLSPEELKAWSPFIFW- 325 +PE+ +D + +F A D + + ++WR+ + T + + K + + Sbjct: 69 LPEKHDDYHMMLRFLKARKFDLEKTKQMWTEMLRWRKEFGADTVMEEFDFKEIDEVLKYY 128 Query: 326 ----HGHDANQRPCLIIRLGLACSNLRSNGKSLLIKAVVSQIEHGIL---RMVNVEHP-- 478 HG D RP I RLGL S K + + + + + ++ R NV+ P Sbjct: 129 PQGHHGVDKEGRPVYIERLGLVDST-----KLMQVTTMDRYVNYHVMEFERTFNVKFPAC 183 Query: 479 ---------QITVLMDCEGLSPFGFPIHMMRSCAMLLQ----DHYPNRLSSLIIVRLPQV 619 Q T ++D +G+ F R LQ D+YP L+ + I+ Sbjct: 184 SIAAKKHIDQSTTILDVQGVGLKNFN-KAARDLITRLQKVDGDNYPETLNRMFIINAGSG 242 Query: 620 AQIIMQTFFQVLKPSTRQKVRIIGRNH----LEFLSNHLNSIPPFLGGNCSCSNAQTDGC 787 +++ T L P T K+ ++G + LE + + +P FLGG+C+C A GC Sbjct: 243 FRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDE--SELPEFLGGSCTC--ADNGGC 298 Query: 788 RK 793 + Sbjct: 299 MR 300 >At5g47510.1 SEC14 cytosolic factor, putative / contains similarity to phosphatidylinositol/phosphatidylcholine transfer protein Length = 403 Score = 56.2 bits (134), Expect = 2e-08 Identities = 65/248 (26%), Positives = 107/248 (42%), Gaps = 29/248 (11%) Frame = +2 Query: 113 RWLLELHKELREESISVPERLND-DELRQFYAAANGDFARLLSSVKKTIKWR-------- 265 R LL LH L P++ D + LR+F + D + + +KWR Sbjct: 32 RNLLLLHGHL-------PDKHGDHNTLRRFLKMRDFDLEKSKEAFLNYMKWRVDYKVDLI 84 Query: 266 -QNYTFLSPEELKAWSPFIFWHGHDANQRPCLIIRLGLACSNLRSNGKSLLIKAVVSQIE 442 Q + F E+K P F H D RP I RLG+ ++L + K+ I+ V+ Sbjct: 85 SQKFKFEEYGEVKKHYPHGF-HKVDKTGRPIYIERLGM--TDLNAFLKATTIERYVNYHI 141 Query: 443 HGILRMVNVEHPQITVLMDCE-------------GLSPFGFPIHMMRSCAMLLQ----DH 571 + +++ +P ++ D G+S F P RS M +Q ++ Sbjct: 142 KEQEKTMSLRYPACSIASDKHVSSTTTILDVSGVGMSNFSKPA---RSLFMEIQKIDSNY 198 Query: 572 YPNRLSSLIIVRLPQVAQIIMQTFFQVLKPSTRQKVRIIGRNHLEFLSNHL--NSIPPFL 745 YP L L +V +++ L T KV+++G N+L L + +++P FL Sbjct: 199 YPETLHRLFVVNASSGFRMLWLALKTFLDARTLAKVQVLGPNYLGELLEAIEPSNLPTFL 258 Query: 746 GGNCSCSN 769 GGNC+CS+ Sbjct: 259 GGNCTCSD 266 >At2g21540.1 putative phosphatidylinositol phophatidylcholine transfer protein / ; supported by cDNA: gi_16209641_gb_AY057587.1_ Length = 548 Score = 55.8 bits (133), Expect = 3e-08 Identities = 56/241 (23%), Positives = 101/241 (41%), Gaps = 30/241 (12%) Frame = +2 Query: 161 VPERLNDDELR-QFYAAANGDFARLLSSVKKTIKWR---------QNYTFLSPEELKAWS 310 +P + +D + +F A D + I WR +++ F +E+ + Sbjct: 86 LPSKHDDHHMMLRFLRARKFDLEKAKQMWTDMIHWRKEFGVDTIMEDFDFKEIDEVLKYY 145 Query: 311 PFIFWHGHDANQRPCLIIRLGL--ACSNLRSNGKSLLIKAVVSQIEHGILRMVNVEHP-- 478 P + HG D + RP I RLG A ++ +K V + E + N++ P Sbjct: 146 PQGY-HGVDKDGRPVYIERLGQVDATKLMQVTTIDRYVKYHVREFE----KTFNIKLPAC 200 Query: 479 ---------QITVLMDCEGLSPFGFPI---HMMRSCAMLLQDHYPNRLSSLIIVRLPQVA 622 Q T ++D +G+ F +++ + D+YP L+ + I+ Sbjct: 201 SIAAKKHIDQSTTILDVQGVGLKSFSKAARDLLQRIQKIDSDNYPETLNRMFIINAGSGF 260 Query: 623 QIIMQTFFQVLKPSTRQKVRIIGRNH----LEFLSNHLNSIPPFLGGNCSCSNAQTDGCR 790 +++ T L P T K+ ++G + LE + + N +P FLGGNC+C A GC Sbjct: 261 RLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDS--NELPEFLGGNCTC--ADKGGCM 316 Query: 791 K 793 + Sbjct: 317 R 317 >At1g75170.1 unknown protein / ; supported by cDNA: gi_17979168 Length = 296 Score = 55.5 bits (132), Expect = 3e-08 Identities = 55/209 (26%), Positives = 98/209 (46%), Gaps = 17/209 (8%) Frame = +2 Query: 176 NDDELRQFYAAANGDFARLLSSVKKTIKWRQNYTFLSPEELKAWSPF--------IFWHG 331 +D L+++ A N + + +++T+KWR ++ PEE++ W+ ++ G Sbjct: 43 SDACLKRYLEARNWNVGKAKKMLEETLKWRSSF---KPEEIR-WNEVSGEGETGKVYKAG 98 Query: 332 -HDANQRPCLIIRLGLACSNLRSNGKSL--LIKAVVSQIEHGILRMVNVEHPQITVLMDC 502 HD + R LI+R GL N KSL +K +V IE+ IL + + Q++ L+D Sbjct: 99 FHDRHGRTVLILRPGL------QNTKSLENQMKHLVYLIENAILNLPE-DQEQMSWLIDF 151 Query: 503 EGLS-PFGFPIHMMRSCAMLLQDHYPNRLSSLIIVRLPQVAQIIMQTFFQVLKPSTRQKV 679 G S PI R +LQ+HYP RL+ + P++ + + + T KV Sbjct: 152 TGWSMSTSVPIKSARETINILQNHYPERLAVAFLYNPPRLFEAFWKIVKYFIDAKTFVKV 211 Query: 680 RII---GRNHLEFLSNHLN--SIPPFLGG 751 + + +E +S + ++P GG Sbjct: 212 KFVYPKNSESVELMSTFFDEENLPTEFGG 240 >At1g75370.1 sec14 cytosolic factor, putative / similar to SP:P24859 from [Kluyveromyces lactis] Length = 530 Score = 54.3 bits (129), Expect = 8e-08 Identities = 56/231 (24%), Positives = 95/231 (40%), Gaps = 31/231 (13%) Frame = +2 Query: 194 QFYAAANGDFARLLSSVKKTIKWR---------QNYTFLSPEELKAWSPFIFWHGHDANQ 346 +F A D + IKWR +++ F +E+ + P + HG D Sbjct: 3 RFLKARKFDIGKTKLMWSNMIKWRKDFGTDTIFEDFEFEEFDEVLKYYPHGY-HGVDKEG 61 Query: 347 RPCLIIRLGLACSNLRSNGKSLLIKAVVSQIEHGIL---RMVNVEHPQI----------- 484 RP I RLGL K + + V I + + + VN++ P Sbjct: 62 RPVYIERLGLV-----DPAKLMQVTTVERFIRYHVREFEKTVNIKLPACCIAAKRHIDSS 116 Query: 485 TVLMDCEGLSPFGFPIHMMRSCAMLLQ------DHYPNRLSSLIIVRLPQVAQIIMQTFF 646 T ++D +G+ GF + +++Q D+YP L + I+ +++ T Sbjct: 117 TTILDVQGV---GFKNFSKPARDLIIQLQKIDNDNYPETLHRMFIINGGSGFKLVWATVK 173 Query: 647 QVLKPSTRQKVRIIGRNHLEFLSNHLNS--IPPFLGGNCSCSNAQTDGCRK 793 Q L P T K+ +IG + L +++ +P FLGG C+C A GC + Sbjct: 174 QFLDPKTVTKIHVIGNKYQNKLLEIIDASQLPDFLGGTCTC--ADRGGCMR 222 >At2g18180.1 putative phosphatidylinositol/phophatidylcholine transfer protein / Length = 558 Score = 53.5 bits (127), Expect = 1e-07 Identities = 55/240 (22%), Positives = 99/240 (40%), Gaps = 29/240 (12%) Frame = +2 Query: 161 VPERLNDDELR-QFYAAANGDFARLLSSVKKTIKWRQNY---TFLSPEELKAWSPFIFW- 325 +P++ +D + +F A D + ++WR+ + T + E K + + Sbjct: 72 LPDKHDDYHMMLRFLKARKFDLEKTNQMWSDMLRWRKEFGADTVMEDFEFKEIDEVLKYY 131 Query: 326 ----HGHDANQRPCLIIRLGLACSNLRSNGKSLLIKAVVSQIEHGIL---RMVNVEHP-- 478 HG D RP I RLG S K + + + + + ++ R NV+ P Sbjct: 132 PQGHHGVDKEGRPVYIERLGQVDST-----KLMQVTTMDRYVNYHVMEFERTFNVKFPAC 186 Query: 479 ---------QITVLMDCEGLSPFGFPIHMMRSCAMLLQ----DHYPNRLSSLIIVRLPQV 619 Q T ++D +G+ F R LQ D+YP L+ + I+ Sbjct: 187 SIAAKKHIDQSTTILDVQGVGLKNFN-KAARDLITRLQKVDGDNYPETLNRMFIINAGSG 245 Query: 620 AQIIMQTFFQVLKPSTRQKVRIIGRNHLEFLSNHLNS--IPPFLGGNCSCSNAQTDGCRK 793 +++ T L P T K+ ++G + L +++ +P FLGG+C+C A GC + Sbjct: 246 FRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELPEFLGGSCTC--ADNGGCMR 303 >At2g21520.1 putative phosphatidylinositol/phosphatidylcholine transfer protein / Length = 531 Score = 53.1 bits (126), Expect = 2e-07 Identities = 57/238 (23%), Positives = 94/238 (38%), Gaps = 29/238 (12%) Frame = +2 Query: 161 VPERLNDDELR-QFYAAANGDFARLLSSVKKTIKWR---------QNYTFLSPEELKAWS 310 +P+R +D + +F A D + I+WR Q++ F E+ Sbjct: 5 LPDRHDDYHMMLRFLKARKFDVEKAKQMWADMIQWRKEFGTDTIIQDFDFEEINEVLKHY 64 Query: 311 PFIFWHGHDANQRPCLIIRLGLACSN--LRSNGKSLLIKAVVSQIEHGILRMVNVEHPQI 484 P + HG D RP I RLG N ++ ++ V + E + ++ P Sbjct: 65 PQCY-HGVDKEGRPIYIERLGKVDPNRLMQVTSMDRYVRYHVKEFERSFM----IKFPSC 119 Query: 485 TV-----------LMDCEGLSPFGFPIHMMRSCAMLLQ----DHYPNRLSSLIIVRLPQV 619 T+ ++D +G+ F R LQ D+YP L + I+ Sbjct: 120 TISAKRHIDSSTTILDVQGVGLKNFN-KSARDLITRLQKIDGDNYPETLHQMFIINAGPG 178 Query: 620 AQIIMQTFFQVLKPSTRQKVRIIGRNHLEFLSN--HLNSIPPFLGGNCSCSNAQTDGC 787 +++ T L P T K+ ++G +L L +N +P FLGG C+C A GC Sbjct: 179 FRLLWNTVKSFLDPKTSAKIHVLGYKYLSKLLEVIDVNELPEFLGGACTC--ADQGGC 234 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,943,986 Number of Sequences: 27288 Number of extensions: 360014 Number of successful extensions: 1117 Number of sequences better than 1.0e-05: 32 Number of HSP's better than 0.0 without gapping: 1051 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1093 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1503203240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264702|gb|BM413072.1|BM413072 EST587399 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62K15 5' end, mRNA sequence (775 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g08640.1 expressed protein / ;supported by full-length cDN... 207 9e-55 >At1g08640.1 expressed protein / ;supported by full-length cDNA: Ceres:35718. Length = 294 Score = 207 bits (526), Expect(2) = 9e-55 Identities = 96/135 (71%), Positives = 114/135 (84%) Frame = +1 Query: 271 NPYEVLGVNPIEGFDMVKAAYARRRKDAERRGDEATLAQLEKAYDKIMMSQLTKRKQGVT 450 NPYEVLGVNPIEGFD +K Y R+ KDA+R GDEAT A LEKAYDK+M +QL RK+GVT Sbjct: 74 NPYEVLGVNPIEGFDKIKQTYGRKLKDAQRSGDEATAALLEKAYDKLMYAQLMNRKKGVT 133 Query: 451 FGSFKVSKEVRYADKQPILPWGPRFTKSDDKDIKINLAISAVFIAWVFINRNAEWKPLQF 630 FGSFKVSK+++YADKQPI+PWGPRF++S D+ INLAIS VF AW+ I RN E+KPLQF Sbjct: 134 FGSFKVSKDIKYADKQPIIPWGPRFSRSSKNDMLINLAISVVFSAWIAIKRNVEYKPLQF 193 Query: 631 LAFAFVYRIFEKLKA 675 ++F FVYRIFEKLK+ Sbjct: 194 MSFVFVYRIFEKLKS 208 Score = 24.6 bits (52), Expect(2) = 9e-55 Identities = 11/12 (91%), Positives = 12/12 (99%) Frame = +3 Query: 738 GKRLLRSLALVF 773 GKRLLRSL+LVF Sbjct: 231 GKRLLRSLSLVF 242 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,306,759 Number of Sequences: 27288 Number of extensions: 274719 Number of successful extensions: 696 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264689|gb|BM413059.1|BM413059 EST587386 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62G23 5' end, mRNA sequence (784 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01220.1 hypothetical protein / similar to unknown protein... 244 e-100 >At1g01220.1 hypothetical protein / similar to unknown protein GB:AAF32477 GI:6957733 from [Arabidopsis thaliana] Length = 1055 Score = 244 bits (622), Expect(2) = e-100 Identities = 122/159 (76%), Positives = 135/159 (84%) Frame = +3 Query: 3 KIELPVRVDFVGGWSDTPPWSLERAGCVLNMAITLEDSLPIGTVIEIEKGTGIFISDDVG 182 K+ELPVRVDFVGGWSDTPPWSLERAG VLNMAITLE SLPIGT+IE GI I DD G Sbjct: 714 KVELPVRVDFVGGWSDTPPWSLERAGYVLNMAITLEGSLPIGTIIETTNQMGISIQDDAG 773 Query: 183 NQLSIEDLSSIALPFEISDPFRLVKSALLVTSVIHEKILQSVALQIRTWANVPRGSGLGT 362 N+L IED SI PFE++DPFRLVKSALLVT ++ E + S L I+TWANVPRGSGLGT Sbjct: 774 NELHIEDPISIKTPFEVNDPFRLVKSALLVTGIVQENFVDSTGLAIKTWANVPRGSGLGT 833 Query: 363 SSILAAAVVKGLLRITDGDESNENVTRLVLVLEQLMGTG 479 SSILAAAVVKGLL+I++GDESNEN+ RLVLVLEQLMGTG Sbjct: 834 SSILAAAVVKGLLQISNGDESNENIARLVLVLEQLMGTG 872 Score = 139 bits (349), Expect(2) = e-100 Identities = 71/101 (70%), Positives = 80/101 (78%) Frame = +1 Query: 478 GGGWQDQIGGLYAGIKFTASFPGIPLRLQVIPLLASPQLIKELQQRLSCSFHWSSSTCTP 657 GGGWQDQIGGLY GIKFT+SFPGIP+RLQV+PLLASPQLI EL+QRL F Sbjct: 872 GGGWQDQIGGLYPGIKFTSSFPGIPMRLQVVPLLASPQLISELEQRLLVVF-TGQVRLAH 930 Query: 658 GACIRVVTRYLQRDNLLVSSIKRLTELAKIAREAFMSCDID 780 +VVTRYLQRDNLL+SSIKRLTELAK REA M+C++D Sbjct: 931 QVLHKVVTRYLQRDNLLISSIKRLTELAKSGREALMNCEVD 971 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,609,263 Number of Sequences: 27288 Number of extensions: 365459 Number of successful extensions: 1137 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1076 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1134 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1445754580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264667|gb|BM413037.1|BM413037 EST587364 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62C23 5' end, mRNA sequence (803 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18420.1 putative protein / non-consensus GC donor splice ... 225 2e-59 >At5g18420.1 putative protein / non-consensus GC donor splice site at exon 1, unknown (C40) protein, Homo sapiens, EMBL:AF103798 Length = 441 Score = 225 bits (573), Expect = 2e-59 Identities = 112/235 (47%), Positives = 160/235 (67%), Gaps = 1/235 (0%) Frame = +2 Query: 26 EESNMLLTMLKAGDHRPFDEIVADFISSFPPHRQFYTCFSLALIL-DEKLLKPAQRLVAF 202 EES ++L++LK+ D RP ++++++F S F R C SL+++L D+++ K +RL+AF Sbjct: 12 EESAIVLSLLKS-DLRPMEDVLSEFDSKFESARYLSVCNSLSMMLQDQQMFKNTERLIAF 70 Query: 203 AILLQVYSSQEPSSNPFISLLVNAACDEGAEQCERAFILQLLXXXXXXXXREVLKQSATD 382 I+ Q YSSQ+PS NPF+S +++AAC+E E+ ERAF+L LL +E+LK SA D Sbjct: 71 GIIYQCYSSQKPSFNPFLSEMISAACNEQLEKSERAFLLHLLQWNSYNNVKEILKLSAVD 130 Query: 383 YMKMFDTSQLSFPQREQLQQQYGSKALPEEFQCLIGNNSVKNSIPDPDVPRGCDSNSLEF 562 Y++ FD S FP+ +LQ++YG KA P + + S+K + DPDVPRGCD NS EF Sbjct: 131 YIRSFDPSTHDFPELGELQREYGDKADPGPSSHIFADYSLKKLLHDPDVPRGCDPNSPEF 190 Query: 563 DLLPGSKPKIGSGDVDETITGLLSNLSFEGLGPQWIRPHPPRLPVLDGELVWLTP 727 D+ G P+IGSGD DE ++G L NL+ GLGP+WIRP PPR PV EL+W+ P Sbjct: 191 DVQAGVNPRIGSGDRDEALSGFLGNLTMGGLGPRWIRPCPPRYPVHQSELLWIDP 245 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,053,013 Number of Sequences: 27288 Number of extensions: 373919 Number of successful extensions: 1046 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1046 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1494360868 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264578|gb|BM412948.1|BM412948 EST587275 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61B12 5' end, mRNA sequence (682 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50000.1 hypothetical protein / predicted by genemark.hmm 243 5e-65 >At1g50000.1 hypothetical protein / predicted by genemark.hmm Length = 277 Score = 243 bits (621), Expect = 5e-65 Identities = 119/170 (70%), Positives = 142/170 (83%) Frame = +2 Query: 125 VVRVKGDEFWHMTRVLRLRIHDRVELFDGKGGLVEGCIQNIDQNGLDIVALENPKSVSPH 304 VVRV+G EFWHM +VLRL+ DRVELF+GKGGLVEGCIQ+ID+ G+D +A E+ K + P Sbjct: 51 VVRVQGSEFWHMAKVLRLKQEDRVELFNGKGGLVEGCIQSIDKTGVDFIAQEDQKVILPQ 110 Query: 305 NTQWHVYAAFGTLKGGRADWLVEKCTELGACSVTPLLTDRSPSISENRVDRLQRVNLAAA 484 QW V+AAFGTLKGGRADWL+EKCTELGA SVTPLLT+RSP ISENRVDRL+RV+ AAA Sbjct: 111 GMQWQVFAAFGTLKGGRADWLIEKCTELGASSVTPLLTERSPIISENRVDRLERVSFAAA 170 Query: 485 KQCQRLHEMVLNPPIKIGGLLPLVKNSKLSFIATAEAKPVFSALSSIKKD 634 KQCQRLH+MVLNPPIK G LL +SKL +ATAEAKP+ +A++S K+ Sbjct: 171 KQCQRLHQMVLNPPIKFGTLL---DHSKLCLVATAEAKPLLNAVNSSAKE 217 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,786,536 Number of Sequences: 27288 Number of extensions: 319549 Number of successful extensions: 830 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 829 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1156603240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264527|gb|BM412897.1|BM412897 EST587224 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61F3 5' end, mRNA sequence (750 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01760.1 double-stranded RNA-specific editase, putative / ... 121 1e-48 >At1g01760.1 double-stranded RNA-specific editase, putative / similar to double-stranded RNA-specific editase GB:AAF69673 GI:7770275 from [Danio rerio] Length = 325 Score = 121 bits (304), Expect(3) = 1e-48 Identities = 57/72 (79%), Positives = 62/72 (85%) Frame = +3 Query: 402 SFHLW*PLVFVASIPPEEFQHSETALTTLTCGYSICWNNSGLHEVILGTTGRKQGTSAKG 581 SF L PL FVA +PP EFQHSETA TLTCGYS+CWN SGLHEVILGTTGRKQGTSAKG Sbjct: 254 SFRLNKPLFFVAPVPPSEFQHSETAQATLTCGYSLCWNYSGLHEVILGTTGRKQGTSAKG 313 Query: 582 AMSPSTESSLCK 617 A+ PST+SS+CK Sbjct: 314 ALYPSTQSSICK 325 Score = 58.2 bits (139), Expect(3) = 1e-48 Identities = 27/58 (46%), Positives = 42/58 (71%) Frame = +1 Query: 163 RGALLSYFLEPIYISSVTIGQSHIASKTSIIEDEVMRATYERILPLSNKLMDPFQVNK 336 +GALL L+P+YIS++T+GQS + + D + R+ YERILPLS++L+ F++NK Sbjct: 202 QGALLYQVLQPVYISTITVGQSLHSPDNFSLADHLRRSLYERILPLSDELLTSFRLNK 259 Score = 52.4 bits (124), Expect(3) = 1e-48 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 92 VMRKPGRGDTTLSVSCSDKIARWNV 166 V RKPGRG+TTLSVSCSDKIARWNV Sbjct: 174 VQRKPGRGETTLSVSCSDKIARWNV 198 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,201,089 Number of Sequences: 27288 Number of extensions: 393849 Number of successful extensions: 1106 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1106 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264514|gb|BM412884.1|BM412884 EST587211 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61B15 5' end, mRNA sequence (735 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g46220.1 putative protein / KIAA0776 protein, Homo sapiens... 269 1e-72 >At3g46220.1 putative protein / KIAA0776 protein, Homo sapiens, EMBL:AB018319; supported by cDNA: gi_14334491_gb_AY034937.1_ Length = 530 Score = 269 bits (687), Expect = 1e-72 Identities = 137/215 (63%), Positives = 173/215 (79%), Gaps = 1/215 (0%) Frame = +1 Query: 70 DESFLNMQLYEKALDLFEDEPSTSVLLHKHLLRTTGTSIVDTXXXXXXXXXXXXXGVPVE 249 DESFLNMQLYEKALDLFED+ ST+V+LH+HLLRTT +I DT G VE Sbjct: 280 DESFLNMQLYEKALDLFEDDQSTAVVLHRHLLRTTAATIADTLLHGLDIHNKMKNGTEVE 339 Query: 250 PQAPES-ILLSPGDRSALAKSLTGSMSAKAIATVEALEGKRVESFMSALREVAEESGLAL 426 + +LL +R+ALAK+L GS+S KA+A VEALEGKRV++FM R++AEESGL L Sbjct: 340 ESKTQDLVLLDSSERTALAKNLNGSLSKKALALVEALEGKRVDTFMVTFRDLAEESGLVL 399 Query: 427 KKLDKKLERTLLHSYRKDLTSQVSAETDPVSLLPQVISLLYVQVHGKALQAPGRAISAAV 606 KKLDKKLERTLLHSYRKDL SQVS E+DP++LL +V+SLL++++H KALQAPGRAI+AA+ Sbjct: 400 KKLDKKLERTLLHSYRKDLISQVSTESDPIALLAKVVSLLFIKIHNKALQAPGRAIAAAI 459 Query: 607 SRLKDKLDDSAFKTLVDYQSGTVSVLALMAAATGE 711 S LK+KLD+SA+KTL DYQ+ TV++LALM+A++GE Sbjct: 460 SHLKEKLDESAYKTLTDYQTATVTLLALMSASSGE 494 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.131 0.346 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,769,455 Number of Sequences: 27288 Number of extensions: 284599 Number of successful extensions: 726 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264458|gb|BM412828.1|BM412828 EST587155 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61C22 5' end, mRNA sequence (621 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28200.1 putative protein / hypothetical protein - Schizos... 275 1e-74 >At4g28200.1 putative protein / hypothetical protein - Schizosaccharomyces pombe, PID:e1295810; supported by cDNA: gi_18252168 Length = 648 Score = 275 bits (704), Expect = 1e-74 Identities = 131/212 (61%), Positives = 162/212 (75%), Gaps = 6/212 (2%) Frame = +3 Query: 3 EIYRLATTRFKGDIELWFQYLEFCRERRNGRMKKALAQVIRFHPKVPGVWIYAAAWEFDX 182 EIYRLAT R+KGDI LWF+YLEFC+++R+GRMKKALAQ IRFHPKV GVWIYAA+WEFD Sbjct: 98 EIYRLATMRYKGDINLWFRYLEFCKQKRHGRMKKALAQAIRFHPKVAGVWIYAASWEFDR 157 Query: 183 XXXXXXXXXXMHSGLRACPTSEDLWVEYLRMELTYLNKLKARKVVLGEDEGTLARSGNSA 362 M +GLR C SEDLWVEYLRMELT+LNKLKARKV LGED+G+L R + Sbjct: 158 NLNVTAARALMLNGLRVCSNSEDLWVEYLRMELTFLNKLKARKVALGEDKGSLVRDTKTV 217 Query: 363 KEEQWRDENKELFIVLDDKREEDKLSNLHDG------DSKEKLDLFRKQGLSVLQTVYGG 524 ++EQW+DENKELF+ LD+K +K N D D EK+D +++G +VLQT+Y G Sbjct: 218 EDEQWKDENKELFMSLDEKEGNEKEENDEDSIVEDVEDVTEKVDFLKEKGSNVLQTIYSG 277 Query: 525 SIRALPSSFSLRTKFLDILEATDLCHSEDMRN 620 ++ A+PSSF LR +FL+ILEATDL HS++MRN Sbjct: 278 AVEAIPSSFDLRKRFLEILEATDLAHSDEMRN 309 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,719,472 Number of Sequences: 27288 Number of extensions: 265100 Number of successful extensions: 852 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 848 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 990590196 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264438|gb|BM412808.1|BM412808 EST587135 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61O17 5' end, mRNA sequence (763 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g48050.1 regulatory protein, putative / contains Pfam prof... 248 2e-84 >At1g48050.1 regulatory protein, putative / contains Pfam profile: PF02197 Regulatory subunit of type II PKA R-subunit; supported by cDNA: gi_12006421_gb_AF283758.1_AF283758 Length = 680 Score = 248 bits (632), Expect(3) = 2e-84 Identities = 109/178 (61%), Positives = 148/178 (82%) Frame = +2 Query: 53 PTSLLGALRTRNISPVTIYRGDLEISAQLKIKVWVYKKTSEEKFPTLKKYSERTPTTDKF 232 P SLLG+L+TR ++PVT++RGDLEI+ +KIKVWVYKK +EE+ PTLK YS++ P TDKF Sbjct: 201 PLSLLGSLKTRRVAPVTLFRGDLEINPTMKIKVWVYKKVAEERLPTLKMYSDKAPPTDKF 260 Query: 233 GAHDIKVEYENKIIEDPNKVVPPEQRIKGFQYGPQVVPISSAELEAVKFKPEKSVKLLGF 412 H++KV+Y+ K+ + +V+ PE+RIKGF+YGPQV+PIS ++E +KFK +K +KLLGF Sbjct: 261 AKHEVKVDYDYKVTAESTEVIAPEERIKGFRYGPQVIPISPDQIETLKFKTDKGMKLLGF 320 Query: 413 TDSSNIMRHYYLKDVNIFIAEPGNKNAILALSALARAMKEMNKVAIVRCVWRQGQGNV 586 T++SNI+RHYY+KDVNI + +P + ++LA+SA+AR MKE NKVAIVRCVWR GQGNV Sbjct: 321 TEASNILRHYYMKDVNIVVPDPSKEKSVLAVSAIAREMKETNKVAIVRCVWRNGQGNV 378 Score = 66.2 bits (160), Expect(3) = 2e-84 Identities = 29/39 (74%), Positives = 34/39 (86%) Frame = +3 Query: 591 VGVLTPNVSDKDNTPDSFYFNILPFAEDVRGFPVSFFQQ 707 VGVLTPNVS++D+TPDSFYFN+LPFAEDVR FP F + Sbjct: 380 VGVLTPNVSERDDTPDSFYFNVLPFAEDVREFPFPSFNK 418 Score = 37.7 bits (86), Expect(3) = 2e-84 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = +1 Query: 682 DFQFPSFSNLPSSMQPNEKQQDAADKL 762 +F FPSF+ LPSS +P+E+QQ AD L Sbjct: 410 EFPFPSFNKLPSSWKPDEQQQAVADNL 436 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,064,150 Number of Sequences: 27288 Number of extensions: 351372 Number of successful extensions: 972 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 972 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1383666960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264423|gb|BM412793.1|BM412793 EST587120 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61M9 5' end, mRNA sequence (736 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g07950.1 expressed protein / ;supported by full-length cD... 275 1e-74 >At3g07950.1 expressed protein / ;supported by full-length cDNA: Ceres:13017. Length = 304 Score = 275 bits (704), Expect = 1e-74 Identities = 128/202 (63%), Positives = 160/202 (78%) Frame = +3 Query: 6 TVYGAIISTIGLLFLGKLLEPIWGSREFLKFIFIVNFLTSVFVFITAISLYYVTRLEIYL 185 +VYG + ST+ LLF+GK LEP+WGS EFLKFIF+VNFLT + VF+TAI+LYY+TRLE+YL Sbjct: 63 SVYGVVFSTVSLLFMGKFLEPVWGSTEFLKFIFVVNFLTYLCVFVTAIALYYITRLEVYL 122 Query: 186 YMPISGFQGVLSGFLVGVKQIMPDQELSILKLKAKWLPSLALLFSIAISFFTADSVSYLP 365 YMP +GF GVL+G LVG+KQI+PDQE+ +LK+KAKWLPS+ L+ SIA SFFT DS +YLP Sbjct: 123 YMPFAGFHGVLAGLLVGIKQIIPDQEILLLKIKAKWLPSIMLILSIASSFFTLDSAAYLP 182 Query: 366 TIVFGTYLGWIYLRYWQKKPETKLKGXXXXXXXXXXXXXXXLRPVIDPIATIFERMLCGR 545 T++FGTY+GW+YLRY Q++PETKL+G LRPVIDPIA IF RMLCGR Sbjct: 183 TLIFGTYMGWLYLRYLQRRPETKLRGDPSDDFAFSTFFPELLRPVIDPIALIFHRMLCGR 242 Query: 546 RSETSNEERGYTLGGSTLPGSD 611 + TS E+ Y+ G+ LPGSD Sbjct: 243 SNATS-EDHDYSTSGAPLPGSD 263 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,049,441 Number of Sequences: 27288 Number of extensions: 303233 Number of successful extensions: 894 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 871 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 894 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264401|gb|BM412771.1|BM412771 EST587098 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61G19 5' end, mRNA sequence (593 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04780.1 hypothetical protein / 160 4e-40 >At4g04780.1 hypothetical protein / Length = 381 Score = 160 bits (406), Expect = 4e-40 Identities = 88/121 (72%), Positives = 94/121 (76%), Gaps = 1/121 (0%) Frame = +2 Query: 2 NTFGTLQRDAPPVRLS-XXXXXXXXXXXTEDSANVAEQPKQMSAAFVKAAKQQFDVLVAA 178 N FGTLQRDAPPV+LS T+D+ EQPKQ+SA VKAAK QFD LVAA Sbjct: 262 NAFGTLQRDAPPVQLSPNYPEPPATTTVTDDATPFPEQPKQLSAGLVKAAK-QFDALVAA 320 Query: 179 LPLSDGSEEAQLKRIAELQAENDAVGQELQKQLEAAEKELKQVQELFNQATDNCLNLKKP 358 LPLS+G E AQLKRIAELQ END VGQELQKQLEAAEKELKQVQELF QA DNCLN+KKP Sbjct: 321 LPLSEGGEGAQLKRIAELQVENDLVGQELQKQLEAAEKELKQVQELFGQAADNCLNMKKP 380 Query: 359 E 361 E Sbjct: 381 E 381 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,208,095 Number of Sequences: 27288 Number of extensions: 203439 Number of successful extensions: 571 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 922006972 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264365|gb|BM412735.1|BM412735 EST587062 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61A11 5' end, mRNA sequence (627 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g28120.1 expressed protein / ;supported by full-length cDN... 262 9e-71 >At1g28120.1 expressed protein / ;supported by full-length cDNA: Ceres:106626. Length = 306 Score = 262 bits (670), Expect = 9e-71 Identities = 125/195 (64%), Positives = 158/195 (80%) Frame = +3 Query: 42 LKLMTGKKYKDDDIMQQHSAIQAEQAVKVPFLGDKEPLSSLEAEYHLGNSIVLEKIKVLS 221 + + G+++ + ++ + Q E+A KVP++GDKEPLSSL AEY G+ I+LEKIK+L Sbjct: 18 ISAIKGEEWGNCSSVEDQPSFQEEEAAKVPYVGDKEPLSSLAAEYQSGSPILLEKIKILD 77 Query: 222 EQYAAIRRTRGDGNCFFRSFMFGYLEHILESQDHNEVQHIKSNIEECKKTLQSLGYAEFT 401 QY IRRTRGDGNCFFRSFMF YLEHILESQD EV IK N+E+C+KTLQ+LGY +FT Sbjct: 78 SQYIGIRRTRGDGNCFFRSFMFSYLEHILESQDRAEVDRIKVNVEKCRKTLQNLGYTDFT 137 Query: 402 FEDFFALFLEQLDSVLSGSEDSISHDELLCRSRDPSISDYGVMFFRFVTSGEIRKRSEFF 581 FEDFFALFLEQLD +L G+E+SIS+DEL+ RSRD S+SDY VMFFRFVT+G+IR R++FF Sbjct: 138 FEDFFALFLEQLDDILQGTEESISYDELVNRSRDQSVSDYIVMFFRFVTAGDIRTRADFF 197 Query: 582 EPFILRLNNTSVEQF 626 EPFI L+N +V+QF Sbjct: 198 EPFITGLSNATVDQF 212 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,967,515 Number of Sequences: 27288 Number of extensions: 264705 Number of successful extensions: 828 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 828 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1008438668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264348|gb|BM412729.1|BM412729 EST587045 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG60N20 5' end, mRNA sequence (751 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39690.1 putative protein / ; supported by cDNA: gi_13605... 215 2e-56 >At4g39690.1 putative protein / ; supported by cDNA: gi_13605658_gb_AF361810.1_AF361810 Length = 650 Score = 215 bits (547), Expect(2) = 2e-56 Identities = 118/238 (49%), Positives = 140/238 (58%) Frame = +2 Query: 2 YISKDGKLVLDVLQVIHETESRQAELDARLFAXXXXXXXXXXXXXXXDARARELMYAERE 181 Y+++DGKLVLD L IH E +QA LDA++FA D RARELM E Sbjct: 318 YMTEDGKLVLDFLAAIHAAEKQQAHLDAQVFAEELRALKEKYENELRDLRARELMRIEEA 377 Query: 182 ALLDKELKKERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLDAAIA 361 A+LDKELK+ER ++ + IA Sbjct: 378 AILDKELKRERTKAAAAIKAIQERMEDKLKAELEQKETEAQLALSKAEELAKAEMISTIA 437 Query: 362 SEKASQIEKMAEANLHINALCMAFYARSEEVRQTHSVHKLALGVLALEDALSRGLPIQKE 541 EKA+QIEKMAEA+L+I AL MAFYARSEE RQ+HSVHKLALG LAL+D LS+GLP+QKE Sbjct: 438 KEKAAQIEKMAEADLNIKALSMAFYARSEEARQSHSVHKLALGALALDDTLSKGLPVQKE 497 Query: 542 LENLHTSLEGIXXXXXXXXXXXXXPEETQRYGSDTVLQLNHKFDTLKGTLRHFSLIPP 715 ++ L T LEG PEE + G+DTVLQLN KFDTLKGTLRHFSLIPP Sbjct: 498 IDTLQTYLEGTHKDSILGLVLSSLPEEARSNGTDTVLQLNQKFDTLKGTLRHFSLIPP 555 Score = 22.3 bits (46), Expect(2) = 2e-56 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 721 GGGILTHSLA 750 GGGIL HSLA Sbjct: 557 GGGILAHSLA 566 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,256,594 Number of Sequences: 27288 Number of extensions: 276801 Number of successful extensions: 668 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264301|gb|BM412671.1|BM412671 EST586998 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG60F2 5' end, mRNA sequence (637 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g17690.1 expressed protein / ; supported by cDNA: gi_15810... 298 1e-81 >At1g17690.1 expressed protein / ; supported by cDNA: gi_15810522_gb_AY056300.1_ Length = 754 Score = 298 bits (764), Expect = 1e-81 Identities = 141/213 (66%), Positives = 176/213 (82%), Gaps = 4/213 (1%) Frame = +3 Query: 9 YLDGQAPFYRQSIILSSHINPDINGLFNHHCLNHEGKVKLASEYKGVLPKVVLQIRQIYE 188 YLDG A FYRQSIILSS++ P++N LF HCLN++GK+K+A EYKGVL KV+L +RQIYE Sbjct: 527 YLDGHARFYRQSIILSSYLTPEMNSLFGRHCLNYKGKMKMACEYKGVLEKVLLPVRQIYE 586 Query: 189 RFDANTAEDADDARFDYFTKKVFPKIKDSTQGGIMLFISSYFEFIRVRNFLKSQEASFCL 368 RFDA + DDAR +YFTKK+FPKIKDS QGG+M+FI SYFEF+R+RNFL +Q SFCL Sbjct: 587 RFDAASITQVDDARLEYFTKKIFPKIKDSVQGGVMIFIHSYFEFVRLRNFLNTQNTSFCL 646 Query: 369 LGEYTEQSDISRARGWFFDGKKKIMLYTERAHFYHRYKIRGIQNLIIYSLPERKEFYPEV 548 LG+Y + +DISRAR FF G +KIMLYTERA+FY RYKIRGI+NLI+YSLPERKEFYPE+ Sbjct: 647 LGDYAKNADISRAREQFFVGSRKIMLYTERAYFYKRYKIRGIKNLILYSLPERKEFYPEI 706 Query: 549 VNLLQGSA----CTVLFSRYDQLRLDRIVGTAA 635 +N+L+ + T LFSR+D L+L+RIVG+ + Sbjct: 707 MNMLEEGSHDMMSTALFSRFDMLQLERIVGSTS 739 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,421,768 Number of Sequences: 27288 Number of extensions: 277068 Number of successful extensions: 711 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264265|gb|BM412635.1|BM412635 EST586962 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG60N15 5' end, mRNA sequence (785 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g42990.1 bZIP family transcription factor / contains Pfam ... 114 6e-26 At2g40950.1 bZIP family transcription factor / similar to Atb... 50 1e-06 At3g17610.1 bZIP family transcription factor / similar to TGA... 47 9e-06 >At1g42990.1 bZIP family transcription factor / contains Pfam profile: PF00170: bZIP transcription factor; supported by cDNA: gi_15028322_gb_AY045964.1_ Length = 295 Score = 114 bits (285), Expect = 6e-26 Identities = 86/247 (34%), Positives = 120/247 (47%), Gaps = 16/247 (6%) Frame = +2 Query: 11 EQLLMNDDDFGLVS----DPQFAAESLSDFLVXXXXXXXXXXXXAEQAIGFSDPKVSSAD 178 E LMND++ S D Q ++ ++D LV A + D ++ D Sbjct: 47 ENQLMNDENHQEESFVELDQQSVSDFIADLLVDYPTSDSGSVDLAADKVLTVDSPAAADD 106 Query: 179 QDKH--------KVSQSPS---DGDDELNNHDPVDKKRKRQLRNRDAAVRSRERKKLYVR 325 K K + S S D DDE + D V KKR+R++RNRDAAVRSRERKK YV+ Sbjct: 107 SGKENSDLVVEKKSNDSGSEIHDDDDEEGDDDAVAKKRRRRVRNRDAAVRSRERKKEYVQ 166 Query: 326 DLELKSRYFESECKRLGFVLQCCLAENQALRFSLHNSSANGVS-MTKQESAVXXXXXXXX 502 DLE KS+Y E EC RLG +L+C +AENQ+LR+ L + N + M+KQESAV Sbjct: 167 DLEKKSKYLERECLRLGRMLECFVAENQSLRYCLQKGNGNNTTMMSKQESAVLLLESLLL 226 Query: 503 XXXXXXXXITCLLILPSQTWSVPEESQGSRNHGLLVPIKEGKKTSRILLFLSFMMSKRCK 682 + + + P + + + +L + K S +S+RCK Sbjct: 227 GSLLWLLGVNFICLFPYMSHTKCCLLRPEPEKLVLNGLGSSSKPSYT------GVSRRCK 280 Query: 683 ASRSRMK 703 SR RMK Sbjct: 281 GSRPRMK 287 >At2g40950.1 bZIP family transcription factor / similar to AtbZIP transcription factor GI:17065880 from [Arabidopsis thaliana]; contains Pfam profile: bZIP transcription factor PF00170 Length = 721 Score = 50.1 bits (118), Expect = 1e-06 Identities = 31/79 (39%), Positives = 41/79 (51%) Frame = +2 Query: 191 KVSQSPSDGDDELNNHDPVDKKRKRQLRNRDAAVRSRERKKLYVRDLELKSRYFESECKR 370 K +S D D + +KKR R +RNR++A SR+RKK YV +LE K R S Sbjct: 210 KYRRSGEDADASAVTGEEDEKKRARLMRNRESAQLSRQRKKHYVEELEEKVRNMHSTITD 269 Query: 371 LGFVLQCCLAENQALRFSL 427 L + +AEN LR L Sbjct: 270 LNGKISYFMAENATLRQQL 288 >At3g17610.1 bZIP family transcription factor / similar to TGACG-motif binding factor GI:2934884 from [Glycine max]; contains Pfam profile: PF00170 bZIP transcription factor; supported by full-length cDNA: Ceres: 35429. Length = 135 Score = 47.4 bits (111), Expect = 9e-06 Identities = 38/116 (32%), Positives = 54/116 (45%), Gaps = 26/116 (22%) Frame = +2 Query: 167 SSADQDKHKVSQSP-----SDGDDELNN------------------HDPVDKKR---KRQ 268 SS+ KHK + S DD +NN +PVDK+ KR Sbjct: 12 SSSSHKKHKTAAGSTCVLSSSADDGVNNPELDQTQNGVSTAKRRRGRNPVDKEYRSLKRL 71 Query: 269 LRNRDAAVRSRERKKLYVRDLELKSRYFESECKRLGFVLQCCLAENQALRFSLHNS 436 LRNR +A ++RERKK+YV DLE ++ ++ +L + EN LR L N+ Sbjct: 72 LRNRVSAQQARERKKVYVSDLESRANELQNNNDQLEEKISTLTNENTMLRKMLINT 127 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,771,245 Number of Sequences: 27288 Number of extensions: 317901 Number of successful extensions: 1232 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 1157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1225 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264249|gb|BM412619.1|BM412619 EST586946 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG60J23 5' end, mRNA sequence (658 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18410.1 putative protein / p53 inducible protein PIR121, ... 337 4e-93 >At5g18410.1 putative protein / p53 inducible protein PIR121, Homo sapiens, EMBL:AF160973 Length = 1235 Score = 337 bits (863), Expect = 4e-93 Identities = 165/218 (75%), Positives = 191/218 (86%) Frame = +1 Query: 1 LGLIPGADGQILHSQEGGDSPMVTLFKSATTATMSNPNCTNPTSFHTISRQAEAADLLYK 180 LGLIPGA+GQI+++Q+G +SP+V L KSAT+A +S+P C NP +F+T+S+QAEAADLLYK Sbjct: 989 LGLIPGAEGQIVNAQDG-ESPLVNLLKSATSAVVSSPGCLNPAAFYTMSKQAEAADLLYK 1047 Query: 181 ANINTGSVLEYALAFTSAALDKYCSKWSAAPKTGFIDITTSKDFYRIFSGLQIEYLEESI 360 AN+N GSVLEY LAFTSA+LDKYCSKWSA PKTGF+DITTSKDFYRI+ GLQI YLEE Sbjct: 1048 ANMNGGSVLEYTLAFTSASLDKYCSKWSAPPKTGFVDITTSKDFYRIYGGLQIGYLEEIT 1107 Query: 361 QLQSNTYEMLGDSVAWGGCTIIYLLGQQLHFELFDFSHQVLNVAEVESVAISPTQKNPNF 540 QS +E+LGDS+AWGGCTIIYLLGQQLHFELFDFS+QVLNV+EVE+V+ S T +NP Sbjct: 1108 APQSAQHEVLGDSIAWGGCTIIYLLGQQLHFELFDFSYQVLNVSEVETVSASHTHRNPQI 1167 Query: 541 LQGIEGLLEAMKKARRLNNHVFSMLKARCPLEDKQACA 654 QG EGLLE MKKARRLNNHVFSMLKARCPLEDK ACA Sbjct: 1168 HQGWEGLLEGMKKARRLNNHVFSMLKARCPLEDKTACA 1205 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,591,775 Number of Sequences: 27288 Number of extensions: 307124 Number of successful extensions: 737 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 735 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1097681028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264154|gb|BM412524.1|BM412524 EST586851 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG60G20 5' end, mRNA sequence (763 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g15140.1 expressed protein / Contains a PF|00175 Oxidoredu... 272 2e-73 >At1g15140.1 expressed protein / Contains a PF|00175 Oxidoreductase FAD/NADH-binding domain. ESTs gb|H76345 and gb|AA651465 come from this gene; supported by cDNA: gi_15451091_gb_AY054626.1_ Length = 295 Score = 272 bits (695), Expect(2) = 2e-73 Identities = 130/190 (68%), Positives = 153/190 (80%) Frame = +1 Query: 157 QDTNLWTTAPLVTVSPAAESLFHVTIDVSDYPDLANSHTKAGQYLQLRIPDVEKXXXXXX 336 QD +LWT APL + AAESLFH++ID+S+ PDL S+T+ GQYLQ+R+PDVEK Sbjct: 53 QDASLWTPAPLSLIESAAESLFHISIDISNAPDLVASYTRPGQYLQIRVPDVEKPSFMAI 112 Query: 337 XXXXXXXXXKGVFEFLVKSISGSTAELLCGLQKGDVVELSQVMGKGFDLDQISPAEEYQT 516 +G FEFLVKSI+GSTAE+LCGL+KG+ VELS VMG GF++D I P EEY T Sbjct: 113 ASPPSLASSRGAFEFLVKSIAGSTAEILCGLKKGETVELSSVMGNGFNIDLIDPPEEYPT 172 Query: 517 VVIFATGSGISPIRSLIEAGFGADRRSDVRVYYGARNLKRMAYQDKFENWASSGVKVVPV 696 V+IFATGSGISPIRSLIE+GFGADRRSDVR+YYGARNL RMAYQ+KF+ W S+GVKVVPV Sbjct: 173 VLIFATGSGISPIRSLIESGFGADRRSDVRLYYGARNLNRMAYQEKFKEWESAGVKVVPV 232 Query: 697 LSQPDDAWKG 726 LSQPDD WKG Sbjct: 233 LSQPDDGWKG 242 Score = 21.9 bits (45), Expect(2) = 2e-73 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 735 GYVQAAFAR 761 GYVQAAFAR Sbjct: 245 GYVQAAFAR 253 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,058,584 Number of Sequences: 27288 Number of extensions: 342291 Number of successful extensions: 1081 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1018 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1078 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1383666960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264015|gb|BM412385.1|BM412385 EST586712 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG59L20 5' end, mRNA sequence (721 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g17930.1 expressed protein / ;supported by full-length cDN... 105 2e-23 >At3g17930.1 expressed protein / ;supported by full-length cDNA: Ceres:20484. Length = 190 Score = 105 bits (262), Expect = 2e-23 Identities = 60/141 (42%), Positives = 76/141 (53%), Gaps = 1/141 (0%) Frame = +3 Query: 144 VSHNMSMKKVPRMITRASSEPSGSSDGALGQNKT-PFGYTRKDXXXXXXXXXXXXXXXKS 320 +S ++ + RM R SS + + D + + KT PFGYTRKD +S Sbjct: 49 LSSSVEKGEKQRMRCRVSSNSTETEDDSATKTKTTPFGYTRKDVILIGVGVTALGIGLES 108 Query: 321 GLEFLGFDPXXXXXXXXXXXXXXXXXXWISTYIFRVSNKEMTYAQQLRDYESKVMEKRLE 500 GLE++G DP WISTYIFRV NKEMTYAQQLRDYES+VM+KRLE Sbjct: 109 GLEYVGVDPLQAGNAVQLILVLGLTLGWISTYIFRVGNKEMTYAQQLRDYESQVMQKRLE 168 Query: 501 SLTEAXXXXXXXXXXXXKTRL 563 SL+EA KT++ Sbjct: 169 SLSEAELEALMAQVDEEKTKV 189 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,669,912 Number of Sequences: 27288 Number of extensions: 313509 Number of successful extensions: 899 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 895 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1272263564 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263890|gb|BM412260.1|BM412260 EST586587 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG59B7 5' end, mRNA sequence (724 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g18340.1 expressed protein / similar to hypothetical prote... 308 2e-84 >At1g18340.1 expressed protein / similar to hypothetical protein GB:AAF25986 GI:6714290 from [Arabidopsis thaliana];supported by full-length cDNA: Ceres:126051. Length = 301 Score = 308 bits (788), Expect = 2e-84 Identities = 163/240 (67%), Positives = 193/240 (79%), Gaps = 13/240 (5%) Frame = +1 Query: 43 MTPVSSKLYADDVSLLMVLVDTNPYFWSSMKNTAFTFPKFISHVLAFLNSILLLNQMNQV 222 M ++SK Y+DDVSLL++L+DTNP FWS+ T+ TF +F+SHVLAFLN++L LNQ+NQV Sbjct: 1 MPAIASKQYSDDVSLLVLLLDTNPLFWST---TSITFSQFLSHVLAFLNAVLGLNQLNQV 57 Query: 223 VVIATGYNSCDYVFDSS-TSSMQRAEC-----------LLEKLEDFVDKDESLSQED-SV 363 VVIATGY+SCDY++DSS TS+ E LL+KLE+FV KDE LS+E+ S Sbjct: 58 VVIATGYSSCDYIYDSSLTSNHGNFESNGTGMPAIFGSLLKKLEEFVTKDEELSKEEVSE 117 Query: 364 DGVGFSLLSGALSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAVMNSIFSAQRS 543 D + LLSG+LSMALCYIQRVFRSG LHPQPRILCL GSPDGP QYVAVMNSIFSAQR Sbjct: 118 DRIPSCLLSGSLSMALCYIQRVFRSGHLHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRL 177 Query: 544 MVPIDSCVIGSQHSAFLQQASYITGGVYLKPQVSDGLFQYLSTVFATDLHSRSFLALPRP 723 MVPIDSC IG Q+SAFLQQASYITGGV+ P+ DGLFQYL+T+FATDLHSR F+ LP+P Sbjct: 178 MVPIDSCYIGVQNSAFLQQASYITGGVHHTPKQLDGLFQYLTTIFATDLHSRGFVQLPKP 237 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,789,851 Number of Sequences: 27288 Number of extensions: 337199 Number of successful extensions: 1001 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 958 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 996 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1268361380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263881|gb|BM412251.1|BM412251 EST586578 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG59O8 5' end, mRNA sequence (750 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39370.1 ubiquitin-specific protease 27 (UBP27), putative /... 114 6e-26 >At4g39370.1 ubiquitin-specific protease 27 (UBP27), putative / similar to GI:11993494; ubiquitin specific protease 66 - Gallus gallus,PID:g3800764; supported by cDNA: gi_11993493_gb_AF302675.1_AF302675 Length = 494 Score = 114 bits (285), Expect = 6e-26 Identities = 58/121 (47%), Positives = 80/121 (65%) Frame = +2 Query: 2 WHTAAEKYVSAMDENEAIVEKLKLCNEEDSCDCKQLACLAKFPWSNSFSRTFKQLSIGRS 181 WH AA KY+S + E +EKL+ C ED CDCK L + PWSNS+S KQL I R Sbjct: 298 WHGAALKYLSVIGAAETEIEKLRSCGGEDQCDCKTSLHLQRMPWSNSYSHILKQLIIARF 357 Query: 182 PKVLCLHLQRASINVFGEQNKLQGHISFPLILDLAPFVKSGVGTKSWEENLQIGQITHQQ 361 PK+LC+ +QRAS N+F E+ KL GHI+FPL+L+L+ F S +G + EE +++ +Q+ Sbjct: 358 PKLLCIQVQRASFNMF-EEFKLSGHIAFPLVLNLSLFTPSSIGV-NIEERIEMSS-EYQK 414 Query: 362 P 364 P Sbjct: 415 P 415 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,841,166 Number of Sequences: 27288 Number of extensions: 337582 Number of successful extensions: 993 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 955 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 991 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263470|gb|BM411840.1|BM411840 EST586167 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG58G19 5' end, mRNA sequence (807 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54540.1 putative protein / similar to unknown protein (pi... 97 8e-21 >At5g54540.1 putative protein / similar to unknown protein (pir||T05538); supported by cDNA: gi_16648815_gb_AY058185.1_ Length = 297 Score = 97.4 bits (241), Expect = 8e-21 Identities = 67/210 (31%), Positives = 105/210 (49%), Gaps = 4/210 (1%) Frame = +1 Query: 166 VSISGLSSTSEDVKSGMVTASHGGSLDVSHVPKMVSDFDDWEMAGGEEEMMVNPGEPLPR 345 V + +++S+ V + + +A H S++ + +DDWE A EE EP+PR Sbjct: 37 VKTAAAAASSKPVSASITSAVHP-SVEEDGMIMQRPVWDDWEFA---EE------EPIPR 86 Query: 346 LVFGGAPSLQEATEATSDLKDA--LVYLXX--XXXXXXXXXXXXXXXXXXXXXXXXXETI 513 +VF PSL+EA EAT DLK+A LVY+ Sbjct: 87 VVFSKPPSLEEAKEATEDLKEAINLVYMSSPKSSAAMEGSNDGGSVSKMLSGFQSSENRA 146 Query: 514 VTKSVPKHAVQAYRVLSEIPAAQNVVASIACDPNVWNAVLQNPALQDFLESQRSSEKCAS 693 V +VP+ A+QA+ LSE AAQ VVASIA DP VW+AV++N L FL++ +++ Sbjct: 147 VESAVPQVALQAFAFLSENTAAQTVVASIASDPKVWDAVMENKDLMKFLQTNKTAVSSQV 206 Query: 694 FPDSDQERDESVANTDYFSESSPLKAVPLI 783 D+D + + S E+ P++ + ++ Sbjct: 207 ESDNDDQSERSSTTECEVVETKPMELLEIL 236 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,685,101 Number of Sequences: 27288 Number of extensions: 350697 Number of successful extensions: 1072 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1028 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1070 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1503203240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263413|gb|BM411783.1|BM411783 EST586110 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57N6 5' end, mRNA sequence (786 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03210.1 unknown protein / 137 2e-44 >At3g03210.1 unknown protein / Length = 368 Score = 137 bits (345), Expect(2) = 2e-44 Identities = 76/148 (51%), Positives = 91/148 (61%), Gaps = 13/148 (8%) Frame = +1 Query: 190 MLGAVQLGLFAAGVVLFVPMGMAGWHLSRNKMLFFSCALFITLAVGVHLVPYFPXXXXXX 369 MLGA+ LG+ AA VLFVPM MAGWHLSRNKMLFFS ALFI+LAV VHL PYFP Sbjct: 1 MLGAIHLGVLAACFVLFVPMAMAGWHLSRNKMLFFSGALFISLAVCVHLTPYFP--SVSD 58 Query: 370 XXXXXXXXXVIVNRDSCFSLLHQVAFDFQELSN----NSKRGS---------WKWVESEN 510 V +R SC + ++Q+ +D + + N GS W W++S Sbjct: 59 IVASVSSVVVYDHRISCINEVNQIVWDVKPVPNPESVRRNNGSTKLDYFVKNWDWMKSRK 118 Query: 511 VVDCDFQKLTMNDASDLLNGSWVVVAGD 594 V+ C+FQKL D SDLLNGSWVVVAGD Sbjct: 119 VLSCEFQKLDKFDVSDLLNGSWVVVAGD 146 Score = 59.7 bits (143), Expect(2) = 2e-44 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +3 Query: 660 IKKDLFLRHSDYNIFGDEIGMKLDFIWAPYMSNLTDLIMRFK 785 ++ DLF RHSDY+I EIGMKLDF+WAPY +L DL++ +K Sbjct: 171 VRGDLFRRHSDYSIVVKEIGMKLDFVWAPYEKDLDDLVVSYK 212 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,380,002 Number of Sequences: 27288 Number of extensions: 303943 Number of successful extensions: 980 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 979 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263404|gb|BM411774.1|BM411774 EST586101 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57L6 5' end, mRNA sequence (767 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g19990.1 hypothetical protein / predicted by genemark.hmm 370 e-103 >At3g19990.1 hypothetical protein / predicted by genemark.hmm Length = 425 Score = 370 bits (949), Expect = e-103 Identities = 182/261 (69%), Positives = 210/261 (79%), Gaps = 6/261 (2%) Frame = +2 Query: 2 GAGECWHKHGSFLDHLIDIYKILKIWEAPNSVCLCGLFHSAYSNSYVNLAIFDPSTGRET 181 GAGECWHKHGSFLDHLIDIYKILK+W+AP SVCLCGLFHSAYSNSYVNLAIFDPSTGR+ Sbjct: 43 GAGECWHKHGSFLDHLIDIYKILKLWKAPESVCLCGLFHSAYSNSYVNLAIFDPSTGRDV 102 Query: 182 VRRHVGEAAERLIHLFCIVPRQSLIHDDLLFRYADSELVEHLELSMASLSNAKEKGLFNE 361 VR HVGEAAE LIHLFC+VPRQ+LIHD+LLF+Y+D ELVEHL+ S SL NAKEKG+F+ Sbjct: 103 VRDHVGEAAESLIHLFCVVPRQTLIHDELLFKYSDCELVEHLDCSEVSLRNAKEKGIFDG 162 Query: 362 NEAWRKKLGSILPVDGVIVKHIKTGEDVLVSRRLVAVFLLMTMADFSDQLFNFQDLLFEN 541 +E WRKK+ +++P +GV+VKHIKTGE+++VSRR+V VFLLMTMADFSDQLF FQD LF N Sbjct: 163 DEEWRKKINALVPENGVVVKHIKTGEEIVVSRRVVGVFLLMTMADFSDQLFGFQDELFCN 222 Query: 542 SNGRLEFTGNNSQTTLWPGDGKPGLWMNSASRMGAIYTXXXXXXXXXXXXXXXNGERVVV 721 +GRLEF GNN T LWPG+GKPGLWMNS SRMGAIY+ R Sbjct: 223 HDGRLEFRGNN-VTALWPGNGKPGLWMNSNSRMGAIYS----LIVREEEILMEERRRAFG 277 Query: 722 SG------RDEEIELVIPPAF 766 SG RDE+I+LV+PP F Sbjct: 278 SGFEVRKERDEDIDLVVPPVF 298 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,371,521 Number of Sequences: 27288 Number of extensions: 312932 Number of successful extensions: 920 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 918 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1401406280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263341|gb|BM411711.1|BM411711 EST586038 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57N9 5' end, mRNA sequence (700 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66510.1 expressed protein / ; supported by cDNA: gi_15529... 293 5e-80 >At1g66510.1 expressed protein / ; supported by cDNA: gi_15529199_gb_AY052224.1_ Length = 399 Score = 293 bits (751), Expect = 5e-80 Identities = 141/233 (60%), Positives = 180/233 (76%), Gaps = 1/233 (0%) Frame = +2 Query: 5 GPNFKGVKMIPPGVHFIYYSSSNREGNEFSPIVGFFVEASPSEVIVKKWDSKDERFVKLS 184 GP FKG+KMIPPG+HF++YSSS R+G EFSP +GFFV+ +PS+VIV+KW+ +DE K+S Sbjct: 37 GPAFKGIKMIPPGIHFVFYSSSTRDGREFSPTIGFFVDVAPSQVIVRKWNQQDEWLTKVS 96 Query: 185 EEEGERYAQAVKKLEFDRQLGPYALDQYGDWKRLSNFITKSTIGRIEPVGGEITIISESE 364 EEE ERY+QAV+ LEFD+ LGPY L QYG+W+ LSN+ITK + + EPVGGEIT+ ES Sbjct: 97 EEEEERYSQAVRSLEFDKNLGPYNLKQYGEWRHLSNYITKDVVEKFEPVGGEITVTYESA 156 Query: 365 MVGNVHKTAMEKVLAEQLXXXXXXXXXXXX-XXNSCYYTSIPRVIKLKGVSGQDLTNMNL 541 ++ KTAME L Q+ N YYTSIPR+IK KG+SGQ+LT+MNL Sbjct: 157 ILKGGPKTAMEIALDTQMKKSKFTTSSTEQPKGNRFYYTSIPRIIKHKGMSGQELTSMNL 216 Query: 542 DKTRILETILTKQYGGSEDSLLGELQFAFVAFLMGQSLEAFLTWKLLVSLLLG 700 DKT++LE++L+K+Y SED LLGELQF+FVAFLMGQSLE+F+ WK +VSLLLG Sbjct: 217 DKTQLLESVLSKEYKDSEDLLLGELQFSFVAFLMGQSLESFMQWKSIVSLLLG 269 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,502,051 Number of Sequences: 27288 Number of extensions: 257521 Number of successful extensions: 756 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 754 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1209984928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263328|gb|BM411698.1|BM411698 EST586025 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57J19 5' end, mRNA sequence (816 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g30920.1 dihydroxypolyprenylbenzoate methyltransferase / i... 351 3e-97 >At2g30920.1 dihydroxypolyprenylbenzoate methyltransferase / identical to GB:Y15055;supported by full-length cDNA: Ceres:108529. Length = 322 Score = 351 bits (900), Expect = 3e-97 Identities = 171/245 (69%), Positives = 196/245 (79%) Frame = +1 Query: 82 IFSTSQNQVTWRSYSEASQXXXXXXXXXXXXXXXXXXXXXXXLNEFELAKFSAIAETWWD 261 +FSTS + S+S S LNE ELAKFSAIA+TWW Sbjct: 36 LFSTSDTDASAASFS--SSHPKIQTLEGKASNKSRSTSSTTSLNEDELAKFSAIADTWWH 93 Query: 262 AEGPFKPLHLMNPTRLAFIRSTLCRHFRKDPNCTRPFEGLKFVDVGCGGGILSEPLARMG 441 +EGPFKPLH MNPTRLAFIRSTLCRHF KDP+ +PFEGLKF+D+GCGGG+LSEPLARMG Sbjct: 94 SEGPFKPLHQMNPTRLAFIRSTLCRHFSKDPSSAKPFEGLKFIDIGCGGGLLSEPLARMG 153 Query: 442 ATVTGVDAVDKNIKIARLHADLDPQTSSIEYRCTTAESLVEEQRQFDAVIALEVIEHVAD 621 ATVTGVDAVDKN+KIARLHAD+DP TS+IEY CTTAE L +E R+FDAV++LEVIEHVA+ Sbjct: 154 ATVTGVDAVDKNVKIARLHADMDPVTSTIEYLCTTAEKLADEGRKFDAVLSLEVIEHVAN 213 Query: 622 PAGFCKSLSALTIPGGATVISTINRSMRAYATAIVAAEYLLHWLPKGTHQWSSFLTPEEL 801 PA FCKSLSALTIP GATV+STINR+MRAYA+ IV AEY+L WLPKGTHQWSSF+TPEE+ Sbjct: 214 PAEFCKSLSALTIPNGATVLSTINRTMRAYASTIVGAEYILRWLPKGTHQWSSFVTPEEM 273 Query: 802 VLILQ 816 +ILQ Sbjct: 274 SMILQ 278 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,152,847 Number of Sequences: 27288 Number of extensions: 291991 Number of successful extensions: 1048 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1002 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1043 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1529730356 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263282|gb|BM411652.1|BM411652 EST585979 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57O24 5' end, mRNA sequence (676 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80940.1 expressed protein / ;supported by full-length cDN... 238 2e-63 >At1g80940.1 expressed protein / ;supported by full-length cDNA: Ceres:37300. Length = 213 Score = 238 bits (607), Expect = 2e-63 Identities = 123/192 (64%), Positives = 157/192 (81%), Gaps = 3/192 (1%) Frame = +1 Query: 22 EGFLEGFSPVSSTPVLWKSRKRSAGVKNLETPQKQEESPADETPQKQDESPAD-EKMQES 198 +GF+ GF PVS+T + WKSRKRSA + NL+ K E+ + TP+K + + D EK+ E Sbjct: 16 DGFVGGFFPVSTTKIAWKSRKRSA-LLNLD---KAPEAVTEVTPEKNEITAMDTEKVGEP 71 Query: 199 QPSTEL-SERRKALFEPLEPVTNANGRRPSA-ETLLPPPDFDAACYPKGWLAGKRRKLVN 372 +T L SE+RKALFEPLEP+TN NG+RP+A ++LLPPPDF+ A YPKGWL GK+RKLVN Sbjct: 72 MTTTPLLSEKRKALFEPLEPITNLNGKRPTAADSLLPPPDFETANYPKGWLIGKKRKLVN 131 Query: 373 VDVVESMRRIALQEMNRKDREIDGLNEQLEADAQCLEHLQIQLLEERSKRADVERQNAML 552 VDVVESMRRIA+QEMNRKDREIDGLNEQLE D++CLEHLQ+QLL+ERSKR ++ER+N ML Sbjct: 132 VDVVESMRRIAVQEMNRKDREIDGLNEQLEEDSRCLEHLQLQLLQERSKRTEIERENTML 191 Query: 553 QSQINVLMNMYQ 588 + Q+++L+NM Q Sbjct: 192 KEQVDMLVNMIQ 203 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,941,404 Number of Sequences: 27288 Number of extensions: 268247 Number of successful extensions: 1305 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1277 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1138809344 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263202|gb|BM411572.1|BM411572 EST585899 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57A2 5' end, mRNA sequence (721 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g32970.1 expressed protein / ; supported by cDNA: gi_1529... 239 8e-67 >At2g32970.1 expressed protein / ; supported by cDNA: gi_15293114_gb_AY050991.1_ Length = 577 Score = 239 bits (610), Expect(2) = 8e-67 Identities = 113/196 (57%), Positives = 136/196 (68%) Frame = +2 Query: 23 VVEASQYKDILLLFRFNHRDFPFKXXXXXXXXXXXXXXXEAGLPSWVIFLQSYPVFCHIY 202 ++EA+QYKD+L+L R RD PFK EAGLPSWV+FLQSYP FCH+Y Sbjct: 214 IIEATQYKDVLVLVRCGDRDLPFKLREVIMADIRLLTLLEAGLPSWVLFLQSYPGFCHLY 273 Query: 203 RPWMCPLARFLYVIISVVTVLIGFYDLYKNVPVLKATASSLFGPLFDWIETWEMVSRIQY 382 RPWMC AR LYV+ISV+TV+IGFYDLYKNVPVLKATAS L GPLFDW+ETW+MVSRI+Y Sbjct: 274 RPWMCHFARALYVMISVITVVIGFYDLYKNVPVLKATASRLCGPLFDWVETWDMVSRIKY 333 Query: 383 LGTMLFLHNFQKAFRWFLMTMRTTRSFFSVLTQPMAGPLVEFVGFFLPYSTMCAQIMEDF 562 LGTMLFLHNFQKA +W L R +SF S P+ PL++ + LP A+ + Sbjct: 334 LGTMLFLHNFQKAVKWALTMARAMQSFVSFCIMPLVNPLLDILELLLPLWNSLAETVASL 393 Query: 563 FSVIWFTVWSSYTLVG 610 SV+W + S LVG Sbjct: 394 VSVVWIVMESGCNLVG 409 Score = 32.3 bits (72), Expect(2) = 8e-67 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +1 Query: 601 LGGKTIEILLLPLWYTTSFILNLGDYLLYPILWDLWESTY 720 L G +E++LLP+ S + N+ + +L P+ W +WE Y Sbjct: 407 LVGDVVELVLLPI----SLVWNVTNTVLLPLFWIIWEVVY 442 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,591,905 Number of Sequences: 27288 Number of extensions: 380031 Number of successful extensions: 927 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 899 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 927 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1272263564 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263201|gb|BM411571.1|BM411571 EST585898 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57O23 5' end, mRNA sequence (761 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g37460.1 putative protein / SPINDLY protein, Petunia x hyb... 323 3e-95 >At4g37460.1 putative protein / SPINDLY protein, Petunia x hybrida, Y17720 Length = 1013 Score = 323 bits (828), Expect(2) = 3e-95 Identities = 147/219 (67%), Positives = 182/219 (82%), Gaps = 2/219 (0%) Frame = +2 Query: 2 STGRSMMSWNHLYSLAVKWRQISEPCDPVVWINKLSEEFNTGFGSHTPLVLGQAKVVRYH 181 S+GRS++SW +YS AV+WRQISEPCDPVVW+NKLSEEFN+GFGSHTP+VLGQAKVVRY Sbjct: 725 SSGRSILSWQDVYSPAVRWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMVLGQAKVVRYF 784 Query: 182 PNFQRTLTVAKAVIKENKSVCNKEDKIIDLSEQQKLQ--EIMAAESSSDLYRVVGQDFWL 355 PN++RTLT+AK++IK+ SV +K+DK+IDLS+ +K++ +IM AE+ +L+ +VG+DFW+ Sbjct: 785 PNYERTLTLAKSIIKDKLSVRSKKDKVIDLSKDEKIEKMQIMRAETCDELHNIVGEDFWV 844 Query: 356 ATWCNSTALEGKRLEGTRITVVKMGEIGYDFAIRTPCTPARWDDFDVEMTSAWEALCAAY 535 ATWC+ST EG G +GYDF+IRTPCTPARW DFD EMTSAWEALC AY Sbjct: 845 ATWCDSTGSEG-------------GRLGYDFSIRTPCTPARWSDFDEEMTSAWEALCTAY 891 Query: 536 CGDNYGSTDFDVLENVRDAILRMTYYWYNFMPLSRGTGL 652 CG+NYGST+ D LE VRDAILRMTYYWYNFMPL+RGT + Sbjct: 892 CGENYGSTELDALETVRDAILRMTYYWYNFMPLARGTAV 930 Score = 43.5 bits (101), Expect(2) = 3e-95 Identities = 20/23 (86%), Positives = 22/23 (94%) Frame = +3 Query: 657 GFIVLLGLLLAANMEFTGSIPKG 725 GF+VLLGLLLAANMEFT +IPKG Sbjct: 932 GFVVLLGLLLAANMEFTETIPKG 954 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,039,363 Number of Sequences: 27288 Number of extensions: 408763 Number of successful extensions: 1295 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1219 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1291 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1383666960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263180|gb|BM411550.1|BM411550 EST585877 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57K9 5' end, mRNA sequence (802 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g65230.1 unknown protein / ; supported by cDNA: gi_20466567 304 4e-83 >At1g65230.1 unknown protein / ; supported by cDNA: gi_20466567 Length = 286 Score = 304 bits (778), Expect = 4e-83 Identities = 154/234 (65%), Positives = 183/234 (77%), Gaps = 2/234 (0%) Frame = +1 Query: 106 SISIHQPHRFSFRVINDSNRTELATE--DADKLVDGMDFGELCDEFECISSPSVEATARQ 279 S IH HR +V+NDS RTE++ + + DKLVD +DFGELC++FEC SSP VE+TARQ Sbjct: 29 SSKIH--HRLP-QVMNDSTRTEVSIDKSEVDKLVDKIDFGELCNDFECTSSPQVESTARQ 85 Query: 280 LVRDILELREGNRALGTFAVSVKYKDPVRSFTGRDKYKRPLWITDALQNPKPSVQEMVML 459 LVRDILE+REGNRA +AVSVKYKDPVRSFTGR+KYKRP+WIT L+NP +VQEMVML Sbjct: 86 LVRDILEIREGNRAFACYAVSVKYKDPVRSFTGREKYKRPMWITSGLENPTVTVQEMVML 145 Query: 460 STSVLNIKWTIKGKAKSLIGSIGGDLMIKVNSRFTLNQISGQVVEHEEEWDLSGSSIIAQ 639 STSVL IKWT+KGK KS++ ++ GDL++KV S FTLNQISGQV EHEE WDLS SS IAQ Sbjct: 146 STSVLRIKWTVKGKPKSILAAVSGDLIVKVKSEFTLNQISGQVFEHEESWDLSSSSPIAQ 205 Query: 640 AYFWASRRLFATVEAGKDVVDIVNDLSSKSAKENKNMDGYPDPYGDPAKFFQRD 801 AYFW SRRLFA E+ KDV D+ DL++ ++ D Y DP DP KFFQRD Sbjct: 206 AYFWTSRRLFAASESAKDVADVTKDLTANLTTRKEDTDIYRDP-TDPNKFFQRD 258 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.315 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,677,101 Number of Sequences: 27288 Number of extensions: 252795 Number of successful extensions: 667 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 664 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1485518496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263137|gb|BM411507.1|BM411507 EST585834 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57A19 5' end, mRNA sequence (821 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05320.1 unknown protein / 321 3e-88 >At3g05320.1 unknown protein / Length = 445 Score = 321 bits (823), Expect = 3e-88 Identities = 166/262 (63%), Positives = 197/262 (74%), Gaps = 4/262 (1%) Frame = +2 Query: 11 LAAKCLLLVVIALFLGTVLLPTFSGFGRVIRQNNFVFVHNR---SFPLNQPVKQKFLEVP 181 +A KCL+LV IALF +LL S R N+ +F S KFLEVP Sbjct: 17 VACKCLVLVGIALFYRALLL---SYSPRNALSNSLLFRDRHMSDSSSTGGIRTDKFLEVP 73 Query: 182 QIVWGLNNQKIAFARACLTARMLNRTLLMPKLSASLFYKEVELLKPISFDKIFQFERFNS 361 QIVWGLNNQKIAFARACLTARM+NRTLLMP LSASLFYKEV+ L+PI FDK+FQFERFNS Sbjct: 74 QIVWGLNNQKIAFARACLTARMMNRTLLMPSLSASLFYKEVDKLRPIPFDKVFQFERFNS 133 Query: 362 ICKGFVQLSRYSDVSNQSDIIELQKGSGRRWTLEKDLEQLNQISKH-PYDAREIIRIVGK 538 +C GFV+LSR+SDV N++ + +L+KGSGRRWT+E+DLE L Q +++ D E+IR++GK Sbjct: 134 LCSGFVRLSRFSDVKNRAQVFDLEKGSGRRWTVERDLEHLKQSARNESIDEFEVIRLIGK 193 Query: 539 NPFLWHDHWPTRDYAKVFECLALVEEISMEADKVVSQIREIRMEVRSKNAMPSSSSQPVP 718 NPFLWHDHWP DYAKVFEC+ +V+EIS EADKVV +IRE R+K A + PVP Sbjct: 194 NPFLWHDHWPVEDYAKVFECMVVVDEISREADKVVMKIREAGEAERAKLASKTEILGPVP 253 Query: 719 FVAVHMRIEKDWMIHCKKLEQR 784 FVAVHMRIE DWMIHCKKLEQR Sbjct: 254 FVAVHMRIEIDWMIHCKKLEQR 275 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,123,071 Number of Sequences: 27288 Number of extensions: 327545 Number of successful extensions: 1077 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1031 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1070 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1547415100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263091|gb|BM411461.1|BM411461 EST585788 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG56H18 5' end, mRNA sequence (791 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59780.1 putative protein / 190 9e-49 >At3g59780.1 putative protein / Length = 663 Score = 190 bits (482), Expect = 9e-49 Identities = 132/332 (39%), Positives = 157/332 (46%), Gaps = 86/332 (25%) Frame = +1 Query: 1 PDLRRAARFRFANVTLPEI----------------------------------DGSTRKL 78 PDLRR+ARFR+++VTLPE+ DG ++L Sbjct: 341 PDLRRSARFRYSSVTLPEVGFSILIVVDHSEYRNSTHVIYEHNEVSAISATEVDGDVKRL 400 Query: 79 FKSGRELDDYLLAAVIRNLKIVQDRSQVIVMDADGNRSKGVARSLRRLGIKRPYLVQGGF 258 K G E+DD L A +I+NLKIVQDRS+V+VMDADG RSK GG+ Sbjct: 401 LKGGSEVDDILTAVIIKNLKIVQDRSKVVVMDADGTRSK------------------GGY 442 Query: 259 RSWVEEGLRIKELKPETTLTILXXXXXXXXXXXXPTPLQ--------------XXXXXXX 396 RSWV+EGLR+KE KPETTLTIL P+PLQ Sbjct: 443 RSWVQEGLRVKEPKPETTLTILNEEAEAIFEDINPSPLQLFGVEYLIFSTTHKLLTSTFC 502 Query: 397 XXXXXXXXXEWEKTLQYVGVFGLC--QTL------------------------------- 477 EWEKTLQ + V GL QTL Sbjct: 503 TNMIALSLAEWEKTLQLIAVIGLSLFQTLCRLYTYDFLHMMTPKTSNKTSGIKAPSLDPF 562 Query: 478 -----YRRISSYEDSEDLKQDVRQLLAPVILGGQAMTWAAGKLETNRNGLPTSPSSTDVQ 642 R + S R LLAPV LG QA +WAAGKLETN GLPTSPSS+DV+ Sbjct: 563 SIAKTQRNLCSVLTKIVSSSSSRLLLAPVKLGAQAFSWAAGKLETNGVGLPTSPSSSDVR 622 Query: 643 SRVLQAAAKHESQPDSEETQDPSPETMSSVSE 738 SRVLQAAAKHES+P S+ET + + SS E Sbjct: 623 SRVLQAAAKHESKP-SDETSESLQDASSSPEE 653 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,496,638 Number of Sequences: 27288 Number of extensions: 309166 Number of successful extensions: 945 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 941 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1472363560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263039|gb|BM411409.1|BM411409 EST585736 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG56N13 5' end, mRNA sequence (804 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g31970.1 putative RAD50 DNA repair protein / ; supported ... 443 e-125 >At2g31970.1 putative RAD50 DNA repair protein / ; supported by cDNA: gi_7110147_gb_AF168748.1_AF168748 Length = 1316 Score = 443 bits (1140), Expect = e-125 Identities = 219/268 (81%), Positives = 242/268 (89%) Frame = +1 Query: 1 RKIKSEVDELTHEIELLEDKVLTLGGFSSVEAELKKXXXXXXXXXXXXNKCHGTLSVYQS 180 R K++V+ELT EIE LE+++L +GG ++VEAE+ K N+C GT+SVY+S Sbjct: 1039 RTTKAKVEELTREIESLEEQILNIGGIAAVEAEIVKILRERERLLSELNRCRGTVSVYES 1098 Query: 181 NISKNKVDLKQAQYKDIDKRYFDQLIQLKTTEMANKDLDRYYNALDKALMRFHSMKMEEI 360 +ISKN+V+LKQAQYKDIDKR+FDQLIQLKTTEMANKDLDRYYNALDKALMRFH+MKMEEI Sbjct: 1099 SISKNRVELKQAQYKDIDKRHFDQLIQLKTTEMANKDLDRYYNALDKALMRFHTMKMEEI 1158 Query: 361 NKIIRELWQQTYRGQDIDYISIHSDSEGSGTRSYSYKVVMLTGDTELEMRGRCSAGQKVL 540 NKIIRELWQQTYRGQD+DYI IHSDSEG+GTRSYSYKV+M TGDTELEMRGRCSAGQKVL Sbjct: 1159 NKIIRELWQQTYRGQDMDYIRIHSDSEGAGTRSYSYKVLMQTGDTELEMRGRCSAGQKVL 1218 Query: 541 ASLIIRLALAETFCLNCGILALDEPTTNLDGPNSESLAAALLRIMEDRKGQENFQLIVIT 720 ASLIIRLALAETFCLNCGILALDEPTTNLDGPNSESLA ALLRIMEDRKGQENFQLIVIT Sbjct: 1219 ASLIIRLALAETFCLNCGILALDEPTTNLDGPNSESLAGALLRIMEDRKGQENFQLIVIT 1278 Query: 721 HDERFAPYIGQRQHAEKYYRISKDDHQH 804 HDERFA IGQRQHAEKYYR++KDD QH Sbjct: 1279 HDERFAQMIGQRQHAEKYYRVAKDDMQH 1306 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,449,794 Number of Sequences: 27288 Number of extensions: 310115 Number of successful extensions: 823 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 823 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1494360868 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263010|gb|BM411380.1|BM411380 EST585707 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG56H9 5' end, mRNA sequence (777 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54770.1 thiazole biosynthetic enzyme precursor (ARA6) (sp Q3... 414 e-127 >At5g54770.1 thiazole biosynthetic enzyme precursor (ARA6) (sp Q38814) / ; supported by cDNA: gi_1113782_gb_U17589.1_ATU17589 Length = 349 Score = 414 bits (1065), Expect(2) = e-127 Identities = 204/232 (87%), Positives = 221/232 (94%) Frame = +1 Query: 1 LGSFSFNPIKESIVAREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKNPNVQVAI 180 L +F+F+PIKESIV+REMTRRYMTDMITYA+TDVV+VGAGSAGLS AYE+SKNPNVQVAI Sbjct: 53 LNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQVAI 112 Query: 181 LEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIDYDEQDNYVVIKHAALFTSTIMSK 360 +EQSVSPGGGAWLGGQLFSAM+VRKPAHLFL+E+G+ YDEQD YVV+KHAALFTSTIMSK Sbjct: 113 IEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDTYVVVKHAALFTSTIMSK 172 Query: 361 LLARPNVKLFNAVATEDLIVKNGRVGGVVTNWSLVSQNHDTQSCMDPNVMEAKIVVSSCG 540 LLARPNVKLFNAVA EDLIVK RVGGVVTNW+LV+QNH TQSCMDPNVMEAKIVVSSCG Sbjct: 173 LLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHHTQSCMDPNVMEAKIVVSSCG 232 Query: 541 HDGPMGATGVKRLRSIGMINSVPGMKALDMNAAEDAIVRLTREVVPGMIVTG 696 HDGP GATGVKRL+SIGMI+ VPGMKALDMN AEDAIVRLTREVVPGMIVTG Sbjct: 233 HDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTG 284 Score = 57.8 bits (138), Expect(2) = e-127 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 695 GMEVAEIDGAPRMGPTFGAMMISGQKA 775 GMEVAEIDGAPRMGPTFGAMMISGQKA Sbjct: 284 GMEVAEIDGAPRMGPTFGAMMISGQKA 310 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,307,216 Number of Sequences: 27288 Number of extensions: 316923 Number of successful extensions: 1059 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1017 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1055 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1428015260 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262920|gb|BM411290.1|BM411290 EST585617 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG56E10 5' end, mRNA sequence (744 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g18850.1 unknown protein / 246 9e-66 At1g14030.1 putative ribulose-1,5 bisphosphate carboxylase oxyge... 59 3e-09 At3g07670.1 putative ribulose-1,5-bisphosphate carboxylase oxyge... 52 4e-07 >At2g18850.1 unknown protein / Length = 441 Score = 246 bits (628), Expect = 9e-66 Identities = 131/243 (53%), Positives = 171/243 (69%) Frame = +2 Query: 2 ELELYFGGEDVKDMVGFNSPRNEMEALNSILTAIAKLDGEHCSTTTLEELRVAAVNLISE 181 ++E+YFG ED G S RNE+ AL+ IL+ I T E LR A I+E Sbjct: 65 KVEVYFG-EDACTPAGIYSVRNEISALSWILSLIPVSCKMQTQVDTFEALRAALKGRINE 123 Query: 182 LGKKCKEESKVVTRSSCEAEKCLQQWGEDQGVKSQLEISYFEGAGRGAIARQDLRIGDIA 361 + KE+++VV CE E L +WG+D GVK++L+I+ +G GRGAIA +DL+ GD+A Sbjct: 124 VVGAEKEKARVVDSYRCEKESKLVEWGQDNGVKTKLQIAQIDGYGRGAIASEDLKFGDVA 183 Query: 362 LEIPLSIVISDDLVHEYYMYSILEKIEGMSAETMLLLWSMKEKHNPDSKFKLYFDTLPEV 541 LEIP+S +IS++ V+ MY ILE +G+++ETMLLLW+M+EKHN DSKFK YFD+L E Sbjct: 184 LEIPVSSIISEEYVYNSDMYPILETFDGITSETMLLLWTMREKHNLDSKFKPYFDSLQEN 243 Query: 542 FNTGLSFGMEAIMALDGTLLLEEIVQAKEHLRAQYDELFPSLCNDHPDVFPPEQYGWEQF 721 F TGLSFG++AIM LDGTLLL+EI+QAKE LR +YDEL P L N H +VFPPE Y WE + Sbjct: 244 FCTGLSFGVDAIMELDGTLLLDEIMQAKELLRERYDELIPLLSN-HREVFPPELYTWEHY 302 Query: 722 LWA 730 LWA Sbjct: 303 LWA 305 >At1g14030.1 putative ribulose-1,5 bisphosphate carboxylase oxygenase large subunit N-methyltransferase / highly similar to ribulose-1,5 bisphosphate carboxylase oxygenase large subunit N-methyltransferase, gi|1731475. Rare GC intron splice site at 49572 is inferred from protein alignment and is not confirmed experimentally Length = 482 Score = 58.9 bits (141), Expect = 3e-09 Identities = 40/161 (24%), Positives = 81/161 (49%), Gaps = 2/161 (1%) Frame = +2 Query: 254 QWGEDQGVKSQLEISY--FEGAGRGAIARQDLRIGDIALEIPLSIVISDDLVHEYYMYSI 427 +W DQGV S ++ G G +AR+D+ ++ LEIP + I+ + V + + Sbjct: 54 KWLRDQGVVSGKSVAEPAVVPEGLGLVARRDIGRNEVVLEIPKRLWINPETVTASKIGPL 113 Query: 428 LEKIEGMSAETMLLLWSMKEKHNPDSKFKLYFDTLPEVFNTGLSFGMEAIMALDGTLLLE 607 G+ + L+ ++EK+ +S +++Y D LP+ ++ + + E + L GT LL Sbjct: 114 CG---GLKPWVSVALFLIREKYEEESSWRVYLDMLPQSTDSTVFWSEEELAELKGTQLLS 170 Query: 608 EIVQAKEHLRAQYDELFPSLCNDHPDVFPPEQYGWEQFLWA 730 + KE++ ++ +L + + D+F + + F+WA Sbjct: 171 TTLGVKEYVENEFLKLEQEILLPNKDLF-SSRITLDDFIWA 210 >At3g07670.1 putative ribulose-1,5-bisphosphate carboxylase oxygenase small subunit N-methyltransferase I / similar to ribulose-1,5-bisphosphate carboxylase oxygenase small subunit N-methyltransferase I GB:AAC29137 (Chloroplast Spinacia oleracea); nearly identical to putative methyltransferase GB:AAC14296 (Arabidopsis thaliana); supported by cDNA: 12942. Length = 504 Score = 51.6 bits (122), Expect = 4e-07 Identities = 50/208 (24%), Positives = 90/208 (43%), Gaps = 3/208 (1%) Frame = +2 Query: 116 GEHCSTTTLEELRVAAVNLISELGKKCKEESKVVTRSSCEAEKCLQQWGEDQGVKSQ-LE 292 G HCS + E + ++ ++ C+ +S E LQ W D G+ Q + Sbjct: 41 GIHCSVSA-GETTIQSMEEAPKISWGCEIDS-------LENATSLQNWLSDSGLPPQKMA 92 Query: 293 ISYFEGAGRGAIARQDLRIGDIALEIPLSIVISDDLVHEYYMYSILEKIEGMSAETMLLL 472 I + RG +A Q+LR G+ L +P S+VIS D + K + +L Sbjct: 93 IDRVDIGERGLVASQNLRKGEKLLFVPPSLVISADSEWTNAEAGEVMKRYDVPDWPLLAT 152 Query: 473 WSMKEKH-NPDSKFKLYFDTLP-EVFNTGLSFGMEAIMALDGTLLLEEIVQAKEHLRAQY 646 + + E S++ Y LP + ++ E M L+ + + E ++ ++ Y Sbjct: 153 YLISEASLQKSSRWFNYISALPRQPYSLLYWTRTELDMYLEASQIRERAIERITNVVGTY 212 Query: 647 DELFPSLCNDHPDVFPPEQYGWEQFLWA 730 ++L + + HP +FP E + E F W+ Sbjct: 213 EDLRSRIFSKHPQLFPKEVFNDETFKWS 240 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,542,529 Number of Sequences: 27288 Number of extensions: 400960 Number of successful extensions: 1194 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 1146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1190 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1330449000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262881|gb|BM411251.1|BM411251 EST585578 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG56K21 5' end, mRNA sequence (800 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g07210.1 expressed protein / predicted using genefinder;su... 187 6e-48 >At3g07210.1 expressed protein / predicted using genefinder;supported by full-length cDNA: Ceres:23826. Length = 547 Score = 187 bits (475), Expect = 6e-48 Identities = 121/259 (46%), Positives = 160/259 (61%), Gaps = 13/259 (5%) Frame = +3 Query: 9 EGEALITDPHAVSSV---HGIPTPEIYESPNLTSVPVKMKEGTHIQLLDINFPPRVAKFS 179 E E T+P + GIPTPEIYESP LTS P++ E + LLDINFPPR+ K Sbjct: 308 EEETSKTNPQVCGTTTHAQGIPTPEIYESPKLTSGPLR-NETAQVHLLDINFPPRIPKAI 366 Query: 180 GSPQPARRIRSSFGENFVNKPPLEHPVRKGTIWQSNPVADAEIASTGSVNGIQSEVQSSC 359 ++S+ H V + I +DA+IASTGSVNG SEV SS Sbjct: 367 TFHPELNSLQSN------------HIVEEAEIVSEG--SDAQIASTGSVNGALSEVISSS 412 Query: 360 --SSIRILEMENGYSSDGEITMYSAETAESRNFPSPKEGRRF--QQVGRSQSCVNHNRWG 527 ++ + +GYSS+ E TMYSAETAESRN+P+P F ++VGRSQSCV+ +RWG Sbjct: 413 PPAAAHYVYNNHGYSSEEE-TMYSAETAESRNYPTPPRKSEFHHERVGRSQSCVSSSRWG 471 Query: 528 TAKQNAGARGAMLQQQQRSSMQGRKVYSQGANSQRSSDYFNPTVSSIMKKRNN------L 689 T +++ R ML++Q RS + G+K++SQGA SQRS+DY++PTVSSIMKKR N + Sbjct: 472 TPQKSLNGRREMLEKQ-RSFVHGKKMHSQGAMSQRSNDYYSPTVSSIMKKRINSSEQQII 530 Query: 690 EPQTRPRQSAANSSPKWNF 746 +P RPR A +SSP+W F Sbjct: 531 KPVPRPR--AVSSSPRWAF 547 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,307,067 Number of Sequences: 27288 Number of extensions: 413098 Number of successful extensions: 1182 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1176 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1485518496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262880|gb|BM411250.1|BM411250 EST585577 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG56K19 5' end, mRNA sequence (829 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22990.1 expressed protein / ;supported by full-length cD... 304 3e-83 >At3g22990.1 expressed protein / ;supported by full-length cDNA: Ceres:120050. Length = 460 Score = 304 bits (779), Expect = 3e-83 Identities = 159/258 (61%), Positives = 187/258 (71%), Gaps = 6/258 (2%) Frame = +1 Query: 34 MQKREQSKLXXXXXXXXXPPAKRGRPFGSGNSNXXXXXXXXXXXXX-XPSTLLGPSLQVH 210 MQKRE K PPAKRGRPFGS ++N PS LLGPSL VH Sbjct: 1 MQKRELGKSGGNSGGSSGPPAKRGRPFGSTSANSAAAAAAAAAADAMSPSALLGPSLLVH 60 Query: 211 SAFAEQNNKRIVLALQSGLKRELTWALNTLTLLSFKEKDEVRRDATPLAKIPGLLDALLQ 390 ++F EQNN+RIVLALQSGLK E+TWALNTLTLLSFKEK+++RRD PLAKI GLLDALL Sbjct: 61 NSFVEQNNRRIVLALQSGLKSEVTWALNTLTLLSFKEKEDIRRDVMPLAKIAGLLDALLL 120 Query: 391 IIDDWRDIALPRVLVKAPRVRLLGANSVVTGFGLEYEALNSNESV-----LNPRESSVQK 555 IIDDWRDIALP+ L + RVR LG N+ VTGFG EY+AL S + + E+ +K Sbjct: 121 IIDDWRDIALPKDLTRGTRVRTLGTNASVTGFGNEYDALASIQPPGSGIGSSAAEALGKK 180 Query: 556 SSTKSRPTGLCFEEDGLFNLDEEGRIEKQQFAVAASNVVRNFSFMPDNEVIMGQHRHCLE 735 S+ K + + EEDGLFNLD+EGR EKQ A+AASNV+RNFSFMPDNEV+M QHRHCLE Sbjct: 181 STGKHQSSQWWMEEDGLFNLDDEGRSEKQMCAIAASNVIRNFSFMPDNEVVMAQHRHCLE 240 Query: 736 TLFPCLADYVTEDEELVT 789 T+F C+ D++TEDEELVT Sbjct: 241 TVFQCIHDHMTEDEELVT 258 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,964,662 Number of Sequences: 27288 Number of extensions: 344811 Number of successful extensions: 961 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 955 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1565099844 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262860|gb|BM411230.1|BM411230 EST585557 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG56G15 5' end, mRNA sequence (752 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g16570.1 unknown protein / contains similarity to beta-1,4... 184 4e-47 >At1g16570.1 unknown protein / contains similarity to beta-1,4 mannosyltransferase GI:6970470 from [Homo sapiens] Length = 465 Score = 184 bits (467), Expect = 4e-47 Identities = 89/116 (76%), Positives = 98/116 (83%) Frame = -2 Query: 742 EDYPCFLGSADLGVCLHTSSSGLDLPMKVVDMFGCGLPVCAVSYSCINELVEVDKNGLLF 563 EDYP LGSADLGVCLHTSSSGLDLPMKVVDMFGCGLPVC+VSYSCI ELV+ KNGLLF Sbjct: 344 EDYPLLLGSADLGVCLHTSSSGLDLPMKVVDMFGCGLPVCSVSYSCIQELVKDGKNGLLF 403 Query: 562 SSSSELADQFVTLFKGFPGECDELKSLRQGVLASRSSVNWATEWEANAKPLISKVI 395 SSSSELADQ + LFKGFPG CD L SL+ G + + SS WATEWE AKPLI++V+ Sbjct: 404 SSSSELADQLLILFKGFPGNCDALMSLKAGAMETGSSGRWATEWEDCAKPLITQVV 459 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,059,586 Number of Sequences: 27288 Number of extensions: 372295 Number of successful extensions: 1078 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1048 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1077 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1357057980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262854|gb|BM411224.1|BM411224 EST585551 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG56E19 5' end, mRNA sequence (725 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g18270.1 putative protein / phospho-N-acetylmuramoyl-penta... 159 2e-39 >At4g18270.1 putative protein / phospho-N-acetylmuramoyl-pentapeptide-transferase, Haemophilus influenzae,Pir2:A64185 Length = 313 Score = 159 bits (401), Expect = 2e-39 Identities = 78/128 (60%), Positives = 93/128 (71%) Frame = -1 Query: 674 LSIFGASMAGACAGFLLHNRYKASIFMGDTXXXXXXXXXXXXXACTGMFFPLFISSGVFV 495 LS+FGASMAGAC GFLLHNRY+AS+ MGDT AC+GMFFPLFISSGV V Sbjct: 185 LSVFGASMAGACFGFLLHNRYRASVSMGDTGSLALGGALAAMAACSGMFFPLFISSGVAV 244 Query: 494 LEALSVILQVSFFKTTKHFLGTGHRLFRMAPLHHHLELCGVKEPVIVAGAYVFSCILALT 315 LEA SVI+QV ++ TTK G G R+F+ P HHHL L G+KEP+IV AYV S +L+L+ Sbjct: 245 LEASSVIIQVVYYSTTKRLKGKGRRIFKTIPFHHHLRLNGLKEPMIVTMAYVISSLLSLS 304 Query: 314 AGYVGLAS 291 A Y+GL S Sbjct: 305 AAYIGLIS 312 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,096,699 Number of Sequences: 27288 Number of extensions: 354315 Number of successful extensions: 804 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 802 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1277231040 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262795|gb|BM411165.1|BM411165 EST585492 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55J6 5' end, mRNA sequence (695 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g04305.1 hypothetical protein / predicted by genefinder; s... 206 9e-54 >At2g04305.1 hypothetical protein / predicted by genefinder; supported by cDNA: gi_19310533 Length = 434 Score = 206 bits (524), Expect = 9e-54 Identities = 105/156 (67%), Positives = 121/156 (77%) Frame = +2 Query: 2 FASDDINSLEELIGRLRRLKENVGFIANRVTAIQAGLDSWQSEQINKKLYYLSFLSIVFL 181 F ++DI+SLEELIGRLRRLKENVGFIANRVTAIQAGLDSWQ+EQIN+KLYYLSFLSI+FL Sbjct: 282 FLAEDIHSLEELIGRLRRLKENVGFIANRVTAIQAGLDSWQAEQINRKLYYLSFLSIIFL 341 Query: 182 PLSVVTGVFGMNVGGVPWTNQREPELKEGFRNXXXXXXXXXXXXXXXXXXPALYSHLMAW 361 PLS++TGVFGMNVGGVPWT Q +PEL++GFRN PALYS + +W Sbjct: 342 PLSIITGVFGMNVGGVPWTGQDKPELRDGFRNVMYICLIMLVLVLCCFGFPALYSRIASW 401 Query: 362 KRRRDMKRNWSLNRRSFLRRSTGVRERNERGGYLRL 469 RDMKR+WSLNRRSF + V+ER GYLRL Sbjct: 402 WGTRDMKRSWSLNRRSFKKIPNIVQERK---GYLRL 434 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,009,000 Number of Sequences: 27288 Number of extensions: 285979 Number of successful extensions: 887 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 858 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 886 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1201087980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262789|gb|BM411159.1|BM411159 EST585486 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55H14 5' end, mRNA sequence (753 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11680.1 putative protein / predicted proteins, Arabidopsi... 320 7e-88 >At5g11680.1 putative protein / predicted proteins, Arabidopsis thaliana;supported by full-length cDNA: Ceres:403. Length = 207 Score = 320 bits (819), Expect = 7e-88 Identities = 157/202 (77%), Positives = 174/202 (85%), Gaps = 9/202 (4%) Frame = +2 Query: 14 MAVNPQLFRNGMPVPFVNELFVLARDGVEFEVDKIPGV--GAVKAKGTVYLSNIRMVFVS 187 MA+NPQL NGMPVPFVNE+FVL RDGVEFEVDKIPG G VKAKG +YLSNIRMVFVS Sbjct: 1 MALNPQLLPNGMPVPFVNEMFVLVRDGVEFEVDKIPGGHGGHVKAKGVIYLSNIRMVFVS 60 Query: 188 IKPVENFIAFDMPLLYVHGEKFNQPIFFCNNICGHVDPVIPVNENRALFSTHSFKILFKE 367 KPV+NF+AFDMPLLY+H EKFNQPIF CNNI G V+PV+P NE+RAL+STHSFKILFKE Sbjct: 61 SKPVDNFVAFDMPLLYIHAEKFNQPIFHCNNIAGQVEPVVPENEHRALYSTHSFKILFKE 120 Query: 368 GGCGTFIPLFFNLIASVRQYHQQSREEA-------RVDPLQAAQTPVDEMMRHAYVDPND 526 GGCGTF+PLF NLI+SVRQY++Q ++ A VDPLQAAQTPVDEMMRHAYVDPND Sbjct: 121 GGCGTFVPLFLNLISSVRQYNRQMQQAAEAAAAAPHVDPLQAAQTPVDEMMRHAYVDPND 180 Query: 527 PTRIFLQQPSTESQLRRRTYQS 592 PTRI+LQQPS ESQLRRR Y S Sbjct: 181 PTRIYLQQPSGESQLRRRAYHS 202 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,256,566 Number of Sequences: 27288 Number of extensions: 373429 Number of successful extensions: 951 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 919 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 948 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1357057980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262769|gb|BM411139.1|BM411139 EST585466 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55D4 5' end, mRNA sequence (750 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g10690.1 putative DNA gyrase subunit A / similar to DNA gy... 343 6e-95 >At3g10690.1 putative DNA gyrase subunit A / similar to DNA gyrase A subunit GB:BAA10380 (Synechocystis sp) Length = 917 Score = 343 bits (880), Expect = 6e-95 Identities = 176/249 (70%), Positives = 206/249 (82%) Frame = +2 Query: 2 NLDEVINTIRKASSHALATANLRKEFELTEKQAEAILDISLRRLTALERNKFVDEGKSLR 181 N+DEVI I KASSH+ ATA L+ E+ L+EKQAEAIL+I+LRRLTALER KF DE SL Sbjct: 484 NVDEVIELITKASSHSSATAALQSEYGLSEKQAEAILEITLRRLTALERKKFTDESSSLT 543 Query: 182 TQISKLEELLSSXXXXXXXXXXXXXXXXDKYFTPRRSQLEDTDSGDLEDIDVIPNEEMLL 361 QI+KLE+LLS+ D++ +PRRS LED+DSGDLEDIDVIPNEEML+ Sbjct: 544 EQITKLEQLLSTRTNILKLIEQEAIELKDRFSSPRRSMLEDSDSGDLEDIDVIPNEEMLM 603 Query: 362 AISEKGYVKRMKPDTFNLQNRGTIGKSVGKLRVNDAMSDFLVCRAHDKVLYFSDKGTVYS 541 A+SEKGYVKRMK DTFNLQ+RGTIGKSVGKLRV+DAMSDFLVC AHD VL+FSD+G VYS Sbjct: 604 AVSEKGYVKRMKADTFNLQHRGTIGKSVGKLRVDDAMSDFLVCHAHDHVLFFSDRGIVYS 663 Query: 542 SPAYKIPECSRTAAGTPLIQILSLSDGERITSIIPVSDFAGDQYLVMLTVNGYIKKVSLD 721 + AYKIPECSR AAGTPL+QILS+S+GER+TSI+PVS+FA D+YL+MLTVNG IKKVSL Sbjct: 664 TRAYKIPECSRNAAGTPLVQILSMSEGERVTSIVPVSEFAEDRYLLMLTVNGCIKKVSLK 723 Query: 722 YFALYRSTG 748 F+ RSTG Sbjct: 724 LFSGIRSTG 732 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,731,709 Number of Sequences: 27288 Number of extensions: 264113 Number of successful extensions: 611 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262662|gb|BM411032.1|BM411032 EST585359 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55M18 5' end, mRNA sequence (835 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g48850.1 chorismate synthase, putative / similar to choris... 328 e-107 >At1g48850.1 chorismate synthase, putative / similar to chorismate synthase GI:452796 from [Synechocystis sp.]; supported by cDNA: gi_15982823_gb_AY057519.1_ Length = 436 Score = 328 bits (840), Expect(3) = e-107 Identities = 155/204 (75%), Positives = 180/204 (87%) Frame = +3 Query: 81 FGNYFRVTTFGESHGGGVGCIIDGCPPRLPLSESDMQVELDRRRPGQSRITTPRKETDTC 260 +G +FRV+TFGESHGGGVGCIIDGCPPR+PL+ESD+Q +LDRRRPGQSRITTPRKETDTC Sbjct: 55 YGTHFRVSTFGESHGGGVGCIIDGCPPRIPLTESDLQFDLDRRRPGQSRITTPRKETDTC 114 Query: 261 KISSGTADGLTTGSPIKVEVPNTDQRGNDYSEMSLAYRPSHADATYDFKYXXXXXXXXXX 440 +ISSG ++G+TTG+PI V VPNTDQRG DYSEMS+AYRPSHADATYD KY Sbjct: 115 RISSGVSEGMTTGTPIHVFVPNTDQRGLDYSEMSVAYRPSHADATYDMKYGVRSVQGGGR 174 Query: 441 XXARETIGRVAAGAVAKKILKLYSGAEVLAYVSQVHQVVLPEDLIDHQNVTLEQIESNIV 620 ARETIGRVA GA+AKKILK ++G E+LAYVSQVH VVLPE+L+DH+N+TLEQIE+NIV Sbjct: 175 SSARETIGRVAPGALAKKILKQFAGTEILAYVSQVHHVVLPEELVDHENLTLEQIENNIV 234 Query: 621 RCPDPEYAEKMIAAIDAVRVRGDS 692 RCP+PEYAEKMIAAIDAVR +G+S Sbjct: 235 RCPNPEYAEKMIAAIDAVRTKGNS 258 Score = 78.2 bits (191), Expect(3) = e-107 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = +1 Query: 694 VGGVVTCIGRNLPRGLGTPVFDKL*AELAKACMSLPATKGF 816 VGGVVTCI RN PRGLGTPVFDKL AELAKACMSLPATKGF Sbjct: 259 VGGVVTCIVRNAPRGLGTPVFDKLEAELAKACMSLPATKGF 299 Score = 22.7 bits (47), Expect(3) = e-107 Identities = 8/9 (88%), Positives = 9/9 (99%) Frame = +2 Query: 809 RGFEFGSGF 835 +GFEFGSGF Sbjct: 297 KGFEFGSGF 305 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,852,459 Number of Sequences: 27288 Number of extensions: 335897 Number of successful extensions: 961 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 960 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1582784588 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262654|gb|BM411024.1|BM411024 EST585351 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55K24 5' end, mRNA sequence (648 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g43400.1 putative electron transfer flavoprotein ubiquinone o... 259 6e-70 >At2g43400.1 putative electron transfer flavoprotein ubiquinone oxidoreductase / Length = 633 Score = 259 bits (663), Expect = 6e-70 Identities = 116/150 (77%), Positives = 130/150 (86%) Frame = +3 Query: 3 GLALSAVEHYILKGRSPVTLNHGKPDHEATREAQLFSPIEYPKPDGVVSFDVPTSLYRSN 182 GLA+SA+EHY+LKG+ P TL HGK DHEAT A+ ++PI YPKPDGV+SFDVPTSLYRSN Sbjct: 484 GLAISAMEHYVLKGKVPFTLKHGKADHEATDLARKWTPIVYPKPDGVLSFDVPTSLYRSN 543 Query: 183 TNHDHDQPSHLHLKDPTVPENVNLPKYAGPEARYCPARVYEYIPDETGDLKLQINAQNCL 362 TNHDHDQPSHL L+DP +PE VN P+YA PE+RYCPARVYEYI DE G KLQINAQNCL Sbjct: 544 TNHDHDQPSHLRLRDPKIPEKVNFPEYAAPESRYCPARVYEYIEDEEGKPKLQINAQNCL 603 Query: 363 HCKACSIKDPKQNFEWTVPEGGGGPGYTIM 452 HCKAC IKDPKQN EWTVPEGGGGP Y++M Sbjct: 604 HCKACDIKDPKQNIEWTVPEGGGGPAYSLM 633 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,970,016 Number of Sequences: 27288 Number of extensions: 312006 Number of successful extensions: 864 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1070908320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262643|gb|BM411013.1|BM411013 EST585340 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55I22 5' end, mRNA sequence (672 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g45790.1 putative phosphomannomutase / ;supported by full... 282 3e-79 >At2g45790.1 putative phosphomannomutase / ;supported by full-length cDNA: Ceres:998. Length = 246 Score = 282 bits (721), Expect(2) = 3e-79 Identities = 129/165 (78%), Positives = 152/165 (91%) Frame = -3 Query: 637 QAYGKQSLKSYLGDEKLKEFINFTLHYIADLDIPIKRGTFIEFRSGMLNVSPIGRNCSQE 458 ++ G QSLK +LGD+KLKE INFTLHYIADLDIPIKRGTFIEFR+GMLNVSPIGRNCSQE Sbjct: 81 KSIGIQSLKLHLGDDKLKELINFTLHYIADLDIPIKRGTFIEFRNGMLNVSPIGRNCSQE 140 Query: 457 EKDEFEKYDKVQKIRETMVSVLREKFAHFNLTFSIGGQISFDVFPQGWDKTYCLRYLEEF 278 E+DEFE+YDKVQ IR MV+ LRE+FAH NLTFSIGGQISFDVFP+GWDKTYCL+YLE+F Sbjct: 141 ERDEFERYDKVQNIRPKMVAELRERFAHLNLTFSIGGQISFDVFPKGWDKTYCLQYLEDF 200 Query: 277 NEIHFFGDKTYKGGNDHEIYESERTVGHTVTSPEETLKQCSVLFL 143 +EIHFFGDKTY+GGND+EIYES +T+GH+VTSP++T+ +C LF+ Sbjct: 201 SEIHFFGDKTYEGGNDYEIYESPKTIGHSVTSPDDTVAKCKALFM 245 Score = 30.8 bits (68), Expect(2) = 3e-79 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 Query: 672 FFENGLVAHKDGKLMG 625 F ENGLVAHKDGK +G Sbjct: 69 FSENGLVAHKDGKSIG 84 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,937,756 Number of Sequences: 27288 Number of extensions: 295651 Number of successful extensions: 833 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 808 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 833 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1129912396 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262618|gb|BM410988.1|BM410988 EST585315 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55E12 5' end, mRNA sequence (748 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27110.1 expressed protein / contains Pfam profile:PF01435... 343 4e-95 >At3g27110.1 expressed protein / contains Pfam profile:PF01435 Peptidase family M48;supported by full-length cDNA: Ceres:156849. Length = 344 Score = 343 bits (881), Expect = 4e-95 Identities = 171/218 (78%), Positives = 188/218 (85%) Frame = +1 Query: 1 LPELHYLMVEASRILNIEAPDLYIRQSPVPNAYTLAVSGKKPFVVVHTSLVELLSRNELQ 180 L +LH L+VEA+ ILNIEAPDLY+RQSPVPNAYTLA+SGKKPF+VVHTSL+ELL+ ELQ Sbjct: 127 LSDLHGLLVEAAEILNIEAPDLYVRQSPVPNAYTLAISGKKPFIVVHTSLIELLTSAELQ 186 Query: 181 AVLAHELGHLKCDHGVWLTFANVLTLGAYTVPGVGSLIXXXXXXXXXXXXXXXXXTCDRA 360 AVLAHELGHLKCDHGVWLTFAN+LTLGAYTVP G +I TCDRA Sbjct: 187 AVLAHELGHLKCDHGVWLTFANILTLGAYTVPAFGQMIARTLEEQLLRWLRSAELTCDRA 246 Query: 361 ALLVAQDPKVVVSVLMKLAGGCPSLSDQLNVDAFLEQARSYDKASSSPVGWYIRNAQTRQ 540 ALLVAQDPKVVVSVLMKLAGGCPS++DQLNVDAFLEQARSYDKASSSP+GWYIRNAQT Q Sbjct: 247 ALLVAQDPKVVVSVLMKLAGGCPSIADQLNVDAFLEQARSYDKASSSPLGWYIRNAQTSQ 306 Query: 541 LSHPLPVLRAREIDEWSRSQEYRSLLQRAIQVNPVQKV 654 LSHPLPVLRAREIDEWSRS EY+SLL+RA + + VQKV Sbjct: 307 LSHPLPVLRAREIDEWSRSLEYKSLLKRANRKSTVQKV 344 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,540,820 Number of Sequences: 27288 Number of extensions: 283589 Number of successful extensions: 665 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 665 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262577|gb|BM410947.1|BM410947 EST585274 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55M9 5' end, mRNA sequence (764 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g31040.1 expressed protein / ;supported by full-length cD... 301 3e-82 >At4g31040.1 expressed protein / ;supported by full-length cDNA: Ceres:31287. Length = 438 Score = 301 bits (770), Expect = 3e-82 Identities = 148/200 (74%), Positives = 170/200 (85%) Frame = +2 Query: 2 FLDRYVKTVPLAAQMLDVRRNQKLEMVKELKAEQARYRLEVEIGKSPPLSEKELHLELRH 181 FLDRYVKTVPLAAQ LDVRRNQKLEMVKEL E+ARYRLEVEIGKSPPLS+ +L E+R Sbjct: 239 FLDRYVKTVPLAAQTLDVRRNQKLEMVKELNREKARYRLEVEIGKSPPLSDDDLWWEMRG 298 Query: 182 KALELRDEWRLENRKAFAYIFSDFVSGVSLFILLCFNESKVKLLKFTGYKILNNISDAGK 361 KALELRDEWRLENRKAFA I+SD V G+SLF+LL N+ +V LLKFTGYKI+NNISD GK Sbjct: 299 KALELRDEWRLENRKAFANIWSDMVFGISLFVLLYANQGRVALLKFTGYKIINNISDTGK 358 Query: 362 AFLIILISDTLLGYHSEYGWNTALEMLVEHYGIEVDRSAITIFVCIVPVITDTFVKLWIF 541 AFLIILI+D LGYHSE GW T LE+++EHYG+EV++S ITIF+C+VPVI D VKLW+F Sbjct: 359 AFLIILITDIFLGYHSESGWETLLEIIMEHYGLEVEQSTITIFICLVPVIMDACVKLWLF 418 Query: 542 KYLPRLSSEVPKYIQKMKRH 601 K+LPRLS V Q+MKRH Sbjct: 419 KFLPRLSPRVSNIFQEMKRH 438 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,511,080 Number of Sequences: 27288 Number of extensions: 316118 Number of successful extensions: 899 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 868 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 899 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1392536620 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262556|gb|BM410926.1|BM410926 EST585253 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55G13 5' end, mRNA sequence (786 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g52050.1 putative protein / weak similarity DNA polymerase... 94 6e-20 >At3g52050.1 putative protein / weak similarity DNA polymerase I -Bacillus stearothermophilus,PIR2:S70368 Length = 384 Score = 94.4 bits (233), Expect = 6e-20 Identities = 46/68 (67%), Positives = 54/68 (78%) Frame = +3 Query: 372 SNGKLMLIDGTSIIYRAYYRLLAKLHHGHLSHADGNGDWVLTIFTALSLIIDVLEFLPSH 551 SNG++MLIDGTSIIYRAYY+LLA+L+HGHL+HADGN DWVLTIF++LSL Sbjct: 115 SNGRVMLIDGTSIIYRAYYKLLARLNHGHLAHADGNADWVLTIFSSLSL----------- 163 Query: 552 IAVVFDHD 575 VVFDHD Sbjct: 164 --VVFDHD 169 Score = 63.2 bits (152), Expect = 2e-10 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = +2 Query: 575 RMVSFGMEEFAEKYGGLKPSQFVDLTSLMGDKSDNIPG 688 RM SFGME+FA+K+G L+P+QFVD+ +L GDKSDNIPG Sbjct: 273 RMASFGMEDFAKKFGNLEPAQFVDIIALAGDKSDNIPG 310 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,067,600 Number of Sequences: 27288 Number of extensions: 328938 Number of successful extensions: 763 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 763 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262551|gb|BM410921.1|BM410921 EST585248 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55E23 5' end, mRNA sequence (705 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27530.1 expressed protein / similar to hypothetical prote... 267 5e-72 >At3g27530.1 expressed protein / similar to hypothetical protein GB:CAA07228 from [Cicer arietinum]; supported by cDNA: gi_15810206_gb_AY056118.1_ Length = 914 Score = 267 bits (682), Expect = 5e-72 Identities = 139/236 (58%), Positives = 175/236 (73%), Gaps = 3/236 (1%) Frame = +3 Query: 6 LGRAEPLLHRMVKYLALASSMKSKDGKSSTSENVFVQPIILKLLTIWLSDCPNAVQCFLD 185 +G EPL R+V+YLA+ASSMKSK+ KSST ++Q IILKLL W DCP AVQCFLD Sbjct: 488 MGTPEPLFQRIVRYLAVASSMKSKE-KSSTLGKSYIQQIILKLLVTWTVDCPTAVQCFLD 546 Query: 186 SRPHLTYLLELVSNPTTTVCVRGLAAVLLGECVIYNNSNASGKDAYSIVDAISQKVGLTS 365 SR HLT+LLELV++P TVC+RGLA++LLGECVIYN S +GKDA+S+VDA+ QK+GLTS Sbjct: 547 SRHHLTFLLELVTDPAATVCIRGLASILLGECVIYNKSIENGKDAFSVVDAVGQKMGLTS 606 Query: 366 YFLKFDEMQKSSLFT-SAKPFLPRKSLTRSSAVSMSEIE--DGATESSDQKNEHPMLASV 536 YF KF+EMQ S +F+ S KP K LTR+ S +EI D E +HPML S+ Sbjct: 607 YFSKFEEMQNSFIFSPSKKPPQGYKPLTRTPTPSEAEINEVDEVDEMVKGNEDHPMLLSL 666 Query: 537 FDSPFVYFLKRLEADIREKMVEAYSSPNSQVTVVPAELEQRSGENDVDYIKRLKTF 704 FD+ F+ +K LE +IRE++V+ YS P S+V VVPA+LEQ+SGEN+ DYI RLK F Sbjct: 667 FDASFIGLVKSLEGNIRERIVDVYSRPKSEVAVVPADLEQKSGENEKDYINRLKAF 722 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,137,208 Number of Sequences: 27288 Number of extensions: 316568 Number of successful extensions: 790 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 767 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 788 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1227778824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262476|gb|BM410846.1|BM410846 EST585173 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG54F18 5' end, mRNA sequence (787 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g17230.1 phytoene synthase [geranylgeranyl-diphosphate gerany... 427 e-120 >At5g17230.1 phytoene synthase [geranylgeranyl-diphosphate geranylgeranyl transferase](PSY) / identical to GB:L25812; synonymous with geranylgeranyl-diphosphate geranylgeranyl transferase; supported by full-length cDNA: Ceres:15761. Length = 422 Score = 427 bits (1097), Expect = e-120 Identities = 210/261 (80%), Positives = 240/261 (91%), Gaps = 3/261 (1%) Frame = +1 Query: 13 VRSAILATPSGERTMTSEQMVYDVVLRQAALVKRQLRSTN-ELEVKP--DIPIPGNLGLL 183 V S+++A+PSGE ++SE+ VY+VVL+QAALV +QLRS++ +L+VK D+ +PG+L LL Sbjct: 69 VSSSLVASPSGEIALSSEEKVYNVVLKQAALVNKQLRSSSYDLDVKKPQDVVLPGSLSLL 128 Query: 184 SEAYDRCGEVCAEYAKTFNLGTMLMTPERRRAIWAIYVWCRRTDELVDGPNASYITPAAL 363 EAYDRCGEVCAEYAKTF LGT+LMTPERR+AIWAIYVWCRRTDELVDGPNAS+ITP AL Sbjct: 129 GEAYDRCGEVCAEYAKTFYLGTLLMTPERRKAIWAIYVWCRRTDELVDGPNASHITPMAL 188 Query: 364 DRWENRLEDVFNGRPFDMLDGALSDTVSNFPVDIQPFRDMIEGMRMDLRKSRYKNFDELY 543 DRWE RLED+F GRPFDMLD AL+DTV+ +PVDIQPFRDMIEGMRMDL+KSRY+NFD+LY Sbjct: 189 DRWEARLEDLFRGRPFDMLDAALADTVARYPVDIQPFRDMIEGMRMDLKKSRYQNFDDLY 248 Query: 544 LYCYYVAGTVGLMSVPIMGIAPESKATTESVYNAALALGIANQLTNILRDVGEDARRRRV 723 LYCYYVAGTVGLMSVP+MGI P+SKATTESVYNAALALGIANQLTNILRDVGEDARR RV Sbjct: 249 LYCYYVAGTVGLMSVPVMGIDPKSKATTESVYNAALALGIANQLTNILRDVGEDARRGRV 308 Query: 724 YLPSDELAQAGLSDEDIFAGR 786 YLP DELAQAGLSDEDIFAG+ Sbjct: 309 YLPQDELAQAGLSDEDIFAGK 329 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,673,933 Number of Sequences: 27288 Number of extensions: 361584 Number of successful extensions: 963 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 961 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262431|gb|BM410801.1|BM410801 EST585128 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG54N5 5' end, mRNA sequence (775 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15530.1 pyruvate,orthophosphate dikinase / 404 e-113 >At4g15530.1 pyruvate,orthophosphate dikinase / Length = 960 Score = 404 bits (1038), Expect = e-113 Identities = 208/274 (75%), Positives = 233/274 (84%), Gaps = 16/274 (5%) Frame = +1 Query: 1 PPAMTGDLEIFMALADKIRRIKVMANADTPEDALAARNNGAEGIGLCRTEHM-------- 156 PPA++ DLE FM+ AD IRR+KVMANADTPEDA+AAR NGA+GIGLCRTEHM Sbjct: 585 PPALSPDLETFMSWADAIRRLKVMANADTPEDAIAARKNGAQGIGLCRTEHMIVCIQMFN 644 Query: 157 --------FFASDERIKAVRRMIMAVTLEQRKEALDSLLPYQRSDFEGIFRAMDGLPVTI 312 FF +D RIKAVR+MIMAVT EQRK +LD LLPYQRSDFEGIFRAMDGLPVTI Sbjct: 645 VVFGLVFKFFGAD-RIKAVRKMIMAVTTEQRKASLDILLPYQRSDFEGIFRAMDGLPVTI 703 Query: 313 RLLDPPLHEFLPEGNLEEIVSELTTHTGMREEDVYSRIEKLSEVNPMLGFRGCRLGISYP 492 RLLDPPLHEFLPEG+L+ IV EL TG++E++V SRIEKLSEVNPMLGFRGCRLGISYP Sbjct: 704 RLLDPPLHEFLPEGDLDNIVHELAEETGVKEDEVLSRIEKLSEVNPMLGFRGCRLGISYP 763 Query: 493 ELTEMQARAIFQAAITMNNQGISVFPEIMVPLVGTPQELGHQVDLIRDVAKKVFAEMGTS 672 ELTEMQARAIF+AA +M +QG++V PEIMVPLVGTPQELGHQVD+IR VAKKVFAE G + Sbjct: 764 ELTEMQARAIFEAAASMQDQGVTVIPEIMVPLVGTPQELGHQVDVIRKVAKKVFAEKGHT 823 Query: 673 LNYKVGTMIEIPRAAFDADEIAKETEFFSFGTHD 774 ++YKVGTMIEIPRAA ADEIAKE EFFSFGT+D Sbjct: 824 VSYKVGTMIEIPRAALIADEIAKEAEFFSFGTND 857 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,813,123 Number of Sequences: 27288 Number of extensions: 377974 Number of successful extensions: 998 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 997 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262407|gb|BM410777.1|BM410777 EST585104 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG54F21 5' end, mRNA sequence (817 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34350.1 putative protein / hypothetical protein, Synechoc... 419 e-122 >At4g34350.1 putative protein / hypothetical protein, Synechocystis sp., PIR2:S76307; supported by cDNA: gi_14596178_gb_AY042877.1_ Length = 466 Score = 419 bits (1078), Expect(2) = e-122 Identities = 202/254 (79%), Positives = 221/254 (86%) Frame = +1 Query: 1 VKLAESYGFCWGVERAVQIAYEARKQFPTERIWITNEIIHNPTVNKRLEDMDVKNIPLEE 180 VKLA++YGFCWGVERAVQIAYEARKQFP ER+WITNEIIHNPTVNKRLEDMDVK IP+E+ Sbjct: 113 VKLAKAYGFCWGVERAVQIAYEARKQFPEERLWITNEIIHNPTVNKRLEDMDVKIIPVED 172 Query: 181 GKKNFXXXXXXXXXXLPAFGAAVDEMLVLSDKNVQIVDTTCPWVTKVWNTVEKHKKGEYT 360 KK F LPAFGA VDEM VL+DK VQIVDTTCPWVTKVWNTVEKHKKGEYT Sbjct: 173 SKKQFDVVEKDDVVILPAFGAGVDEMYVLNDKKVQIVDTTCPWVTKVWNTVEKHKKGEYT 232 Query: 361 SIIHGKYAHEETVATASFAGKYIIVKNMAEATYVCDYILGGKLDGSSSTKEAFMQKFKYA 540 S+IHGKY HEET+ATASFAGKYIIVKNM EA YVCDYILGG+ DGSSSTKE FM+KFKYA Sbjct: 233 SVIHGKYNHEETIATASFAGKYIIVKNMKEANYVCDYILGGQYDGSSSTKEEFMEKFKYA 292 Query: 541 VSEGFDPDVDLVKAGIANQTTMLKGETEDIGEVGREDHDAKYGVENVNNHFVSFNTICDA 720 +S+GFDPD DLVK GIANQTTMLKGETE+IG + KYGVENV+ HF+SFNTICDA Sbjct: 293 ISKGFDPDNDLVKVGIANQTTMLKGETEEIGRLLETTMMRKYGVENVSGHFISFNTICDA 352 Query: 721 TQERQDAMYKLVEQ 762 TQERQDA+Y+LVE+ Sbjct: 353 TQERQDAIYELVEE 366 Score = 35.8 bits (81), Expect(2) = e-122 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +3 Query: 762 KLDLMLVIGGWELSNTSH 815 K+DLMLV+GGW SNTSH Sbjct: 367 KIDLMLVVGGWNSSNTSH 384 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,395,380 Number of Sequences: 27288 Number of extensions: 377363 Number of successful extensions: 958 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 925 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 958 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1529730356 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262298|gb|BM410668.1|BM410668 EST584995 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG54O9 5' end, mRNA sequence (779 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g41950.1 hypothetical protein / predicted by genfinder; su... 196 2e-50 >At2g41950.1 hypothetical protein / predicted by genfinder; supported by cDNA: gi_18491232 Length = 266 Score = 196 bits (497), Expect = 2e-50 Identities = 96/158 (60%), Positives = 124/158 (77%), Gaps = 1/158 (0%) Frame = +3 Query: 309 SNLKSCCSAIASSNDGTVSMINFEDVMEKDWSFLEHPD-SSAEHKQKIDEIISAGEITET 485 S ++ C + +S +GTVS+++F EKDWSFLE + S EH QKI+ II AGE++E+ Sbjct: 54 SRYRAFCVSSSSPPEGTVSVVDFH---EKDWSFLESMEIDSTEHTQKIERIIKAGELSES 110 Query: 486 SKVMIAISSDEFVDRVVESSICKQLLVVHDSLFMLACIKEKYDKVMCWQGEVIYIPEKWT 665 S+V+++ISS+ FVDR+VESS + LL+VHDSLF LACIKEKYDKV CWQGE+IY+PEKW+ Sbjct: 111 SRVLVSISSETFVDRLVESSPSQLLLIVHDSLFTLACIKEKYDKVKCWQGEMIYVPEKWS 170 Query: 666 PFDVVFLYFLPALPFELDQILDALRKWWSPGARVVISH 779 P D VFLYFLPALPF+LD++ L + S GARVVISH Sbjct: 171 PLDAVFLYFLPALPFDLDELFKTLSQRCSSGARVVISH 208 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,759,064 Number of Sequences: 27288 Number of extensions: 320375 Number of successful extensions: 963 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 962 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1436884920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262290|gb|BM410660.1|BM410660 EST584987 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG54M13 5' end, mRNA sequence (769 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g70590.1 expressed protein / ; supported by cDNA: gi_14335... 258 3e-69 At1g18260.1 expressed protein / ; supported by cDNA: gi_14532... 60 2e-09 At1g73570.1 hypothetical protein / predicted by genemark.hmm 49 2e-06 >At1g70590.1 expressed protein / ; supported by cDNA: gi_14335049_gb_AY037204.1_ Length = 351 Score = 258 bits (658), Expect = 3e-69 Identities = 129/247 (52%), Positives = 167/247 (67%), Gaps = 2/247 (0%) Frame = +1 Query: 34 MNQKTWPATKSSSDGLRRFTAFPFIRKQTHLQNRPSENPFSDHSKKINTTTPPXXXXXXX 213 M Q+TWP S RF++ F++ P + IN T Sbjct: 1 MKQRTWPCRSEGS----RFSSLSFLK--------PHDKDKRSRISSINKATAKSTTSSRS 48 Query: 214 XXXXXXXQYCYNQ--DFSQLPYDIILKIAARFSLSNVRASSLVCRSWCEALRPLRESMVF 387 + N+ DFS LPYDI++KIAA FS N++A+SLVC+SW +AL+PLRESM+ Sbjct: 49 SSSSSSSRPPSNEFGDFSMLPYDILMKIAAPFSHPNLQAASLVCKSWRDALKPLRESMLL 108 Query: 388 LRWGKRFKHGRGGVKRNLSKALDSFLKGAARGSTLAMVDAGLLYWELGKREEGISLYRKA 567 +RWGK++KHGRGGV+ NL KALDSFLKGA RGSTLAMVDAGL+YWE G++E+ ++LYR+A Sbjct: 109 IRWGKKYKHGRGGVRANLDKALDSFLKGAMRGSTLAMVDAGLVYWERGEKEKAVNLYRRA 168 Query: 568 AELGDPAGQCNLGISLLQVNPMDPKEAVKWLYKASVSGHVRAQYQLALTLHKGHGPKRNL 747 +ELGD GQCNLGI+ LQV P +PKEA+KWL +++ +G+VRAQYQLAL LH G + NL Sbjct: 169 SELGDAVGQCNLGIAYLQVQPSNPKEAMKWLKQSAENGYVRAQYQLALCLHHGRVVQTNL 228 Query: 748 QETAKWY 768 E KWY Sbjct: 229 LEATKWY 235 >At1g18260.1 expressed protein / ; supported by cDNA: gi_14532715_gb_AY039982.1_ Length = 678 Score = 59.7 bits (143), Expect = 2e-09 Identities = 44/128 (34%), Positives = 67/128 (51%), Gaps = 9/128 (7%) Frame = +1 Query: 412 HGRG-GVKRNLSKALDSFLKGAARGSTLAMVDAGLLY---WELGKRE--EGISLYRKAAE 573 + RG GV+RN +KAL+ A G A G LY + + K+ + + KA + Sbjct: 289 YARGAGVERNYTKALEWLTLAAKEGLYSAFNGIGYLYVKGYGVDKKNYTKAREYFEKAVD 348 Query: 574 LGDPAGQCNLGISLLQ---VNPMDPKEAVKWLYKASVSGHVRAQYQLALTLHKGHGPKRN 744 DP+G NLG+ L+ VN D ++A K+ + A+ +G +A YQLA H G G K+N Sbjct: 349 NEDPSGHYNLGVLYLKGIGVN-RDVRQATKYFFVAANAGQPKAFYQLAKMFHTGVGLKKN 407 Query: 745 LQETAKWY 768 L+ +Y Sbjct: 408 LEMATSFY 415 >At1g73570.1 hypothetical protein / predicted by genemark.hmm Length = 604 Score = 49.3 bits (116), Expect = 2e-06 Identities = 41/138 (29%), Positives = 65/138 (46%), Gaps = 7/138 (5%) Frame = +1 Query: 376 SMVFLRWGKRFKHGRGGVKRNLSKALDSFLKGAARGSTLAMVDAGLLY---WELGKRE-- 540 S+ + G + G G++R+ +KAL F K G G LY + + KR Sbjct: 243 SVAMHKIGLFYYFGLRGLRRDHAKALYWFSKAEFNG-------LGYLYVKGYGVDKRNYT 295 Query: 541 EGISLYRKAAELGDPAGQCNLGISLLQVNPM--DPKEAVKWLYKASVSGHVRAQYQLALT 714 + + AA DP+G NLG+ L+ + D + A K+ + A+ +G +A YQLA Sbjct: 296 KAREYFEMAANNEDPSGHYNLGVLYLKGTGVKKDVRHATKYFFVAANAGQPKAFYQLAKM 355 Query: 715 LHKGHGPKRNLQETAKWY 768 H G G +NL+ +Y Sbjct: 356 FHTGVGLTKNLEMATTFY 373 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,871,814 Number of Sequences: 27288 Number of extensions: 369639 Number of successful extensions: 1125 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 1078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1119 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1401406280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262278|gb|BM410648.1|BM410648 EST584975 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG54K11 5' end, mRNA sequence (754 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39880.1 putative protein / ;supported by full-length cDN... 212 2e-55 >At4g39880.1 putative protein / ;supported by full-length cDNA: Ceres:20457. Length = 178 Score = 212 bits (539), Expect = 2e-55 Identities = 115/183 (62%), Positives = 137/183 (74%) Frame = +1 Query: 52 MGSRLGRRVVNFANLPIKLLMPSSFSNITEISLKTIPSASKIEIKRVLESLYGFEVEKVQ 231 MGSRLG RVV+FANLPIKLLMP+ +NI E +LKTIPSASKIEIKRVLESLYGF+VEKV Sbjct: 1 MGSRLGGRVVHFANLPIKLLMPAKLTNIHEFALKTIPSASKIEIKRVLESLYGFDVEKVN 60 Query: 232 TLNMDGKKKKRGGLLIAKPDYKKAYVTLRNPLSISPDLFPIGVIQEEXXXXXXXXXXXIV 411 TLNMDGKKKKRGGLLIAK DYKKAYVTLR+PLSIS DLFP+ I+E+ V Sbjct: 61 TLNMDGKKKKRGGLLIAKADYKKAYVTLRSPLSISRDLFPVKYIEED--RKSKVKGSSFV 118 Query: 412 EDDEPKKTHWLDEKKDGRNRSEMRFGRGRDHRSGQRSDVGRDRGGESRDVGAAPAKFPWS 591 E+++ KK+HWLD K+ R +G+G+ R G+R++ RGG + A AKFPWS Sbjct: 119 EEEDDKKSHWLDRKE---KREIGGYGKGKGRRGGERAN-SPTRGGAA---AAGTAKFPWS 171 Query: 592 SMR 600 +MR Sbjct: 172 NMR 174 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,078,289 Number of Sequences: 27288 Number of extensions: 310147 Number of successful extensions: 943 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 907 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 937 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1357057980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262263|gb|BM410633.1|BM410633 EST584960 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG54I1 5' end, mRNA sequence (774 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27990.1 putative protein / predicted proteins, Saccharomy... 114 6e-26 At3g22510.1 hypothetical protein / predicted by genscan+ 50 2e-06 >At5g27990.1 putative protein / predicted proteins, Saccharomyces cerevisiae and Schizosaccharomyces pombe;supported by full-length cDNA: Ceres:5109. Length = 184 Score = 114 bits (285), Expect = 6e-26 Identities = 65/185 (35%), Positives = 106/185 (57%), Gaps = 2/185 (1%) Frame = +3 Query: 117 GIGLVLTRWTALQMAIENEWGGRDTREKSNQLNVDIFSAFTQSKEKVY-MDDIEEILDEF 293 GIGL+L RWTA++ A+EN WGGRD++ K+N+ +F F QSK+ V ++ + ++LD+ Sbjct: 18 GIGLILWRWTAMRAAVENGWGGRDSQAKANETVATVFDFFIQSKDPVKDIEKLGDLLDKG 77 Query: 294 MISLNTEVNDGSLEEVAEKLMYMHEECLEGDFNSIKVLRETNVGRRPATYVRQXXXXXXX 473 + LNT DGS++EVA L+ ++E+C G++ ++ LR ATY + Sbjct: 78 LDELNTTAEDGSVDEVANLLVDLYEDCCNGNYEMLEELR--------ATYSQTSASVVKV 129 Query: 474 XXXXXXXRNENFGNNSSDMAID-SMESQPSLGQDMIVEPVRKQPAEVDPDGWTTVSTKRN 650 ++ + ++DM +D S + Q ++ D EPV DGWT VS+++N Sbjct: 130 SNGDDEESDDEDDDQTTDMMVDASNQKQEAMPVD---EPVA-------DDGWTVVSSRKN 179 Query: 651 KGRRN 665 KG+RN Sbjct: 180 KGKRN 184 >At3g22510.1 hypothetical protein / predicted by genscan+ Length = 85 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/47 (42%), Positives = 33/47 (69%) Frame = +3 Query: 120 IGLVLTRWTALQMAIENEWGGRDTREKSNQLNVDIFSAFTQSKEKVY 260 IG +L+RW LQMA++N+WGG D+ +KS +L ++F +QS ++ Sbjct: 35 IGELLSRWGGLQMAVKNQWGGHDSLKKSQELAHNLFHLISQSNGSIF 81 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,126,063 Number of Sequences: 27288 Number of extensions: 322611 Number of successful extensions: 864 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262212|gb|BM410582.1|BM410582 EST584909 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG53J16 5' end, mRNA sequence (579 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48240.1 unknown protein / 179 1e-45 >At5g48240.1 unknown protein / Length = 339 Score = 179 bits (453), Expect = 1e-45 Identities = 92/157 (58%), Positives = 107/157 (67%), Gaps = 24/157 (15%) Frame = +3 Query: 3 KVKGEAKKEKHLIREKGHEKPANFLDTYEKSLIAVATKGVVKLFNAVNKAQHAQKGLNPS 182 K KG+A+K KHLI EKGH KP ++LD++EK LI VATKGVVKLFNAVNKAQHAQKGLNPS Sbjct: 171 KAKGQARKAKHLIAEKGHVKPGSYLDSHEKILIGVATKGVVKLFNAVNKAQHAQKGLNPS 230 Query: 183 RAKDEKVIKKRRREVFFSELGKAPSQT------------------------TVSKAGASN 290 R+KD KV+KKRR+E F SELGK + T + S A A++ Sbjct: 231 RSKDAKVLKKRRKEAFLSELGKTKTDTKPSTLDEHRSKLVFCLELASIEKGSPSVARAAH 290 Query: 291 SLEDEGPAWAPLRDTYMLTNPKLKDWDKNPDTTVDDD 401 EDE P WAPLRD YML NPKLKDWDK +T+ DD Sbjct: 291 KSEDEAPVWAPLRDNYMLANPKLKDWDKKQETSEGDD 327 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,982,625 Number of Sequences: 27288 Number of extensions: 214456 Number of successful extensions: 587 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 586 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 877249352 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262204|gb|BM410574.1|BM410574 EST584901 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG53H10 5' end, mRNA sequence (589 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77230.1 unknown protein / 107 3e-24 >At1g77230.1 unknown protein / Length = 237 Score = 107 bits (268), Expect = 3e-24 Identities = 66/138 (47%), Positives = 82/138 (58%), Gaps = 21/138 (15%) Frame = +2 Query: 26 MKMTWKNQSKKNPNKRPISQLQNLPFDPTEDST---------FPEEKLAKTE-----EIS 163 MK+TW KNP KR L N P P E F E+ + + + + S Sbjct: 1 MKLTWN----KNPKKRSRLVLSNFPDLPFEKDDSLESQSHLHFREDDIDRRQTTDQLDSS 56 Query: 164 HVNG-------DEDTIKLVESFQQQGNKLAEEGKYREALGKWESALLLMPDRAILHEQKA 322 V G D + KL ES + QG+K AEEGKY+EALGKWE+AL L+P+ AILHEQKA Sbjct: 57 EVGGNHPRENFDVEAKKLAESIRAQGDKFAEEGKYQEALGKWEAALNLVPEDAILHEQKA 116 Query: 323 QILLELGETWKALQAATR 376 Q+LLELG+ WKAL+AATR Sbjct: 117 QVLLELGDAWKALKAATR 134 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,919,881 Number of Sequences: 27288 Number of extensions: 219621 Number of successful extensions: 707 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 682 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 706 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 904103924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262032|gb|BM410402.1|BM410402 EST584729 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG52L24 5' end, mRNA sequence (647 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g57630.1 putative protein / DOC4, Mus musculus, AF059485 338 1e-93 >At3g57630.1 putative protein / DOC4, Mus musculus, AF059485 Length = 736 Score = 338 bits (867), Expect = 1e-93 Identities = 153/214 (71%), Positives = 177/214 (82%) Frame = +1 Query: 4 LSMQEHIHGGLRSSLTLDFYKKAYDHIITKYPYWSRSAGKDHIWFFSWDEGACYAPKEIW 183 ++MQ H GLRSSLTL+FYK+AY+HI+ KYPYW+RSAG+DHIW IW Sbjct: 426 INMQNHT--GLRSSLTLEFYKRAYEHIVEKYPYWNRSAGRDHIW--------------IW 469 Query: 184 NSIMLVHWGNTNSKHNHSTTAYWGDNWDPISSDRRGNHTCFDPDKDLVLPAWKRPDESSL 363 NS+MLVHWGNTNSKHNHSTTAY+GDNWD IS +RRG+H CFDP KDLV+PAWK PD S+ Sbjct: 470 NSMMLVHWGNTNSKHNHSTTAYFGDNWDDISDERRGDHPCFDPRKDLVIPAWKVPDPYSM 529 Query: 364 SAKHWSRPREERKTFFYFNGNLGPAYENGRPEDTYSMGIRQKVAEEFGSTLNKEGKLGKQ 543 +W RPRE+RKT FYFNGNLGPAYE GRPED+YSMGIRQK+AEEFGS+ NKEGKLGKQ Sbjct: 530 RKNYWERPREKRKTLFYFNGNLGPAYEKGRPEDSYSMGIRQKLAEEFGSSPNKEGKLGKQ 589 Query: 544 HAEDVIVTPLRAGNYHDELASSVFCGVMPGDGWS 645 HAEDVIVTPLR+ NYH ++A+S+FCG PGDGWS Sbjct: 590 HAEDVIVTPLRSDNYHKDIANSIFCGAFPGDGWS 623 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.135 0.452 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,240,550 Number of Sequences: 27288 Number of extensions: 307972 Number of successful extensions: 867 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 866 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1070908320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18261766|gb|BM410136.1|BM410136 EST584463 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG51H23 5' end, mRNA sequence (546 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g56730.1 zinc protease PQQL-like protein / 244 2e-65 >At5g56730.1 zinc protease PQQL-like protein / Length = 956 Score = 244 bits (623), Expect = 2e-65 Identities = 120/181 (66%), Positives = 143/181 (78%), Gaps = 1/181 (0%) Frame = +2 Query: 2 FLGGNKPSRVGNIRGDISINFSCDPDISSTLVDLALEEILHLQEEGPSIEDAMAVLEIEQ 181 FLGGNKPSR ++RGDIS+NFSCDP+ISS LVDLALEEI+ LQ+EGPS ED A+LEIEQ Sbjct: 775 FLGGNKPSRTADLRGDISVNFSCDPEISSKLVDLALEEIVRLQKEGPSQEDISAILEIEQ 834 Query: 182 RAHENGLQENYYWLDRILRSYQSRIYSGDIGNSFKIQEAARSKVRSILTPLTAQLALQKL 361 RAHENG+QENYYWLDRI+R YQSR+Y+GD+G S KI E R ++R L P TAQ ALQ++ Sbjct: 835 RAHENGMQENYYWLDRIIRGYQSRVYAGDLGASCKILEEGRLRMRESLAPQTAQAALQRI 894 Query: 362 LPFPCKKQYTVVILMPQASRIKRLKSLMQSVPKS-YSRDAKILAGIAGVTILSLSLWKYS 538 LP PCKKQYT VILMPQ SR L S+ S + Y RD KILAGIAG+ ++ +W+YS Sbjct: 895 LPHPCKKQYTAVILMPQRSRFGFLSSIFSSRSEGPYIRDTKILAGIAGLGVVVFGIWRYS 954 Query: 539 R 541 R Sbjct: 955 R 955 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,835,056 Number of Sequences: 27288 Number of extensions: 233851 Number of successful extensions: 677 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 668 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 790135456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18261565|gb|BM409935.1|BM409935 EST584262 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG50F6 5' end, mRNA sequence (651 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g02715.1 unknown protein / predicted by genemarkHMM 89 2e-18 >At4g02715.1 unknown protein / predicted by genemarkHMM Length = 205 Score = 89.0 bits (219), Expect = 2e-18 Identities = 69/199 (34%), Positives = 90/199 (44%), Gaps = 4/199 (2%) Frame = +1 Query: 1 GQAPIRFGSFGSPPSVGFKEINCRNFESSAGILPTPLKAYSTPVTKKGYSSSFRSKTPSP 180 G+ + F S PS F++INCR F+S G+LP P + STP+TK S + ++P Sbjct: 16 GKKSLGHDRFRSAPSKTFRQINCRTFQSGVGLLPRPKRTSSTPLTKGALS---QVQSPRS 72 Query: 181 PSSIQGKSHSEGQXXXXXXXXXXXXXIPIDIKGGGDSRKEGS----LNDEFAYSELWAGX 348 P S+ H IPI G R+ S +YSELWAG Sbjct: 73 PKSVLPVFHHP------SVDSGRTSPIPIANCRGSQIRRCSSEFVDKRRSLSYSELWAGP 126 Query: 349 XXXXXXXXXXXXXXXXXVKPKRTVSLDLPTTSPFGIDLPSFAKSAPASPTRERSPSPGVL 528 ++ KRTVSL P +D+ AKSAP SPT +P Sbjct: 127 TYSNSPPPASVPIPKFSLQQKRTVSLTFPAPDS-AVDIREVAKSAPVSPT-SSGDNP--- 181 Query: 529 SDSTDSATQTLRRILNLEI 585 ST SAT TLRR+LNLE+ Sbjct: 182 FRSTVSATMTLRRMLNLEL 200 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,869,985 Number of Sequences: 27288 Number of extensions: 298759 Number of successful extensions: 989 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 986 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1079832556 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18261531|gb|BM409901.1|BM409901 EST584228 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG50J13 5' end, mRNA sequence (607 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g25770.1 putative protein / predicted protein, Oryza sativa 292 8e-80 >At5g25770.1 putative protein / predicted protein, Oryza sativa Length = 318 Score = 292 bits (748), Expect = 8e-80 Identities = 139/215 (64%), Positives = 168/215 (77%), Gaps = 23/215 (10%) Frame = +1 Query: 31 RGYIAVAIDSRYHGERATSITTYRESLVSSWKNGDTMPFIFDSVWDLIKLVDYLTEREDV 210 RGY+A+ +DSRYHGERA T YR++L+SSW+NG+TMPFIFD+VWDLIKL +YLT+R+D+ Sbjct: 60 RGYVAIGLDSRYHGERADCKTAYRDALISSWRNGNTMPFIFDTVWDLIKLAEYLTQRDDI 119 Query: 211 DPSKIGITGESLGGMHAWFAAFVDTRYSVVVPIIGVQ----------------------- 321 DP KIGITG SLGGMHAWFAA DTRYSVVVP+IGVQ Sbjct: 120 DPKKIGITGISLGGMHAWFAAAADTRYSVVVPLIGVQVLNKIAATMRPILPCMSEYEDGF 179 Query: 322 GFGWAIEHDKWQARVNSIKAIFEEASADLDKSAIDKEVVQKVWDRIAPGLASQFDAPYTV 501 GF WAIE+D+W+ARVNSIK +FEEA DL K+ IDKE+V+KVW+RIAPGLAS+FD+PY++ Sbjct: 180 GFRWAIENDEWEARVNSIKPLFEEARIDLGKNIIDKELVEKVWNRIAPGLASKFDSPYSL 239 Query: 502 PTIAPRPLLIFNGADDPRCPLGGLEIPESRTLEAY 606 P IAPRPL I NGA+DPRCPLGGLE+ R +AY Sbjct: 240 PVIAPRPLYILNGANDPRCPLGGLELALKRAEKAY 274 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,656,672 Number of Sequences: 27288 Number of extensions: 304160 Number of successful extensions: 875 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 872 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 957813068 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18261410|gb|BM409780.1|BM409780 EST584107 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG50G11 5' end, mRNA sequence (572 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g22530.1 unknown protein / 152 2e-37 >At2g22530.1 unknown protein / Length = 897 Score = 152 bits (383), Expect = 2e-37 Identities = 82/159 (51%), Positives = 107/159 (66%), Gaps = 2/159 (1%) Frame = +3 Query: 9 DSAYVIGLSYVYYWSXXXXXXXXPVNSMPVLFLFLQVLASIWFSSGSNQHRRQWVEVAAL 188 D Y+IG +Y+ W P+NS P+L L LQ+LA + SS Q +WVE+ AL Sbjct: 717 DCLYLIGSAYILCWCLLQQLLQQPINSGPILLLLLQILAILCLSSSDFQVN-EWVEITAL 775 Query: 189 YYMGMAGHFGLGNTNTLATIDVAGAFIGVLNHSTVLSGVLMFIITYASPMLYLLSMVMY- 365 YYMGMAGHF LGN+NTLATIDVAGAFIG+ +HST+LSG+LMF+ITYASPML+LLS+VMY Sbjct: 776 YYMGMAGHFALGNSNTLATIDVAGAFIGISSHSTILSGILMFMITYASPMLFLLSLVMYI 835 Query: 366 -NSVKDTSSSIISEKGNIGSLLKRTLGFPCLVPLGLNSI 479 ++++ S+S IS K + PC LN++ Sbjct: 836 GANLRNHSNSTISTH---RETTKARVPLPCSALHQLNTL 871 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,159,665 Number of Sequences: 27288 Number of extensions: 296145 Number of successful extensions: 723 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 859346304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260912|gb|BM409282.1|BM409282 EST583609 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG47L20 5' end, mRNA sequence (712 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67325.1 similar to RRM-containing RNA-binding protein, putat... 239 9e-93 >At1g67325.1 similar to RRM-containing RNA-binding protein, putative / temporary automated functional assignment Length = 288 Score = 239 bits (611), Expect(2) = 9e-93 Identities = 109/150 (72%), Positives = 122/150 (80%), Gaps = 2/150 (1%) Frame = +2 Query: 17 MSQVDNRNSSAAKRARTDGGRREDDWTCPSCGNVNFSFRTTCNMRNCTQSRPADHNSKSA 196 MSQVDNRNSSAAKRARTDGGRREDDW CPSCGNVNFSFRTTCNMRNCTQ RPADHN KSA Sbjct: 1 MSQVDNRNSSAAKRARTDGGRREDDWICPSCGNVNFSFRTTCNMRNCTQPRPADHNGKSA 60 Query: 197 VRPMHAPQSYSPSAAYVGSGAPSSMYMGVAPYGGSLFNGPSMPAYDVPFAGGSAYHYNFG 376 +PM Q +S AY+GSG P +YMG +PYG LFNG SMP YDVPF+GGS YH+N+ Sbjct: 61 PKPMQHQQGFSSPGAYLGSGGPPPVYMGGSPYGSPLFNGSSMPPYDVPFSGGSPYHFNYN 120 Query: 377 SRLSGGSPYRPVHLSAPPPYTGG--MGNGG 460 SR+ G+ YRP+H+S PPPY GG MG+GG Sbjct: 121 SRMPAGAHYRPLHMSGPPPYHGGSMMGSGG 150 Score = 118 bits (296), Expect(2) = 9e-93 Identities = 52/78 (66%), Positives = 58/78 (73%), Gaps = 3/78 (3%) Frame = +3 Query: 459 GMYGVPPLMDRYGVALXXXXXXXXXXXG---FYPDDNSQKKDGTRDNDWTCPKCGNVNFS 629 GMYG+PP +DRYG+ + FYPD+ SQK+D TRDNDWTCP CGNVNFS Sbjct: 150 GMYGMPPPIDRYGLGMAMGPGSAAAMMPRPRFYPDEKSQKRDSTRDNDWTCPNCGNVNFS 209 Query: 630 FRTVCNMRKCNTPKPGSQ 683 FRTVCNMRKCNTPKPGSQ Sbjct: 210 FRTVCNMRKCNTPKPGSQ 227 Score = 67.4 bits (163), Expect = 7e-12 Identities = 27/47 (57%), Positives = 32/47 (67%), Gaps = 4/47 (8%) Frame = +3 Query: 576 GTRDNDWTCPKCGNVNFSFRTVCNMRKCNTPKP----GSQVPKPREN 704 G R++DW CP CGNVNFSFRT CNMR C P+P G PKP ++ Sbjct: 20 GRREDDWICPSCGNVNFSFRTTCNMRNCTQPRPADHNGKSAPKPMQH 66 Score = 62.4 bits (150), Expect = 2e-10 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 2/49 (4%) Frame = +2 Query: 80 REDDWTCPSCGNVNFSFRTTCNMRNCTQSRPADH--NSKSAVRPMHAPQ 220 R++DWTCP+CGNVNFSFRT CNMR C +P S + +AP+ Sbjct: 194 RDNDWTCPNCGNVNFSFRTVCNMRKCNTPKPGSQQGGSSDKISKQNAPE 242 Score = 49.7 bits (117), Expect = 2e-06 Identities = 19/46 (41%), Positives = 28/46 (60%) Frame = +2 Query: 83 EDDWTCPSCGNVNFSFRTTCNMRNCTQSRPADHNSKSAVRPMHAPQ 220 E W C +CGN+N+ FR+ CN +NC +P D ++ S P AP+ Sbjct: 242 EGSWKCDNCGNINYPFRSKCNRQNCGADKPGDRSNGS---PSRAPE 284 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,896,855 Number of Sequences: 27288 Number of extensions: 463952 Number of successful extensions: 1661 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1650 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1245572720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260838|gb|BM409208.1|BM409208 EST583535 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG47J21 5' end, mRNA sequence (747 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03800.1 unknown protein / 281 2e-76 >At2g03800.1 unknown protein / Length = 361 Score = 281 bits (720), Expect = 2e-76 Identities = 131/210 (62%), Positives = 149/210 (70%) Frame = +1 Query: 1 PQGGKPGWAAPPNPRMGPWMILLNKIAESHNLIPEFEITFEATHHGPVTTKPTMFIEIGS 180 PQGGKPGWAA P+ R+GPW LL K+AE+H L+PEFEIT EATHHGP+T KPTMF+EIGS Sbjct: 151 PQGGKPGWAALPSTRIGPWFRLLKKMAEAHGLVPEFEITLEATHHGPITNKPTMFLEIGS 210 Query: 181 TEEYWKRPDAAQXXXXXXXXXXXXXXXXXXXNWSSTSANNKVLLGIGGGHYVPRHTDVIK 360 TEEYWKR DAAQ W S + KVLLGIGGGHY PRH D+ Sbjct: 211 TEEYWKRQDAAQVMALLMWEGLGLGGSEEVGKWKSETGKRKVLLGIGGGHYAPRHMDIAL 270 Query: 361 KDGCWVGQLLSGYSLPMEDPGPSKGKVNAHDIAGTWKHSIRAAYDATKAGFPGGEILAHL 540 KD WVG LLSGYSLPMEDP +K + I G W+ SI+AA++ATKA FPGGEILAHL Sbjct: 271 KDDIWVGHLLSGYSLPMEDPTQTKTTPGENYIGGNWRQSIKAAFEATKASFPGGEILAHL 330 Query: 541 DQKSFKSWQKNAIIEFLGAQNIKIGKPGDF 630 D KSFK WQK AI EFL ++I +GKP DF Sbjct: 331 DHKSFKGWQKKAITEFLAEESINVGKPNDF 360 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,882,374 Number of Sequences: 27288 Number of extensions: 343484 Number of successful extensions: 865 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260582|gb|BM408952.1|BM408952 EST583279 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG46J15 5' end, mRNA sequence (773 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g14835.1 Expressed protein / ; supported by full-length cD... 276 1e-74 >At2g14835.1 Expressed protein / ; supported by full-length cDNA: Ceres: 40603. Length = 343 Score = 276 bits (705), Expect = 1e-74 Identities = 143/235 (60%), Positives = 162/235 (68%), Gaps = 7/235 (2%) Frame = +3 Query: 84 MVVCKCKKATKLYCFVHKIAVCGECICFPEHQICVIRAYSEWVIDGEYDWPPKCCYCKSE 263 MVVCKCKKAT+LYCFVHK VCGECICFPEHQ CV+R YSEWVIDGEYD PKCC C++ Sbjct: 1 MVVCKCKKATRLYCFVHKAPVCGECICFPEHQTCVVRTYSEWVIDGEYD-QPKCCQCQAT 59 Query: 264 LEEGTDAGITRLGCLHTIHTSCLVSHLKSFPPHTAPAGYVCPIPECSTSIWPPKSVKESG 443 +EG +TRLGCLH IHTSCLVS +KSFPPHTAPAGYVC P CST IWPP VK++G Sbjct: 60 FDEGAGHQVTRLGCLHAIHTSCLVSLIKSFPPHTAPAGYVC--PACSTPIWPPMMVKDAG 117 Query: 444 SRFHTKLKEAIMQTGLEKKLFGNHPVTLPGTEPRGPPPAFASDPLKHIST------GGKD 605 SR H L+E I QTGLEK L GNHPV+ TE R PPPAFASD L +IS+ G Sbjct: 118 SRLHALLREVITQTGLEKNLLGNHPVS-RSTESRSPPPAFASDALINISSSSHTQEGNNL 176 Query: 606 SEGLAAIATGS-SKPASLDIVEIDGSTSAPSSMSNHETNFMKSTSPSGPGAPPRR 767 +G + G SK A +IVEID SA S +MKS+SP A R+ Sbjct: 177 PDGYSVAGNGEYSKSAVSEIVEIDVPASAGS--------YMKSSSPGLAAAAARK 223 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,232,327 Number of Sequences: 27288 Number of extensions: 416497 Number of successful extensions: 1346 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1339 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260529|gb|BM408899.1|BM408899 EST583226 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG46M5 5' end, mRNA sequence (238 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39450.1 hypothetical protein / 102 4e-23 >At4g39450.1 hypothetical protein / Length = 1553 Score = 102 bits (254), Expect = 4e-23 Identities = 49/78 (62%), Positives = 64/78 (81%) Frame = +2 Query: 5 DAFAMVYSRFDMKNETASLLESRAHQSCKEWSLHSDKDQTDELLASMGYFIEAAEVYSSI 184 DAFAMVY FDMK+ETA+LLE+RA Q+ ++W L DKDQ ++LL SM Y+IEAAEV++SI Sbjct: 1300 DAFAMVYKHFDMKHETATLLEARADQAAQQWFLRYDKDQNEDLLDSMRYYIEAAEVHTSI 1359 Query: 185 DAGSKTRQSCAQALLLYL 238 DAG+K R++C QA L+ L Sbjct: 1360 DAGNKARKACGQASLVSL 1377 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,531,765 Number of Sequences: 27288 Number of extensions: 99551 Number of successful extensions: 340 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 340 length of database: 11,516,596 effective HSP length: 54 effective length of database: 10,043,044 effective search space used: 241033056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260285|gb|BM408655.1|BM408655 EST582982 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG45G18 5' end, mRNA sequence (714 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g10380.1 expressed protein / ; supported by cDNA: gi_16604... 308 1e-85 >At3g10380.1 expressed protein / ; supported by cDNA: gi_16604636_gb_AY059763.1_ Length = 1053 Score = 308 bits (790), Expect(2) = 1e-85 Identities = 156/221 (70%), Positives = 180/221 (80%), Gaps = 1/221 (0%) Frame = +3 Query: 18 QAAQAAITGLHYLKGQLESFQSSKQKHQNGIYLA-VLLAVSPVSPVMAPTGTAQAAAKEL 194 Q ++ GLH +KGQ E+++ SK+K QNGI + LAVSPVSP+MAP G AQAAAKEL Sbjct: 390 QGDRSVAAGLHLIKGQSEAYRLSKEKPQNGISNSGTHLAVSPVSPLMAPGGKAQAAAKEL 449 Query: 195 LDSTLDAVVHIFENHVIVGELLESKCSQQIDLNTPKSMPTDISWNPDSDASHATGGYNIG 374 LDS LD +V IFENHV++GELLE K SQ D+NTP+S+PTD++WN +S+AS ATGGY I Sbjct: 450 LDSILDTIVKIFENHVVIGELLEMKASQH-DINTPRSLPTDVNWNTESEASQATGGYTIS 508 Query: 375 FSLTVLQSECQQLICEILRATPEAASADAAVQTARLASKAPSKEKRDGSEDGLTFAFRFT 554 F LTVLQSECQQLICEILRATPEAASADAA QTA+LA KAP K+KRD EDGLTF FRFT Sbjct: 509 FPLTVLQSECQQLICEILRATPEAASADAAAQTAKLAKKAPKKDKRDAPEDGLTFTFRFT 568 Query: 555 DATVSISNQGVDLIRQGWGKRGSNVLQEGYGTSTILPEQGI 677 DATVSISNQG DLIRQGWGKR N EGYG++ +LPEQGI Sbjct: 569 DATVSISNQGADLIRQGWGKRAPNASLEGYGSAAVLPEQGI 609 Score = 25.8 bits (55), Expect(2) = 1e-85 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 671 GNYLAASIYRPGLQ 712 G YLAASIYRP LQ Sbjct: 608 GIYLAASIYRPVLQ 621 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,251,381 Number of Sequences: 27288 Number of extensions: 282503 Number of successful extensions: 738 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 736 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1254469668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260284|gb|BM408654.1|BM408654 EST582981 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG45G12 3' end, mRNA sequence (755 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g44575.1 photosystem II 22kDa protein, putative / similar ... 259 8e-70 >At1g44575.1 photosystem II 22kDa protein, putative / similar to photosystem II 22kDa protein GI:21306 from [Spinacia oleracea]; supported by cDNA: gi_15294225_gb_AF410304.1_AF410304 Length = 265 Score = 259 bits (663), Expect = 8e-70 Identities = 144/201 (71%), Positives = 150/201 (73%), Gaps = 3/201 (1%) Frame = -3 Query: 693 KGAPPK---EKQKVEDXXXXXXXXXXXTKQNELFVGRVAMIGFAASLLGEAITGKGILAQ 523 K AP K K KVED TK NELFVGRVAMIGFAASLLGEA+TGKGILAQ Sbjct: 59 KAAPKKVEKPKSKVEDGIFGTSGGIGFTKANELFVGRVAMIGFAASLLGEALTGKGILAQ 118 Query: 522 LNLETGIPIYEAEPXXXXXXXXXXLGAIGALGDRGKFVDDPTPPTGLEKAVIPPGKSFKS 343 LNLETGIPIYEAEP LGAIGALGDRGKFVDDP PTGLEKAVIPPGK+ +S Sbjct: 119 LNLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGKFVDDP--PTGLEKAVIPPGKNVRS 176 Query: 342 ALGLSEGGPLFGFTKANELFVGRLAQLGIAFSIIGEIITGKGALAQLNFETGVPINEIEP 163 ALGL E GPLFGFTKANELFVGRLAQLGIAFS+IGEIITGKGALAQLN ETG+PI +IEP Sbjct: 177 ALGLKEQGPLFGFTKANELFVGRLAQLGIAFSLIGEIITGKGALAQLNIETGIPIQDIEP 236 Query: 162 XXXXXXXXXXXXXXNPGTGKF 100 NPG GKF Sbjct: 237 LVLLNVAFFFFAAINPGNGKF 257 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,475,657 Number of Sequences: 27288 Number of extensions: 329508 Number of successful extensions: 1098 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1029 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1092 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260239|gb|BM408609.1|BM408609 EST582936 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG45O9 5' end, mRNA sequence (711 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41190.1 unknown protein / 273 7e-74 >At5g41190.1 unknown protein / Length = 602 Score = 273 bits (698), Expect = 7e-74 Identities = 143/239 (59%), Positives = 180/239 (74%), Gaps = 2/239 (0%) Frame = +1 Query: 1 VDANAIIQGGDKLNHSADRFVTVPEVLAEIRDRNSRHSLNLLPFTIDTTEPSPDSLKKVI 180 VDANAII+G L + AD+FVTVPEVL+EIRD SR L +PFTIDT EPSP+SL KVI Sbjct: 49 VDANAIIEGRQSLTNFADKFVTVPEVLSEIRDPASRRRLAFIPFTIDTMEPSPESLSKVI 108 Query: 181 SFARSTGDLHTLSDVDLKLIALTYTLHAQFHGTQQLRDCPPAIHMINVKRLPEKDLPGWG 360 FAR+TGDL +LSDVDLKLIAL+YTL AQ +GT+ LRD PP I + VKRLPEKDLPGWG Sbjct: 109 KFARATGDLQSLSDVDLKLIALSYTLEAQVYGTKNLRDVPPPIQTVRVKRLPEKDLPGWG 168 Query: 361 ANISNPEEWEAIEHALDEGADTTSRILPLKDLSLNVIPLDQQSGRDGSVVNGGDSHSENQ 540 +N++N EEWEA+E+ +E ++ S+ILPLKDL++N+I D S GSVV+ ++H E Sbjct: 169 SNVANLEEWEALENETEEKSNANSKILPLKDLNMNIIASDNVS-EVGSVVSHTENHEE-- 225 Query: 541 MDFDDGFSKPQKYLPQKKEVKIDGKEMVADGIDASQGQYDDHGD--DGATAVSRSTHRR 711 D +G K ++Y P+K E+K++GK MV +G+DASQGQYDD D D AVSRSTH + Sbjct: 226 -DVQEGGKKHRRYPPKKTEIKLEGK-MVVEGVDASQGQYDDDDDASDWRPAVSRSTHSK 282 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.314 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,018,154 Number of Sequences: 27288 Number of extensions: 293241 Number of successful extensions: 987 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 854 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 954 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1245572720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260201|gb|BM408571.1|BM408571 EST582898 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG45G13 5' end, mRNA sequence (722 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g34380.1 DNA polymerase type I, putative / similar to GI:4... 204 4e-53 >At1g34380.1 DNA polymerase type I, putative / similar to GI:4090935 from [Rhodothermus sp. 'ITI 518'] Length = 343 Score = 204 bits (519), Expect = 4e-53 Identities = 94/128 (73%), Positives = 114/128 (88%) Frame = +2 Query: 2 WSFYTLKHYVAQYNCDPRSDLSLRCILGDEVDGVPGIQHVVPGFGRKTALKLLKKHGTLE 181 WSFYTLKHY AQYNCDP+SDLS RCI+GDEVDGVPGIQH+VP FGRKTA+KL++KHG+LE Sbjct: 214 WSFYTLKHYHAQYNCDPQSDLSFRCIMGDEVDGVPGIQHMVPAFGRKTAMKLVRKHGSLE 273 Query: 182 NLLNAASVRSVGRQYAQDALIKYADYLRRNYEVLSLKRDVSIHIEEQWLNERDARNDSLV 361 +LL+AA+VR+VGR YAQ+AL KYADYLRRNY+VL+L RDV + I+ +WL ERD NDS V Sbjct: 274 SLLSAAAVRTVGRPYAQEALTKYADYLRRNYQVLALNRDVRVQIQNEWLMERDTSNDSEV 333 Query: 362 LSNFVTSL 385 LS+F ++L Sbjct: 334 LSSFFSTL 341 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,247,307 Number of Sequences: 27288 Number of extensions: 284695 Number of successful extensions: 863 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 863 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1268361380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260183|gb|BM408553.1|BM408553 EST582880 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG45C21 5' end, mRNA sequence (823 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g10860.1 putative protein / 110K5.11, unknown protein, Sor... 301 3e-82 At5g63490.1 putative protein / strong similarity to unknown p... 60 1e-09 At2g36500.1 hypothetical protein / predicted by genscan 57 9e-09 At3g52950.1 putative protein / predicted protein, Arabidopsis... 57 1e-08 At5g50640.1 putative protein / strong similarity to unknown p... 56 3e-08 At5g50530.1 putative protein / strong similarity to unknown p... 56 3e-08 >At5g10860.1 putative protein / 110K5.11, unknown protein, Sorghum bicolor, EMBL:AF124045; supported by cDNA: gi_13605727_gb_AF361845.1_AF361845 Length = 206 Score = 301 bits (771), Expect = 3e-82 Identities = 155/204 (75%), Positives = 176/204 (85%), Gaps = 2/204 (0%) Frame = +1 Query: 1 GGLKQMLSHGSVLKSAVLRHVRLGSGWRQ--LMFVRQETTLTARIEEHGFESTKISDILK 174 G ++ +S G+V+K +VL+H+R+ + Q + R E+T AR+EE GFEST ISD++K Sbjct: 3 GVIRSFVSGGNVVKGSVLQHLRVINPAIQPSVFCSRSESTQPARMEESGFESTTISDVMK 62 Query: 175 GKGKGADGSWLWCTTDDTVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIV 354 KGK ADGSWLWCTTDDTVYDAVKSMT HNVGALVVVK GE +++AGIITERDYLRKIIV Sbjct: 63 SKGKSADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQQALAGIITERDYLRKIIV 122 Query: 355 QGRSSKSTKVGDIMTEENKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTGMIGMVSIGD 534 QGRSSKSTKVGDIMTEENKLITVTPETKVL+AMQLMTDNRIRHIPVI GMIGMVSIGD Sbjct: 123 QGRSSKSTKVGDIMTEENKLITVTPETKVLRAMQLMTDNRIRHIPVIKDKGMIGMVSIGD 182 Query: 535 VVRAVVGEHREELKRLNAFIQGGY 606 VVRAVV EHREEL+RLNA+IQGGY Sbjct: 183 VVRAVVHEHREELQRLNAYIQGGY 206 >At5g63490.1 putative protein / strong similarity to unknown protein (emb|CAB86899.1) Length = 543 Score = 60.1 bits (144), Expect = 1e-09 Identities = 36/128 (28%), Positives = 67/128 (52%), Gaps = 3/128 (2%) Frame = +1 Query: 226 TVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDIMTEE 405 T+Y+A K M V AL++ S N+ + GI+T++D ++I Q + + T V +MT+ Sbjct: 71 TIYEACKRMASRRVDALLLTDS--NEMLCGILTDKDIATRVISQELNVEETPVSKVMTKN 128 Query: 406 NKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTGMIGMVSIGDVVRAVVGEHR---EELK 576 V ET ++A+Q M + RH+PV++ +I ++ I + + E+ K Sbjct: 129 PMF--VLSETLAVEALQKMVQGKFRHLPVVENGEVIALLDIAKCLYDAIARMERAAEKGK 186 Query: 577 RLNAFIQG 600 + A ++G Sbjct: 187 AIAAAVEG 194 >At2g36500.1 hypothetical protein / predicted by genscan Length = 536 Score = 57.4 bits (137), Expect = 9e-09 Identities = 30/101 (29%), Positives = 58/101 (56%) Frame = +1 Query: 226 TVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDIMTEE 405 TV+DA + M V A+++ S + ++GI+T++D ++I +G + T V +MT Sbjct: 78 TVFDACRRMAARRVDAVLLTDS--SALLSGIVTDKDIATRVIAEGLRPEHTLVSKVMTRN 135 Query: 406 NKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTGMIGMVSI 528 I VT ++ ++A+Q M + RH+PV++ +I ++ I Sbjct: 136 P--IFVTSDSLAIEALQKMVQGKFRHLPVVENGEVIALLDI 174 Score = 52.8 bits (125), Expect = 2e-07 Identities = 29/98 (29%), Positives = 52/98 (52%) Frame = +1 Query: 214 TTDDTVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDI 393 + D V+ A K M V ++++ + I GI+T +D L +++ Q S + T V + Sbjct: 238 SASDPVFVASKKMRDLRVNSVIIAVGNK---IHGILTSKDILMRVVAQNLSPELTLVEKV 294 Query: 394 MTEENKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTG 507 MT + ++ ET +L A+ +M D + H+PV D+ G Sbjct: 295 MTPNPECASI--ETTILDALHIMHDGKFLHLPVFDKDG 330 >At3g52950.1 putative protein / predicted protein, Arabidopsis thaliana Length = 556 Score = 57.0 bits (136), Expect = 1e-08 Identities = 31/101 (30%), Positives = 56/101 (54%) Frame = +1 Query: 226 TVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDIMTEE 405 TV+DA + M V A ++ S + ++GI+T++D ++I +G T V +MT Sbjct: 80 TVFDACRRMAARRVDACLLTDS--SALLSGIVTDKDVATRVIAEGLRPDQTLVSKVMTRN 137 Query: 406 NKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTGMIGMVSI 528 I VT ++ L+A+Q M + RH+PV++ +I ++ I Sbjct: 138 P--IFVTSDSLALEALQKMVQGKFRHLPVVENGEVIALLDI 176 Score = 51.6 bits (122), Expect = 5e-07 Identities = 32/95 (33%), Positives = 53/95 (55%) Frame = +1 Query: 223 DTVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDIMTE 402 D V A K M V ++++ S NK I+GI+T +D L +++ Q S + T V +MT Sbjct: 248 DPVSVAAKRMRDLRVNSVII--STGNK-ISGILTSKDILMRVVAQNLSPELTLVEKVMTP 304 Query: 403 ENKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTG 507 + ++ ET +L A+ M D + H+P+ID+ G Sbjct: 305 NPECASL--ETTILDALHTMHDGKFLHLPIIDKDG 337 >At5g50640.1 putative protein / strong similarity to unknown protein (emb CAB86899.1) Length = 548 Score = 55.8 bits (133), Expect = 3e-08 Identities = 34/128 (26%), Positives = 67/128 (51%), Gaps = 3/128 (2%) Frame = +1 Query: 226 TVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDIMTEE 405 T+++A + M V AL++ S N + GI+T+RD K+I + + + T V +MT+ Sbjct: 79 TLFEACRRMAARRVDALLLTDS--NALLCGILTDRDIATKVIAKQLNLEETPVSKVMTKN 136 Query: 406 NKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTGMIGMVSIGDVVRAVVGEHR---EELK 576 + V +T ++A+Q M + RH+PV++ +I ++ I + + E+ K Sbjct: 137 P--VFVLSDTIAVEALQKMVQGKFRHLPVVENGEVIALLDIAKCLYDAIARMERSVEKGK 194 Query: 577 RLNAFIQG 600 + A ++G Sbjct: 195 AIAAAVEG 202 Score = 52.0 bits (123), Expect = 4e-07 Identities = 31/112 (27%), Positives = 61/112 (53%), Gaps = 1/112 (0%) Frame = +1 Query: 220 DDTVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDIMT 399 D+TV M + A +V+ ENK + GI+T +D L ++I Q ++T V +MT Sbjct: 246 DETVLGVTMKMVEYQSSAAMVMV--ENK-LVGILTSKDILMRVISQNLPQETTTVEKVMT 302 Query: 400 EENKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTG-MIGMVSIGDVVRAVV 552 + TV + +++A+ +M + + H+PV+D+ G ++ ++ + + A V Sbjct: 303 PNPESATV--DMAIVEALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITHAAV 352 >At5g50530.1 putative protein / strong similarity to unknown protein (emb|CAB86899.1) Length = 548 Score = 55.8 bits (133), Expect = 3e-08 Identities = 34/128 (26%), Positives = 67/128 (51%), Gaps = 3/128 (2%) Frame = +1 Query: 226 TVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDIMTEE 405 T+++A + M V AL++ S N + GI+T+RD K+I + + + T V +MT+ Sbjct: 79 TLFEACRRMAARRVDALLLTDS--NALLCGILTDRDIATKVIAKQLNLEETPVSKVMTKN 136 Query: 406 NKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTGMIGMVSIGDVVRAVVGEHR---EELK 576 + V +T ++A+Q M + RH+PV++ +I ++ I + + E+ K Sbjct: 137 P--VFVLSDTIAVEALQKMVQGKFRHLPVVENGEVIALLDIAKCLYDAIARMERSVEKGK 194 Query: 577 RLNAFIQG 600 + A ++G Sbjct: 195 AIAAAVEG 202 Score = 52.0 bits (123), Expect = 4e-07 Identities = 31/112 (27%), Positives = 61/112 (53%), Gaps = 1/112 (0%) Frame = +1 Query: 220 DDTVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDIMT 399 D+TV M + A +V+ ENK + GI+T +D L ++I Q ++T V +MT Sbjct: 246 DETVLGVTMKMVEYQSSAAMVMV--ENK-LVGILTSKDILMRVISQNLPQETTTVEKVMT 302 Query: 400 EENKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTG-MIGMVSIGDVVRAVV 552 + TV + +++A+ +M + + H+PV+D+ G ++ ++ + + A V Sbjct: 303 PNPESATV--DMAIVEALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITHAAV 352 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,192,847 Number of Sequences: 27288 Number of extensions: 392835 Number of successful extensions: 1143 Number of sequences better than 1.0e-05: 12 Number of HSP's better than 0.0 without gapping: 1087 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1133 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1547415100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260163|gb|BM408533.1|BM408533 EST582860 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG45A1 5' end, mRNA sequence (778 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g02500.1 putative sugar nucleotide phosphorylase / ; supp... 263 7e-71 >At2g02500.1 putative sugar nucleotide phosphorylase / ; supported by cDNA: gi_12697582_dbj_AB037876.1_AB037876 Length = 302 Score = 263 bits (671), Expect(2) = 7e-71 Identities = 135/188 (71%), Positives = 153/188 (80%), Gaps = 2/188 (1%) Frame = +3 Query: 186 LFKISCSSTS--ENLNXXXXXXXXXXXXXXXILLAGGKGKRMGASMPKQYLPLLGQPIAL 359 L I CSS++ +N N ILLAGG+GKRM SMPKQY+PLLGQPIAL Sbjct: 56 LLSIKCSSSTGFDNSNVVVKEKSVSV-----ILLAGGQGKRMKMSMPKQYIPLLGQPIAL 110 Query: 360 YSFYTFSKMPQVKEIIVVCDPSYQDIFEDAKEYIQVDLKFALPGKERQDSVYSGLQEVDS 539 YSF+TFS+MP+VKEI+VVCDP ++DIFE+ +E I VDL+FA+PGKERQDSVYSGLQE+D Sbjct: 111 YSFFTFSRMPEVKEIVVVCDPFFRDIFEEYEESIDVDLRFAIPGKERQDSVYSGLQEIDV 170 Query: 540 NSKLACIHDSARPLVQIEDVEKVLKDGWLVGAAVLGVPAKATIKEANSESFVVKTLDRKT 719 NS+L CIHDSARPLV EDVEKVLKDG VGAAVLGVPAKATIKE NS+S VVKTLDRKT Sbjct: 171 NSELVCIHDSARPLVNTEDVEKVLKDGSAVGAAVLGVPAKATIKEVNSDSLVVKTLDRKT 230 Query: 720 LWEMQTPQ 743 LWEMQTPQ Sbjct: 231 LWEMQTPQ 238 Score = 22.7 bits (47), Expect(2) = 7e-71 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +1 Query: 745 EGLESTDDVSI 777 EGLE TDDVSI Sbjct: 255 EGLEVTDDVSI 265 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,161,043 Number of Sequences: 27288 Number of extensions: 416690 Number of successful extensions: 1369 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1242 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1369 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1428015260 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250493|gb|BI936021.1|BI936021 EST555910 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD24P23 5' end, mRNA sequence (455 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g06950.1 chloroplast inner envelope protein, putative / si... 200 3e-52 >At1g06950.1 chloroplast inner envelope protein, putative / similar to chloroplast inner envelope protein GB:CAA92823 GI:1495768 from [Pisum sativum]; supported by cDNA: gi_20453113 Length = 1016 Score = 200 bits (508), Expect = 3e-52 Identities = 96/151 (63%), Positives = 129/151 (84%) Frame = +2 Query: 2 LREAQLAYRLSDELAHEMLKEHARKLVEEIISTAVGILKSRTRATREPTRVIEELDKVLS 181 LR++QL+++LSDELA ++ +EH RK+V E IS+A+ ILKSRTRA + V+EEL+KVL Sbjct: 324 LRKSQLSFKLSDELAEDLFREHTRKVVVENISSALSILKSRTRAAKSLASVVEELEKVLE 383 Query: 182 YNNLLISLKNHADASRFAPGIGPVSLVGGEYDGDRKMDDLKLLYRAYVTDSLSSGRMEED 361 +NNLL+SLK+H++A +FA G+GP+SL+G E D +R+MDDLKLLYRAYVTD+LS GR+EE+ Sbjct: 384 FNNLLVSLKSHSEADQFARGVGPISLIGDESDFERRMDDLKLLYRAYVTDALSGGRLEEN 443 Query: 362 KLAALNQLRNIFGLGKREADTITLDVTSKVY 454 KL A++QLRNI GLGKREA+ I++DVTSK Y Sbjct: 444 KLVAMSQLRNILGLGKREAEAISVDVTSKSY 474 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,511,103 Number of Sequences: 27288 Number of extensions: 185727 Number of successful extensions: 579 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 552701236 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250467|gb|BI935995.1|BI935995 EST555884 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD24L13 5' end, mRNA sequence (576 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g06760.1 late embryogenesis abundant protein LEA like / ;... 66 1e-11 >At5g06760.1 late embryogenesis abundant protein LEA like / ; supported by cDNA: gi_15293004_gb_AY050936.1_ Length = 158 Score = 65.9 bits (159), Expect = 1e-11 Identities = 32/71 (45%), Positives = 45/71 (63%) Frame = +1 Query: 49 MEAAKQTAANVAASAKSGMXXXXXXXXXXXXXXXXSDPVQRQMATEKKEQRIHQAEMDKL 228 M++ K+TA+N+AASAKSGM DPVQ+QMAT+ KE +I+QAEM K Sbjct: 1 MQSMKETASNIAASAKSGMDKTKATLEEKAEKMKTRDPVQKQMATQVKEDKINQAEMQKR 60 Query: 229 AAKEQNAASRQ 261 ++ NAA ++ Sbjct: 61 ETRQHNAAMKE 71 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,582,796 Number of Sequences: 27288 Number of extensions: 116934 Number of successful extensions: 334 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 334 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 868297828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250392|gb|BI935920.1|BI935920 EST555809 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD24M12 5' end, mRNA sequence (699 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g37360.1 putative protein / ; supported by cDNA: gi_16604... 176 1e-44 >At5g37360.1 putative protein / ; supported by cDNA: gi_16604481 Length = 309 Score = 176 bits (446), Expect = 1e-44 Identities = 106/205 (51%), Positives = 127/205 (61%), Gaps = 16/205 (7%) Frame = +3 Query: 3 FDLSNGPVKVECGEEVGETLLNISRAWEMADTSTSTALVDKLPLLVGSLTGSQKSVSIWK 182 FDLSNGPV ECG+E+GETLLN+SRAWE ADTSTS +LV+KLP L LT +S + K Sbjct: 106 FDLSNGPVIDECGQELGETLLNLSRAWEQADTSTSRSLVEKLPELEILLTDGARS-AFGK 164 Query: 183 ALVISWKKVPVHG---------------TIWRR*SAEVSGVDVE-EFKQQTRMFKFGDLQ 314 L+ + K+ G T SA+ S V V E K TRMFKFG+LQ Sbjct: 165 RLISAGKRFQGMGQYAKGELQKIAKAMITTGGVLSAKTSSVSVSNESKSGTRMFKFGELQ 224 Query: 315 VELTSGKAYTGAAIAFIFSFLSWELGQGIQSIPESSLQYANDNXXXXXXXXXXXXXVMSY 494 V +T KAYTGAAIAFI+ LSW++ QGIQSIPE+SLQYANDN + Y Sbjct: 225 VAVTPEKAYTGAAIAFIYGILSWQISQGIQSIPENSLQYANDNALLIGKSLRGSLLALFY 284 Query: 495 SSTVLAAFAMVGLILLGGQLKSENK 569 +STVL+ F GLILL QL SE + Sbjct: 285 ASTVLSGFTTAGLILLAKQLSSEKE 309 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,648,498 Number of Sequences: 27288 Number of extensions: 330560 Number of successful extensions: 1056 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1028 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1053 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1209984928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250384|gb|BI935912.1|BI935912 EST555801 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD24K20 5' end, mRNA sequence (754 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g75340.1 expressed protein / ; supported by cDNA: gi_14335... 129 1e-30 >At1g75340.1 expressed protein / ; supported by cDNA: gi_14335031_gb_AY037195.1_ Length = 321 Score = 129 bits (325), Expect = 1e-30 Identities = 62/94 (65%), Positives = 73/94 (76%) Frame = +1 Query: 139 EDFNNEKPLWLLTCYGHRKNGPCDITGDVSYEELRAVAYDDAKRGQSLMSIVERERSQVN 318 +DF NE+P+W LTCYGH K PCD+TGD+SYEELRAVAY++AKRG L SIVERER+ N Sbjct: 3 DDFKNERPMWKLTCYGHWKYFPCDVTGDISYEELRAVAYEEAKRGIPLQSIVERERNLQN 62 Query: 319 SKVAEFENLLQNPYASSSTSALNAQSPFPGATPS 420 SK+AEFEN L+NPY S T+ QSPF TPS Sbjct: 63 SKIAEFENFLRNPYKGSVTA---NQSPFAATTPS 93 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.131 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,916,243 Number of Sequences: 27288 Number of extensions: 258790 Number of successful extensions: 778 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 778 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1357057980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250370|gb|BI935898.1|BI935898 EST555787 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD24I10 5' end, mRNA sequence (739 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05010.1 coatomer delta subunit (delta-coat protein) (delta-C... 323 8e-89 At5g40855.1 hypothetical protein / 50 2e-06 >At5g05010.1 coatomer delta subunit (delta-coat protein) (delta-COP) / ; supported by cDNA: gi_15450768_gb_AY054464.1_ Length = 527 Score = 323 bits (827), Expect = 8e-89 Identities = 169/239 (70%), Positives = 194/239 (80%), Gaps = 2/239 (0%) Frame = +3 Query: 24 MVVLAASIISKSGKALVSRQFVDMSRIRIEGYLAAFPKLVGIGKQHTYIETENVRYVYQP 203 MVVLAA+I+ KSGK +VSR +VDMSRIRIEG LAAFPKLVG+GKQHTYIETENVRYVYQP Sbjct: 1 MVVLAAAIVVKSGKVIVSRHYVDMSRIRIEGLLAAFPKLVGMGKQHTYIETENVRYVYQP 60 Query: 204 IESLYLLLVTNKQSNILEDLETLRLLSKLVPEYSYSLDEEGIGRTAFELIFAFDEVISLG 383 IE+L+LLLVT KQSNILEDL TL LLSKLVPEYS SLDEEGI R +FELIFAFDEVISLG Sbjct: 61 IEALFLLLVTTKQSNILEDLATLTLLSKLVPEYSMSLDEEGISRASFELIFAFDEVISLG 120 Query: 384 HKENVTVTQVKQYCEMESHEERLHKLVLQNKINETKDVMKRKASEIDKSKIERNRGDKGG 563 HKE+VTV QVKQYCEMESHEE+LHKLV+Q+KIN+TKDVMKRKA+EIDKSKIE+N+ GG Sbjct: 121 HKESVTVAQVKQYCEMESHEEKLHKLVMQSKINDTKDVMKRKANEIDKSKIEKNK--PGG 178 Query: 564 FMSLQSMSSGKIDTGF--XXXXXXXXXXXXXXXXFALPPDVDTFSTKSRGSSAASATAP 734 F S+ SM SG++++GF F + DVD +TK + S +S TAP Sbjct: 179 FSSMGSMGSGRLESGFNELSISSGGGGGYGSGSGFGMISDVDPINTKPKDRSRSSVTAP 237 >At5g40855.1 hypothetical protein / Length = 78 Score = 49.7 bits (117), Expect = 2e-06 Identities = 23/39 (58%), Positives = 28/39 (70%) Frame = -3 Query: 446 LLVTLHFTVLLDLCNCNIFLVPKRDHFIKCKNKLKSRPA 330 L+ LHFT+LL L C+ FLVPKR +KCK +LKS PA Sbjct: 26 LMQLLHFTILLHLDTCHTFLVPKRYDLVKCKYQLKSSPA 64 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,127,285 Number of Sequences: 27288 Number of extensions: 314019 Number of successful extensions: 1021 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 981 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1019 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1312709680 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250358|gb|BI935886.1|BI935886 EST555775 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD24G8 5' end, mRNA sequence (789 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g33760.1 putative aspartate--tRNA ligase / aspartate--tRNA... 186 2e-56 >At4g33760.1 putative aspartate--tRNA ligase / aspartate--tRNA ligase, Synechocystis sp., PIR2:S75048 Length = 636 Score = 186 bits (472), Expect(3) = 2e-56 Identities = 86/118 (72%), Positives = 99/118 (83%) Frame = +2 Query: 308 LQWVSRNQYCGELSEEDVGKRVRLCGWVALHRIHGGLTFVNLRDQTGIVQITTLPDDFPD 487 L+WVSR + CGELS DVGKRV LCGWVALHR+HGGLTF+NLRD TGIVQ+ TLPD+FP+ Sbjct: 70 LRWVSRTELCGELSVNDVGKRVHLCGWVALHRVHGGLTFLNLRDHTGIVQVRTLPDEFPE 129 Query: 488 AHSTVRDLRLEYVVAIEGVVRPRPAESVNKKMKTGTIEVAAEDVQVLNAVRLKLPFLV 661 AH + D+RLEYVV +EG VR RP ESVNKKMKTG +EV AE V++LN VR KLPFLV Sbjct: 130 AHGLINDMRLEYVVLVEGTVRSRPNESVNKKMKTGFVEVVAEHVEILNPVRTKLPFLV 187 Score = 46.2 bits (108), Expect(3) = 2e-56 Identities = 22/38 (57%), Positives = 28/38 (72%) Frame = +1 Query: 637 KIEVALLGKTADDAKDSSKEEIRLRYRCLDLRRPQMSS 750 + ++ L TAD+ KD KEEIRLR+RCLDLRR QM + Sbjct: 180 RTKLPFLVTTADENKDLIKEEIRLRFRCLDLRRQQMKN 217 Score = 25.4 bits (54), Expect(3) = 2e-56 Identities = 10/13 (76%), Positives = 12/13 (91%) Frame = +3 Query: 750 NIILRHRVVKLLR 788 NI+LRH VVKL+R Sbjct: 218 NIVLRHNVVKLIR 230 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,110,868 Number of Sequences: 27288 Number of extensions: 275285 Number of successful extensions: 919 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 918 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1463493900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250193|gb|BI935721.1|BI935721 EST555610 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD23F20 5' end, mRNA sequence (588 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49880.1 mitotic checkpoint protein-like / 152 1e-37 >At5g49880.1 mitotic checkpoint protein-like / Length = 726 Score = 152 bits (384), Expect = 1e-37 Identities = 87/163 (53%), Positives = 111/163 (67%), Gaps = 6/163 (3%) Frame = +1 Query: 37 MILRTPPFKR---KAQSNQPEDGSPSSGNQQLVIFEDT---XXXXXXXXXXXXXXQMLCT 198 MILRTP KR A + G+ SGNQ L+I+ED+ Q LCT Sbjct: 1 MILRTPQPKRLRSDAGESPFPTGATGSGNQ-LIIYEDSPLPAPAPLQTSHDHSADQHLCT 59 Query: 199 YQCRQMVKSEFFDALSSAEKQARDNQSKLEALNNDYLKADAERKKFRDQFLNAEQELAAA 378 YQCRQMVK++ DALS+AEKQ ++++KL+ LN ++ +ADAERK FRD+FL +EQELAAA Sbjct: 60 YQCRQMVKADVLDALSTAEKQVEESKTKLQTLNANFTEADAERKHFRDKFLYSEQELAAA 119 Query: 379 KGREEALQDQLMKEVNVSHERLRKQLQLYNELEVKFQNEMNLR 507 K RE+ LQ+QL+ E+N S ER K+LQ +ELEVK QNEMNLR Sbjct: 120 KAREKMLQEQLLMEINNSQERYTKELQSCHELEVKLQNEMNLR 162 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.314 0.127 0.345 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,152,188 Number of Sequences: 27288 Number of extensions: 160541 Number of successful extensions: 448 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 448 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 904103924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250095|gb|BI935623.1|BI935623 EST555512 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD23B17 5' end, mRNA sequence (682 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g13540.1 putative cap-binding protein / ; supported by cD... 273 2e-73 >At2g13540.1 putative cap-binding protein / ; supported by cDNA: gi_15192737_gb_AF272891.1_AF272891 Length = 848 Score = 273 bits (697), Expect(2) = 2e-73 Identities = 128/193 (66%), Positives = 165/193 (85%), Gaps = 1/193 (0%) Frame = +3 Query: 3 ALEELLPPRGGPQFKYSAEDGTDPTE-RALSLELKDMVKGRKTAREMISWVEENVFPAHG 179 ALEELLPP+ GP F YS E+G + TE + LS EL VK ++TAR+MI W+EE ++P HG Sbjct: 471 ALEELLPPKAGPNFMYSLEEGKEKTEEQQLSAELSRKVKEKQTARDMIVWIEETIYPVHG 530 Query: 180 FDITLGVVVQTLLDIGSKSFTHLITVLERYGQVIAKMCTDDDQQVKLITEVSSYWQNSAQ 359 F++TL +VVQTLLDIGSKSFTHL+TVLERYGQV +K+C D+D+QV L+++VS+YW+N+ Q Sbjct: 531 FEVTLTIVVQTLLDIGSKSFTHLVTVLERYGQVFSKLCPDNDKQVMLLSQVSTYWKNNVQ 590 Query: 360 MTAIAIDRMMSYRLISNLAIVRWVFSPLNLDRFHVSDSSWEILRNAVSKTYNRISDLRKE 539 MTA+AIDRMM YRL+SN AIVRWVFSP N+D+FHVSD WEIL NA++KTYNRISDLRK+ Sbjct: 591 MTAVAIDRMMGYRLVSNQAIVRWVFSPENVDQFHVSDQPWEILGNALNKTYNRISDLRKD 650 Query: 540 ISSLERSVVLAEK 578 IS++ ++V++AEK Sbjct: 651 ISNITKNVLVAEK 663 Score = 21.2 bits (43), Expect(2) = 2e-73 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = +2 Query: 629 VIDGEPVLGE 658 +++GEPVLGE Sbjct: 681 LVEGEPVLGE 690 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,978,239 Number of Sequences: 27288 Number of extensions: 319232 Number of successful extensions: 893 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 865 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 892 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1156603240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250080|gb|BI935608.1|BI935608 EST555497 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD23M22 5' end, mRNA sequence (786 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g50590.1 hypothetical protein / 320 1e-89 >At3g50590.1 hypothetical protein / Length = 690 Score = 320 bits (819), Expect(2) = 1e-89 Identities = 156/185 (84%), Positives = 171/185 (92%), Gaps = 1/185 (0%) Frame = +3 Query: 201 MEWATLQHLDLRHVGRS-SKSLQPHAAAFHPTQALLAVAVGSQIIEFDAYTGSKIASIDI 377 MEWAT+QHLDLRHVGR SK LQPH AAFHP+QA++AVAVGS I+EFDA TG KIASIDI Sbjct: 30 MEWATVQHLDLRHVGRGVSKPLQPHTAAFHPSQAVIAVAVGSHIMEFDALTGCKIASIDI 89 Query: 378 GSPVVRMAYSPTSGHCVIAILEDCTMRSCDFDAEQTCVLHSPEKRTERISSDTEVHLALT 557 GSP VRM YSPTS + V+AILEDCT+RSCDF+ EQTCVLHSPEKR+E ISSDTEVHLA+T Sbjct: 90 GSPAVRMLYSPTSSNAVVAILEDCTIRSCDFETEQTCVLHSPEKRSEHISSDTEVHLAVT 149 Query: 558 PLQPVVFFGFHRKMSVTVVGTVEGGKAPTKIKTDLKKPIVNLACHPRLPVLYVAYAEGLI 737 PLQPVVFFGF ++MSVTVVGTVEGG+APTKIKTDLKKPIVN+ACHPRLPVLYVAYAEGLI Sbjct: 150 PLQPVVFFGFPKRMSVTVVGTVEGGRAPTKIKTDLKKPIVNIACHPRLPVLYVAYAEGLI 209 Query: 738 RAYNI 752 RAYNI Sbjct: 210 RAYNI 214 Score = 28.1 bits (61), Expect(2) = 1e-89 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 752 HTYAVHYTLQL 784 HTYAVHYTLQL Sbjct: 215 HTYAVHYTLQL 225 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,705,532 Number of Sequences: 27288 Number of extensions: 360805 Number of successful extensions: 1055 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1034 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1054 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250036|gb|BI935564.1|BI935564 EST555453 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD23C24 5' end, mRNA sequence (696 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24840.1 brefeldin A-sensitive Golgi protein - like / bref... 261 2e-70 >At4g24840.1 brefeldin A-sensitive Golgi protein - like / brefeldin A-sensitive Golgi protein LDLC, Homo sapiens, PIR2:A53542; supported by cDNA: gi_13605802_gb_AF367300.1_AF367300 Length = 756 Score = 261 bits (668), Expect = 2e-70 Identities = 141/227 (62%), Positives = 163/227 (71%), Gaps = 19/227 (8%) Frame = +3 Query: 69 RSATDLFGDPTDPNPPQWLNPTLFQSQDFDPESYISDLRTFVPLETLRSELRSHFTSLQR 248 RSATD F DP D +P W P+LF S +FD ESYIS+LRTFVP +TLRSELRSH SL R Sbjct: 16 RSATDFFSDPYDSHP-LWFKPSLFLSPNFDSESYISELRTFVPFDTLRSELRSHLASLNR 74 Query: 249 DLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLFEIREKIDGFRNAVEGSLAALQNRLK 428 +LVDLINRDYADFV+LSTKL D+DAAVVRMRAPL E+REKI GFR +VE +L AL+N L+ Sbjct: 75 ELVDLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITGFRGSVEAALFALRNGLQ 134 Query: 429 QXXXXXXXXXXXXXXXXTFHVVSKVEKLIKELPSGQTDY-------------------VE 551 Q TFHVVSKVEKLIK LPS +D+ + Sbjct: 135 QRSDAAAAREVLELLLDTFHVVSKVEKLIKVLPSTPSDWQNEDANSMGRSSMNDENSTQQ 194 Query: 552 SGSNLRETQSMLLERIASEMNRLKFYISHAQNMPFIENMEKEIQNAS 692 G+ +RETQSMLLERIASEMNRLKFY++HAQN+PFIENMEK IQ+AS Sbjct: 195 DGTTMRETQSMLLERIASEMNRLKFYMAHAQNLPFIENMEKRIQSAS 241 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,176,511 Number of Sequences: 27288 Number of extensions: 223599 Number of successful extensions: 814 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 809 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1201087980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250030|gb|BI935558.1|BI935558 EST555447 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD23C12 5' end, mRNA sequence (756 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03380.1 DegP protease / contains similarity to degP GI:26... 327 e-100 >At3g03380.1 DegP protease / contains similarity to degP GI:2623992 from [Bradyrhizobium japonicum] Length = 627 Score = 327 bits (838), Expect(2) = e-100 Identities = 161/209 (77%), Positives = 180/209 (86%) Frame = +3 Query: 3 REEIPVYPIYRDPVHDFGFFRYDPGAIQFLSYEEIPLAPDAASVGVEIRVVGNDSGEKVS 182 REEIP+YP+YRDPVHDFGFF YDP A+QFL+Y+EIPLAP+AASVG+EIRVVGNDSGEKVS Sbjct: 94 REEIPIYPVYRDPVHDFGFFCYDPSAVQFLTYQEIPLAPEAASVGLEIRVVGNDSGEKVS 153 Query: 183 ILAGTLARLDRDAPQYKKDGYNDFNTFYMQAAXXXXXXXXXXPVIDWQGRAVALNAGSKL 362 ILAGTLARLDRDAP YKKDGYNDFNTFYMQAA PVIDWQGRAVALNAGSK Sbjct: 154 ILAGTLARLDRDAPHYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKS 213 Query: 363 SSASAFFLPLERVVRSLKFLQEGGYHSTNTWAAVTIPRGTLQVTFLHKGFDETRRLGVQR 542 SSASAFFLPL+RVVR+L FLQ+ T+ AV IPRGTLQ+TFLHKGFDE RRLG++ Sbjct: 214 SSASAFFLPLQRVVRALSFLQKSIDSRTDKPKAVHIPRGTLQMTFLHKGFDEIRRLGLRS 273 Query: 543 ETEQLVRNSTPPSETGMLVIDSVVPGGPA 629 ETEQ+VR+++P ETGMLV+DSVVP GPA Sbjct: 274 ETEQVVRHASPTGETGMLVVDSVVPSGPA 302 Score = 56.6 bits (135), Expect(2) = e-100 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +2 Query: 623 PGSYQLEPGDVLVRMNGEIVTQFLKMETLLDDSGEQKIELSIER 754 P LEPGDVLVR+NG ++TQFL +E LLDD Q +EL IER Sbjct: 301 PADKHLEPGDVLVRVNGTVLTQFLNLENLLDDGVGQILELEIER 344 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,527,654 Number of Sequences: 27288 Number of extensions: 358521 Number of successful extensions: 864 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 835 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 861 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250029|gb|BI935557.1|BI935557 EST555446 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD23C8 5' end, mRNA sequence (774 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13630.1 cobalamin biosynthesis protein / ; supported by c... 459 e-130 >At5g13630.1 cobalamin biosynthesis protein / ; supported by cDNA: gi_17978957 Length = 1381 Score = 459 bits (1181), Expect = e-130 Identities = 228/257 (88%), Positives = 245/257 (94%) Frame = +2 Query: 2 AKIVVERLLERQKIDNGGKYPETVALVLWGTDNIKTYGESLAQVMWMIGVRPVADTLGRV 181 AKIVVERL+ERQK++N GKYPET+ALVLWGTDNIKTYGESL QV+WMIGVRP+ADT GRV Sbjct: 1005 AKIVVERLVERQKLENEGKYPETIALVLWGTDNIKTYGESLGQVLWMIGVRPIADTFGRV 1064 Query: 182 NRVEPVSLEELGRPRVDVVVNCSGVFRDLFINQMNLLDRGIKMVAELDEPEDQNFVRKHA 361 NRVEPVSLEELGRPR+DVVVNCSGVFRDLFINQMNLLDR IKMVAELDEP +QNFVRKHA Sbjct: 1065 NRVEPVSLEELGRPRIDVVVNCSGVFRDLFINQMNLLDRAIKMVAELDEPVEQNFVRKHA 1124 Query: 362 LEQAKTLGIDVREAATRVFSNASGSYSSNINLAVENSSWNDEKQLQDMYLSRKSFAFDCD 541 LEQA+ LGID+REAATRVFSNASGSYS+NI+LAVENSSWNDEKQLQDMYLSRKSFAFD D Sbjct: 1125 LEQAEALGIDIREAATRVFSNASGSYSANISLAVENSSWNDEKQLQDMYLSRKSFAFDSD 1184 Query: 542 APGAGMMEKRKVFEMALSTADATFQNLDSSEISLTDVSHYFDSDPTNLVQNLRKDGKKPS 721 APGAGM EK++VFEMALSTA+ TFQNLDSSEISLTDVSHYFDSDPTNLVQ+LRKD KKPS Sbjct: 1185 APGAGMAEKKQVFEMALSTAEVTFQNLDSSEISLTDVSHYFDSDPTNLVQSLRKDKKKPS 1244 Query: 722 AYIADTTTGYAQVRTLS 772 +YIADTTT AQVRTLS Sbjct: 1245 SYIADTTTANAQVRTLS 1261 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,775,505 Number of Sequences: 27288 Number of extensions: 323351 Number of successful extensions: 1045 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1044 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250003|gb|BI935531.1|BI935531 EST555420 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD23M19 5' end, mRNA sequence (774 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g48470.1 hypothetical protein / predicted by genemarkHMM 123 5e-45 >At3g48470.1 hypothetical protein / predicted by genemarkHMM Length = 1035 Score = 123 bits (309), Expect(2) = 5e-45 Identities = 59/82 (71%), Positives = 68/82 (81%) Frame = +2 Query: 2 ITAALGLCLEKMSKEDLDATKDAMHCILEGVSCRLGSTDHLIRKMASSVALAFSKVIDPQ 181 ITAALGLCLE MS+E+LD TKD MH IL+GVSCRL + L+RKMASS+A FSKVIDP+ Sbjct: 438 ITAALGLCLENMSREELDRTKDVMHSILQGVSCRLENPGDLVRKMASSIAFMFSKVIDPK 497 Query: 182 NPLYLDDSCREEAIDWDFGLLT 247 NPLYLDDS + AIDW+FGL T Sbjct: 498 NPLYLDDSITDNAIDWEFGLQT 519 Score = 75.5 bits (184), Expect(2) = 5e-45 Identities = 41/99 (41%), Positives = 58/99 (58%), Gaps = 2/99 (2%) Frame = +3 Query: 321 KVNIAASRHDNKMTKKKK-LFGYEAVDPDEIIDPASLNNEVDSSKXXXXXXXXXXXXXXX 497 +VN ++ R+ K +K K + + DP+EI+D A+LN + +S K Sbjct: 541 EVNESSRRNKQKENRKSKNISAFVLADPNEIVDLATLNCDTESDKDDGDDDASVSSDNSS 600 Query: 498 -XXLQPYDLSDDGADLKRNFSQLVDVIGALRKSDDADGV 611 L+PYDL DD DL + F+ LVDV+GALRK+DDADGV Sbjct: 601 VTSLEPYDLMDDDKDLGKQFTHLVDVVGALRKTDDADGV 639 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,162,850 Number of Sequences: 27288 Number of extensions: 307873 Number of successful extensions: 808 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 807 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249899|gb|BI935427.1|BI935427 EST555316 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD22J10 5' end, mRNA sequence (496 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g10370.1 putative glycerol-3-phosphate dehydrogenase / sim... 287 2e-78 >At3g10370.1 putative glycerol-3-phosphate dehydrogenase / similar to glycerol-3-phosphate dehydrogenase GB:BAA08926 [Mus musculus]; supported by cDNA: gi_17380777 Length = 629 Score = 287 bits (735), Expect = 2e-78 Identities = 137/164 (83%), Positives = 145/164 (87%) Frame = +3 Query: 3 PLDILXXXXXXXXXXXXLDAATRGLRVGLVEREDFASGTSSRSTKLIHGGVRYLEKAVFN 182 PLD+L LDA TRGLRVGLVEREDF+SGTSSRSTKLIHGGVRYLEKAVFN Sbjct: 73 PLDVLVIGGGATGSGVALDAVTRGLRVGLVEREDFSSGTSSRSTKLIHGGVRYLEKAVFN 132 Query: 183 LDYGQLKLVFHALEERKQLIENAPHLCHALPCMTPCFDWFDAIYYWAGLKMYDLVAGRHL 362 LDYGQLKLVFHALEERKQLIENAPHLCHALPCMTPCFDWF+ IY+W GLKMYDLVAG L Sbjct: 133 LDYGQLKLVFHALEERKQLIENAPHLCHALPCMTPCFDWFEVIYFWMGLKMYDLVAGPRL 192 Query: 363 LHLSRYYSAQESVELFPTLARNGKDKTLKGTVVYYDGQMNDSRV 494 LHLSRYYSA+ES+ELFPTLAR GKDK L+GTVVYYDGQMNDSR+ Sbjct: 193 LHLSRYYSAKESIELFPTLARKGKDKNLRGTVVYYDGQMNDSRL 236 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,576,224 Number of Sequences: 27288 Number of extensions: 182682 Number of successful extensions: 364 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 364 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 648439200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249878|gb|BI935406.1|BI935406 EST555295 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD22F10 5' end, mRNA sequence (676 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g23940.1 dihydroxyacid dehydratase, putative / similar to ... 238 e-101 >At3g23940.1 dihydroxyacid dehydratase, putative / similar to dihydroxyacid dehydratase GB:CAA60939 [Saccharomyces cerevisiae]; supported by cDNA: gi_14532593_gb_AY039921.1_ Length = 608 Score = 238 bits (608), Expect(2) = e-101 Identities = 122/138 (88%), Positives = 129/138 (93%) Frame = +3 Query: 261 LLELLKMDLKPRDIITKKSLRNAMVVVMALGGSTNAVLHLIAIARSVGLELTLDDFQKVS 440 LLELLKMDLKPRDIIT KSLRNAMV VMALGGSTNAVLHLIAIARSVGLELTLDDFQKVS Sbjct: 289 LLELLKMDLKPRDIITPKSLRNAMVSVMALGGSTNAVLHLIAIARSVGLELTLDDFQKVS 348 Query: 441 DEVPFLADLKPSGKYVMEDVHKIGGTPAVIRHLLELGYMDGDCMTVTGKTLAENAKLFPS 620 D VPFLADLKPSGKYVMED+HKIGGTPAV+R+LLELG MDGDCMTVTG+TLA+N + PS Sbjct: 349 DAVPFLADLKPSGKYVMEDIHKIGGTPAVLRYLLELGLMDGDCMTVTGQTLAQNLENVPS 408 Query: 621 LAEGQQIIRPLSNPI*ET 674 L EGQ+IIRPLSNPI ET Sbjct: 409 LTEGQEIIRPLSNPIKET 426 Score = 149 bits (375), Expect(2) = e-101 Identities = 71/85 (83%), Positives = 77/85 (90%) Frame = +1 Query: 1 HFQGHTFDIVSAFQVYGEYVSGAVSDEQRMNVVRNSCPGAGACGGMYTANTMASAIEAMG 180 HFQ T+DIVSAFQ YGE+VSG++SDEQR V+ +SCPGAGACGGMYTANTMASAIEAMG Sbjct: 203 HFQDKTYDIVSAFQSYGEFVSGSISDEQRKTVLHHSCPGAGACGGMYTANTMASAIEAMG 262 Query: 181 MSLPYSSSTPAEDSLKLDECRLAGK 255 MSLPYSSS PAED LKLDECRLAGK Sbjct: 263 MSLPYSSSIPAEDPLKLDECRLAGK 287 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,925,590 Number of Sequences: 27288 Number of extensions: 364679 Number of successful extensions: 1026 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 991 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1026 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1138809344 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249779|gb|BI935307.1|BI935307 EST555196 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD22O22 5' end, mRNA sequence (789 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59630.1 putative protein / diphthamide synthesis protein ... 310 7e-85 At5g62030.1 putative protein / predicted proteins, D.melanoga... 56 3e-08 >At3g59630.1 putative protein / diphthamide synthesis protein DPH2 - Saccharomyces cerevisiae, PIR:S34679; supported by cDNA: gi_19715608 Length = 491 Score = 310 bits (793), Expect = 7e-85 Identities = 151/264 (57%), Positives = 195/264 (73%), Gaps = 2/264 (0%) Frame = +3 Query: 3 ASHANADCVIHYGHTCFSPTSTLPAFLVLGKASLNVPLCAQTLCKYTIKAGKPILVLYGL 182 A H +++CV+HYG TC SPTS LPAF V GKAS+NV C + L Y K+ KPI++LYGL Sbjct: 77 ALHIDSECVVHYGQTCLSPTSVLPAFFVFGKASINVSSCVKHLIDYASKSDKPIMILYGL 136 Query: 183 EYTHTITEIKASVG-AQVCSELEVHYADIISPIITPPETFSSMNEQPE-LSDGQCANGCS 356 EY H I +I+ +G ++ S+L V A+++ I+P + E P S+ ++ S Sbjct: 137 EYAHVIPQIREELGLSKTDSQLSV--ANVLCSFISPSKDPRESMEHPRPYSESDSSDSLS 194 Query: 357 IEVNDAIYCVGGLTWSLPVGHRIEDYLIFYVGSDDPAFANILMTYNACEIVRYDATEDKL 536 + Y +GGLTW LP G +IEDYL+F++GSD AFAN+++T+N C+IVRYDA ED L Sbjct: 195 ---SSRSYRLGGLTWDLPEGSKIEDYLLFWIGSDSSAFANVVLTFNGCDIVRYDAEEDSL 251 Query: 537 VNEFSQQKRILKRRYFLIEKAKDASIIGILVGTLGVAGYLHMIHQMKDLITRAGKKAYTF 716 V EF QQ+RILKRRY+L+EKAKDA+IIGILVGTLGVAGYLHMIH M+ LI+ AGKK+Y Sbjct: 252 VTEFYQQRRILKRRYYLVEKAKDANIIGILVGTLGVAGYLHMIHHMQALISAAGKKSYIL 311 Query: 717 VMGRPNPAKLANFPECDIFVYVSC 788 MGRPNPAKLANFPECD+F+Y+SC Sbjct: 312 AMGRPNPAKLANFPECDVFIYISC 335 >At5g62030.1 putative protein / predicted proteins, D.melanogaster, C.elegans and yeast; supported by cDNA: gi_20259527 Length = 453 Score = 55.8 bits (133), Expect = 3e-08 Identities = 56/260 (21%), Positives = 106/260 (40%), Gaps = 3/260 (1%) Frame = +3 Query: 18 ADCVIHYGHTCFSP--TSTLPAFLVLGKASLNVPLCAQTLCKYTIKAGKPILVLYGLEYT 191 AD +IHYGH+C P ++ +P V + ++V T+ K I++ +++T Sbjct: 117 ADLLIHYGHSCLVPIDSTKIPCLYVFVEIQIDVKCLLNTIHLNLASDVKNIILAGTIQFT 176 Query: 192 HTITEIKASVGAQVCSELEVHYADIISPIITPPETFSSMNEQPELSDGQCANGCSIEVND 371 I +K ELE +++ P P LS G+ + +V Sbjct: 177 SAIRAVKP--------ELEKQGFNVLIPQSKP------------LSAGEVLGCTAPKVKT 216 Query: 372 AIYCVGGLTWSLPVGHRIEDYLIFYVGSDDPAFANILMTYNACEIVRYDATEDKLVNEFS 551 C +D ++ +V ++ + RYD KL E Sbjct: 217 VEDC--------------KDQVLVFVADGRFHLEAFMIANPKIKAFRYDPYLGKLFLEEY 262 Query: 552 QQKRILKRRYFLIEKAKDASIIGILVGTLGVAGYLHMIHQMKDLITRAGKKAYTFVMGRP 731 K + + R I +A++A GI++GTLG G ++ +++ + G + +M Sbjct: 263 DHKGMRETRMRAIARAREAKTWGIVLGTLGRQGNPKILERLEKKMMEKGIDSTVVLMSEL 322 Query: 732 NPAKLANFPE-CDIFVYVSC 788 +P ++A F + D +V ++C Sbjct: 323 SPTRVALFEDSVDAWVQIAC 342 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,382,605 Number of Sequences: 27288 Number of extensions: 388419 Number of successful extensions: 1055 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1016 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1053 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1463493900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249765|gb|BI935293.1|BI935293 EST555182 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD22M18 5' end, mRNA sequence (766 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03820.1 putative nonsense-mediated mRNA decay protein / ... 388 e-108 >At2g03820.1 putative nonsense-mediated mRNA decay protein / ; supported by cDNA: gi_15810402_gb_AY056240.1_ Length = 516 Score = 388 bits (996), Expect = e-108 Identities = 178/253 (70%), Positives = 215/253 (84%) Frame = +1 Query: 7 AMAQDTGMFTVHHTIGNVLCCKCGISMQPNAANMCANCLRSEIDITEGLQKHVIICHCPE 186 ++ ++GMF V TIG+VLCCKCG+ M PNAANMC NCLRSE+DITEGLQK + I +CPE Sbjct: 2 SVMDESGMFNVQQTIGSVLCCKCGVPMAPNAANMCVNCLRSEVDITEGLQKSIQIFYCPE 61 Query: 187 CDSYLQPPRTWIKAQLESKELLTFCVKRLKNLNKVRLVQAEFIWTEPHSKRIKVKLKVQK 366 C YLQPP+TWIK Q ESKELLTFC+KRLKNLNKV+L AEF+WTEPHSKRIKVKL VQ Sbjct: 62 CTCYLQPPKTWIKCQWESKELLTFCIKRLKNLNKVKLKNAEFVWTEPHSKRIKVKLTVQA 121 Query: 367 EVLHGAILEQAYTVEFVIQDQMCEACTRVQANPDQWIAAVQLRQHVTHRRTFFYLEQLIL 546 EVL+GA+LEQ+Y VE+ ++D +CE+C+R QANPDQW+A++QLRQHV+HRRTFFYLEQLIL Sbjct: 122 EVLNGAVLEQSYPVEYTVRDNLCESCSRFQANPDQWVASIQLRQHVSHRRTFFYLEQLIL 181 Query: 547 KHDAASRAIMIKQMDQGIDFFFSNRSHAVKFVEFIGKVVPSRSRNDKTLVSHDPQSNHYH 726 +HDAASRAI I+Q+DQGIDFFF N+SHA FVEF+ KVVP R D+ LVSHD +S+ Y+ Sbjct: 182 RHDAASRAIRIQQVDQGIDFFFGNKSHANSFVEFLRKVVPIEYRQDQQLVSHDVKSSLYN 241 Query: 727 Y*YTFSVEISPSC 765 Y YT+SV+I P C Sbjct: 242 YKYTYSVKICPVC 254 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,309,641 Number of Sequences: 27288 Number of extensions: 335773 Number of successful extensions: 856 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 835 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 856 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1392536620 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249578|gb|BI935106.1|BI935106 EST554995 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD21H18 5' end, mRNA sequence (712 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g17830.1 N-acetylornithine deacetylase-like protein, fragment... 323 1e-96 >At4g17830.1 N-acetylornithine deacetylase-like protein, fragment / N-acetylornithine deacetylase (AOdD) - Dictyostelium discoideum, PID:G763048; supported by cDNA: gi_13507560 Length = 341 Score = 323 bits (829), Expect(2) = 1e-96 Identities = 151/199 (75%), Positives = 172/199 (85%) Frame = +3 Query: 3 LVTELMKKLAETKPKLKSSVIAIFIASEENASIQGIGVDALDKDGWFDKLKEGPLFWIDT 182 LVTELMKKL + KP LKS+V+A+FIASEEN+SI G+GVD L KD DKLK GPL+WIDT Sbjct: 41 LVTELMKKLGQAKPALKSTVVAVFIASEENSSIPGVGVDMLVKDKLLDKLKSGPLYWIDT 100 Query: 183 ADKQPCIGTGGVIPWELVVTGKGFHSGLPNKAINALELGMEALKEIQTRFYRDFPPHPKE 362 ADKQPC+GTGG+IPW+L TGK FHSGL +KAINA+EL ME LKEIQ RFYRDFPPHP+E Sbjct: 101 ADKQPCVGTGGMIPWKLQFTGKLFHSGLAHKAINAMELAMEGLKEIQARFYRDFPPHPQE 160 Query: 363 VIYKFEAPSTMKPTQWFYPGGGNNQIPGECTIAGDVRLTPFYNVSDVIKKLQEYVDDLNA 542 +Y F PSTMKPTQW YP GG NQIPGECT++GDVRLTPFY+V +VI KLQEYVDD+N Sbjct: 161 EVYGFATPSTMKPTQWCYPAGGINQIPGECTVSGDVRLTPFYDVKEVITKLQEYVDDING 220 Query: 543 NIEKLDTRGPVSKYVLPDE 599 NIE+L+TRGPVSKYVLPDE Sbjct: 221 NIERLETRGPVSKYVLPDE 239 Score = 47.4 bits (111), Expect(2) = 1e-96 Identities = 21/38 (55%), Positives = 30/38 (78%) Frame = +2 Query: 599 NIRGSMSISFEEPYSGVACDLDSLGYKVLAQATERGVG 712 N+RG +++SF+E +GVAC+LDS G+ VL +ATE VG Sbjct: 240 NLRGRLTLSFDEASAGVACNLDSPGFHVLCKATEEVVG 277 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,293,732 Number of Sequences: 27288 Number of extensions: 385044 Number of successful extensions: 1226 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1223 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1245572720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249493|gb|BI935021.1|BI935021 EST554910 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD21H11 5' end, mRNA sequence (777 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g52970.1 thylakoid lumen 15.0-kDa protein / SP:Q9LVV5; sim... 289 1e-78 >At5g52970.1 thylakoid lumen 15.0-kDa protein / SP:Q9LVV5; similar to unknown protein (pir||S77462); supported by cDNA: gi_15081647_gb_AY048216.1_ Length = 223 Score = 289 bits (739), Expect = 1e-78 Identities = 142/179 (79%), Positives = 155/179 (86%) Frame = +2 Query: 158 LSKFSSKTLNFXXXXXXXXXXXXTGVGIAEGLVGVNKPELLPKEFTSVIDVAGFLSDGQE 337 +S+F SK+L+ +GVG A+ VGVNKPELLPKEFTSVIDVA FLS+GQE Sbjct: 45 VSRFRSKSLSLVFSGALALGLSLSGVGFADAKVGVNKPELLPKEFTSVIDVADFLSNGQE 104 Query: 338 KRLAQEITDIEKDTGFKLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGNILNFNV 517 KR+AQEI ++EKDTGFKLRVLAQNYP TPGLAIKDFWQVDD TIVFVADPTFGNILNFNV Sbjct: 105 KRIAQEIANLEKDTGFKLRVLAQNYPVTPGLAIKDFWQVDDSTIVFVADPTFGNILNFNV 164 Query: 518 GATVDLDIPRSFWSRLAGTYGNMFYWKEKGEDASIEAAVMAISSCLRETVGPNNCSEVK 694 GATVDLDIPRSFWSRLAG YGNMFYWKEKGEDASIEAAVMAISSCLRE VG NNC+E++ Sbjct: 165 GATVDLDIPRSFWSRLAGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGRNNCAEIQ 223 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,677,112 Number of Sequences: 27288 Number of extensions: 311448 Number of successful extensions: 1012 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 971 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1007 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1428015260 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249480|gb|BI935008.1|BI935008 EST554897 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD21D19 5' end, mRNA sequence (791 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g71820.1 expressed protein / ; supported by cDNA: gi_15028... 412 e-116 >At1g71820.1 expressed protein / ; supported by cDNA: gi_15028128_gb_AY046014.1_ Length = 752 Score = 412 bits (1060), Expect = e-116 Identities = 210/269 (78%), Positives = 236/269 (87%), Gaps = 6/269 (2%) Frame = +3 Query: 3 LVRAIRVVEMQEILDQQLXXXXXXXXXXXXMASVANPRRNAKKTT----SSKNLTQQKLK 170 LVRA+RVVEMQEILDQQL MASVANPRR KK+T SSK L QQKLK Sbjct: 205 LVRALRVVEMQEILDQQLAEEAAEAEGEGAMASVANPRRPGKKSTTTSASSKGLAQQKLK 264 Query: 171 AQGKGYKDKCYESIRKSVEARFDKLLDE--QDLKTAIEEARVIGEELGEIYDYVAPCFPP 344 QGKGYKDKCYE IRK+VE RF++LL +DLK A+EEAR+IGEELG+IYDYVAPCFPP Sbjct: 265 VQGKGYKDKCYEQIRKAVEDRFNRLLTLVFEDLKAALEEARMIGEELGDIYDYVAPCFPP 324 Query: 345 RYEVFQLMVNLYTERFVQWLRKMSDQASNMTNIEILKVTGWVVDYQESLIELGVDDSLAQ 524 RYE+FQLMVNLYTERF+Q LR +SD+A+++TNIEILKVTGWVV+YQE+LI LGVDDSLAQ Sbjct: 325 RYEIFQLMVNLYTERFIQMLRLLSDRANDLTNIEILKVTGWVVEYQENLIALGVDDSLAQ 384 Query: 525 VCSESGAMDPLMNAYVERMQATTKKWYLNILEADQVQPPKKTDDGKLYTPAAVDLFRILG 704 VCSESG+MDPLMNAYVERMQATTKKWY+NILEAD+VQPPKKT++GKLYTPAAVDLFRILG Sbjct: 385 VCSESGSMDPLMNAYVERMQATTKKWYMNILEADKVQPPKKTEEGKLYTPAAVDLFRILG 444 Query: 705 EQVQIVRENSTDVMVYRIALALIQVNDDF 791 EQVQIVR+NSTDVM+YRIALA+IQV DF Sbjct: 445 EQVQIVRDNSTDVMLYRIALAIIQVMIDF 473 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,026,183 Number of Sequences: 27288 Number of extensions: 294591 Number of successful extensions: 805 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 802 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1472363560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249444|gb|BI934972.1|BI934972 EST554861 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD21M2 5' end, mRNA sequence (779 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g62250.1 unknown protein / contains similarity to peroxida... 192 8e-53 >At1g62250.1 unknown protein / contains similarity to peroxidase isozyme GI:217933 from [Armoracia rusticana]; supported by cDNA: gi_17529073 Length = 267 Score = 192 bits (489), Expect(2) = 8e-53 Identities = 92/138 (66%), Positives = 113/138 (81%), Gaps = 1/138 (0%) Frame = +1 Query: 319 LLCRSQD-ATSPENEYRSSRNIAISLFRRYKNFLERGGGDNLKEFISAGVNAYALGCTDE 495 + C S++ + S ++EYRSS NIAISL RRY+ + RG G+ LKEFISAGVNAYALGCTDE Sbjct: 70 MFCNSRNNSISSDDEYRSSPNIAISLLRRYRTVIGRGEGETLKEFISAGVNAYALGCTDE 129 Query: 496 GLRKELFSLKESGVEIEAMETYGGSTSLKSKILSVEVDECIMWLSIIFITILCTPQPTIV 675 LRKEL ++K+SG+EIE ME YGGST KSKI EVDECI+WL I+FITILCTPQPT++ Sbjct: 130 DLRKELMAMKDSGLEIERMENYGGSTQTKSKITLSEVDECILWLRIVFITILCTPQPTVI 189 Query: 676 RWSSTSPVSDEMIVQWKG 729 RWSST VSDE++ +W+G Sbjct: 190 RWSSTPSVSDEILSKWRG 207 Score = 32.3 bits (72), Expect(2) = 8e-53 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 716 SSGKGFLCIIANAYFVRRMAW 778 S +GF +IANAY++R MAW Sbjct: 203 SKWRGFCAVIANAYYIRGMAW 223 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,288,871 Number of Sequences: 27288 Number of extensions: 380668 Number of successful extensions: 1131 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1095 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1131 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1436884920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249399|gb|BI934927.1|BI934927 EST554816 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD21E2 5' end, mRNA sequence (603 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g51740.1 Expressed protein / ; supported by full-length cD... 193 7e-50 >At1g51740.1 Expressed protein / ; supported by full-length cDNA: Ceres: 258340. Length = 310 Score = 193 bits (490), Expect = 7e-50 Identities = 90/133 (67%), Positives = 111/133 (82%) Frame = +1 Query: 205 MSKVRDRTEDFKDVAHRSALSLGYDESKTAALLASFIMHKPRQKSGFTRAALKTLESIGT 384 MS+ RDRTEDFKD SA+S+GY+ESK A+ +ASFI+HKP+++S FT+AA KTL+SI Sbjct: 1 MSRFRDRTEDFKDSVRNSAVSIGYNESKVASTMASFIIHKPKERSPFTKAAFKTLDSIKE 60 Query: 385 LEQFLMKHKKDYVDLHRTTEQERDSIEHEVTIFVKSCKEQIDVLRNSINEEDANSKGWLG 564 LE F++KH+KDYVDLHRTTEQE+DSIE EV F+K+CKEQID+L NSI E+ANSKGWLG Sbjct: 61 LELFMLKHRKDYVDLHRTTEQEKDSIEQEVAAFIKACKEQIDILINSIRNEEANSKGWLG 120 Query: 565 FEGDNLNADTIAH 603 DN NAD+IAH Sbjct: 121 LPADNFNADSIAH 133 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,330,529 Number of Sequences: 27288 Number of extensions: 251123 Number of successful extensions: 726 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 725 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 948861544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249346|gb|BI934874.1|BI934874 EST554763 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD21I19 5' end, mRNA sequence (775 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27180.1 hypothetical protein / predicted by genemark.hmm 272 2e-73 >At3g27180.1 hypothetical protein / predicted by genemark.hmm Length = 499 Score = 272 bits (695), Expect = 2e-73 Identities = 123/163 (75%), Positives = 140/163 (85%) Frame = +3 Query: 228 CALNCTHFQSCSGCTQEYNLHHPVVIDEAIGFFNKLGIKDFSFDSCRLWGWRCRAKLAVR 407 C+L C HFQSCSGCTQE+NLH P V+DEA FF + G+ DF+FDSCRLWGWRCRAKLAVR Sbjct: 46 CSLQCPHFQSCSGCTQEFNLHRPAVVDEASDFFKRYGVDDFTFDSCRLWGWRCRAKLAVR 105 Query: 408 GSSTNPLIGLYEEGTHNVVDIPDCKSHHPNINAAVKLLKKGIIELNVEPYDEDQGTGDLR 587 GSS N LIGLY+EGTH VVDIP+CKSHHPNINAA++LL++GI +V P+DEDQGTGDLR Sbjct: 106 GSSDNALIGLYQEGTHTVVDIPECKSHHPNINAAIELLREGIKVFDVVPFDEDQGTGDLR 165 Query: 588 YVQMAVTTHDTSLPIPERYKNGKVQISLVWNSRSENSANTAKL 716 YVQMAVTTH T+L PERYKNGKVQ+SLVWNSR+E S N KL Sbjct: 166 YVQMAVTTHSTNLRAPERYKNGKVQVSLVWNSRNERSHNADKL 208 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,493,622 Number of Sequences: 27288 Number of extensions: 339541 Number of successful extensions: 878 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 878 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249301|gb|BI934829.1|BI934829 EST554718 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD21A19 5' end, mRNA sequence (755 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g01860.1 hypothetical protein / ; supported by cDNA: gi_1... 254 3e-68 >At4g01860.1 hypothetical protein / ; supported by cDNA: gi_19699002 Length = 1308 Score = 254 bits (650), Expect = 3e-68 Identities = 118/223 (52%), Positives = 163/223 (72%), Gaps = 1/223 (0%) Frame = +1 Query: 1 LSTIRSVFTNADQQDDLPSGSCAIGFSSSDFIIWNLISETKVLQVTCGGWRRPHSYFLGD 180 L+ ++SV +D P+ A GF+S+DFI+WNL +ETKV Q++CGGWRRPHS++LG+ Sbjct: 654 LNLVQSVCQGVQFSEDHPNNDYAAGFASTDFILWNLTAETKVTQISCGGWRRPHSFYLGE 713 Query: 181 VPEMKNCLAYVKDGVIYVHRHWVTTNERVMYPKNFHLQFHGREIHTICFISRDSLCSLNE 360 +PE +NC AYVKD VI++HRHWV + ++P N H QFHGRE+H++CFIS D+ + Sbjct: 714 IPEWQNCFAYVKDDVIHIHRHWVGGQKTKVFPLNLHTQFHGRELHSLCFISTDTKAGFDS 773 Query: 361 KQDTFSE-MIWVATGCEDGTVRLTRYASETENWSTSKLLGEHVGGSAVRSIFFVSRLHRM 537 ++ S+ W+ATGCEDG+VRL+RYASE NWSTS+LLGEHVGGSAVRS+ VS +H M Sbjct: 774 EESKISDRSSWIATGCEDGSVRLSRYASEFGNWSTSELLGEHVGGSAVRSVCCVSNMHMM 833 Query: 538 VLDASDVHESVNSEKWFLEDPEDCSLLISVGAKRVVTAWGTKN 666 D ++ + + + + ++D E LLISVGAKRVVT+W +N Sbjct: 834 SSDVPNLPDMCDQD-YAVDDCESPRLLISVGAKRVVTSWLLRN 875 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,037,269 Number of Sequences: 27288 Number of extensions: 381043 Number of successful extensions: 1002 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 999 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249266|gb|BI934794.1|BI934794 EST554683 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD20L10 5' end, mRNA sequence (696 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g54170.1 FKBP12 interacting protein (FIP37) / ; supported... 204 4e-53 >At3g54170.1 FKBP12 interacting protein (FIP37) / ; supported by cDNA: gi_3859943_gb_AF084570.1_AF084570 Length = 330 Score = 204 bits (519), Expect = 4e-53 Identities = 107/178 (60%), Positives = 129/178 (72%) Frame = +1 Query: 154 TGRSGTKRSFGXXXXXXXXIFGSKKGNLLKVEETAPGAATGMILSLRESLQDCKDNLAST 333 T SG +RSFG IFGS APG TGMILSLR SL++CKD+LAS Sbjct: 20 TRASGNRRSFGDLEDDEDDIFGSTT--------VAPGVRTGMILSLRGSLKNCKDDLASC 71 Query: 334 QTELESAKSEILKWRSAFEKEPFIPPGMTPEPKFVVSYLQNIXXXXXXXXXXXXXAKKKE 513 Q ELESAK+EI KW+SAF+ E F+P G +PEP+F++ Y+QN+ AK+KE Sbjct: 72 QNELESAKTEIQKWKSAFQNESFVPAGKSPEPRFLIDYIQNLKSSEKSLKEQLEIAKRKE 131 Query: 514 AAFIVTFAKREQEIAELKSAVRDLRAQLKPPSMQARKLLLDPAIHEEFTRLKNLVEEK 687 A+ IV +AKREQE+AELKSAVRDL++QLKP SMQAR+LLLDPAIHEEF+RLKNLVEEK Sbjct: 132 ASCIVQYAKREQEMAELKSAVRDLKSQLKPASMQARRLLLDPAIHEEFSRLKNLVEEK 189 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,624,448 Number of Sequences: 27288 Number of extensions: 220597 Number of successful extensions: 662 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 661 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1201087980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249220|gb|BI934748.1|BI934748 EST554637 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD20D6 5' end, mRNA sequence (257 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13540.1 putative protein / HERC2 - Homo sapiens, EMBL:AF0... 165 4e-42 >At5g13540.1 putative protein / HERC2 - Homo sapiens, EMBL:AF071172 Length = 788 Score = 165 bits (418), Expect = 4e-42 Identities = 74/85 (87%), Positives = 81/85 (95%) Frame = +1 Query: 1 QVGDWVRVKASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKV 180 QVGDWVRVKASV SPKYGWEDITRNS+G++HSL+EDGDVGIAFCFRSKPFSCSVTDVEKV Sbjct: 280 QVGDWVRVKASVSSPKYGWEDITRNSIGVMHSLDEDGDVGIAFCFRSKPFSCSVTDVEKV 339 Query: 181 PPFEVGQEIHVLPSVSQPRLGWSNE 255 PF VGQEIH+ PS++QPRLGWSNE Sbjct: 340 TPFHVGQEIHMTPSITQPRLGWSNE 364 Score = 83.6 bits (205), Expect = 2e-17 Identities = 32/85 (37%), Positives = 55/85 (64%) Frame = +1 Query: 1 QVGDWVRVKASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKV 180 ++GDWVRVKAS+ +P Y W ++ +S G++H + EDGD+ ++FCF + + C ++E++ Sbjct: 662 KIGDWVRVKASITTPTYQWGEVNPSSTGVVHRM-EDGDLCVSFCFLDRLWLCKAGELERI 720 Query: 181 PPFEVGQEIHVLPSVSQPRLGWSNE 255 PF +G + + + PR GW E Sbjct: 721 RPFRIGDRVKIKDGLVTPRWGWGME 745 Score = 83.2 bits (204), Expect = 2e-17 Identities = 35/83 (42%), Positives = 55/83 (66%), Gaps = 1/83 (1%) Frame = +1 Query: 1 QVGDWVRVKASVPS-PKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEK 177 +VGDWVR K S+ + P Y W ++ R S+ ++HS++E G + +A CFR +S TD+EK Sbjct: 406 EVGDWVRSKPSLGNRPSYDWSNVGRESIAVVHSIQETGYLELACCFRKGRWSTHYTDLEK 465 Query: 178 VPPFEVGQEIHVLPSVSQPRLGW 246 +P +VGQ +H +++PR GW Sbjct: 466 IPALKVGQFVHFQKGITEPRWGW 488 Score = 61.6 bits (148), Expect = 7e-11 Identities = 29/84 (34%), Positives = 45/84 (53%) Frame = +1 Query: 4 VGDWVRVKASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKVP 183 VGDWV+ K + +P +GW+ SVG + ++ E D+ IAFC S +V K+ Sbjct: 22 VGDWVKFKRGITTPLHGWQGAKPKSVGFVQTILEKEDMIIAFC--SGEARVLANEVVKLI 79 Query: 184 PFEVGQEIHVLPSVSQPRLGWSNE 255 P + GQ + + V +PR GW + Sbjct: 80 PLDRGQHVRLRADVKEPRFGWRGQ 103 Score = 57.4 bits (137), Expect = 1e-09 Identities = 26/85 (30%), Positives = 45/85 (52%) Frame = +1 Query: 1 QVGDWVRVKASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKV 180 +VGDWVR++ ++ S K+G+ + S+GI++ + D + + + P+ C +VE V Sbjct: 145 KVGDWVRIRQNLTSAKHGFGSVVPGSMGIVYCVRPDSSLLVELSYLPNPWHCEPEEVEPV 204 Query: 181 PPFEVGQEIHVLPSVSQPRLGWSNE 255 PF SV++PR W E Sbjct: 205 APFR--------RSVAEPRYAWGGE 221 Score = 57.4 bits (137), Expect = 1e-09 Identities = 29/88 (32%), Positives = 47/88 (52%), Gaps = 5/88 (5%) Frame = +1 Query: 1 QVGDWVRVKASVPSPKYGWEDITRNSVGIIHSL-----EEDGDVGIAFCFRSKPFSCSVT 165 +VG+WVR++ V W+ + SVG++H + E DG ++FC + ++ + Sbjct: 533 EVGEWVRLREGVSC----WKSVGPGSVGVVHGVGYEGDEWDGTTSVSFCGEQERWAGPTS 588 Query: 166 DVEKVPPFEVGQEIHVLPSVSQPRLGWS 249 +EK VGQ+ V +V QPR GWS Sbjct: 589 HLEKAKKLVVGQKTRVKLAVKQPRFGWS 616 Score = 53.1 bits (126), Expect = 3e-08 Identities = 23/82 (28%), Positives = 48/82 (58%) Frame = +1 Query: 7 GDWVRVKASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKVPP 186 G VR++A V P++GW +R+SVG + ++EDG + + F S+ + ++E+V Sbjct: 84 GQHVRLRADVKEPRFGWRGQSRDSVGTVLCVDEDGILRVGFPGASRGWKADPAEMERVEE 143 Query: 187 FEVGQEIHVLPSVSQPRLGWSN 252 F+VG + + +++ + G+ + Sbjct: 144 FKVGDWVRIRQNLTSAKHGFGS 165 Score = 48.1 bits (113), Expect = 8e-07 Identities = 29/93 (31%), Positives = 42/93 (44%), Gaps = 17/93 (18%) Frame = +1 Query: 25 KASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKVPPF----- 189 + SV P+Y W T +SVG I +E DG + I R P+ +D+EK+ F Sbjct: 208 RRSVAEPRYAWGGETHHSVGKISEIENDGLLIIEIPNRPIPWQADPSDMEKIDDFKHVKS 267 Query: 190 ------------EVGQEIHVLPSVSQPRLGWSN 252 +VG + V SVS P+ GW + Sbjct: 268 FDSFNTEPLYHEQVGDWVRVKASVSSPKYGWED 300 Score = 47.0 bits (110), Expect = 2e-06 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 2/83 (2%) Frame = +1 Query: 4 VGDWVRVKASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKVP 183 VG RVK +V P++GW + SVG I +++ DG + I SK + ++VE + Sbjct: 598 VGQKTRVKLAVKQPRFGWSGHSHGSVGTISAIDADGKLRIYTPAGSKTWMLDPSEVETIE 657 Query: 184 PFE--VGQEIHVLPSVSQPRLGW 246 E +G + V S++ P W Sbjct: 658 EEELKIGDWVRVKASITTPTYQW 680 Score = 45.8 bits (107), Expect = 4e-06 Identities = 24/76 (31%), Positives = 40/76 (52%) Frame = +1 Query: 1 QVGDWVRVKASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKV 180 +VG +V + + P++GW +S GII ++ DG+V +AF + D+E Sbjct: 470 KVGQFVHFQKGITEPRWGWRAAKPDSRGIITTVHADGEVRVAFFGLPGLWRGDPADLEVE 529 Query: 181 PPFEVGQEIHVLPSVS 228 P FEVG+ + + VS Sbjct: 530 PMFEVGEWVRLREGVS 545 Score = 44.7 bits (104), Expect = 9e-06 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 1/84 (1%) Frame = +1 Query: 4 VGDWVRVKASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKVP 183 VG + + S+ P+ GW + T ++G + ++ DG + R + S D E + Sbjct: 344 VGQEIHMTPSITQPRLGWSNETPATIGKVMRIDMDGTLSAQVTGRQTLWRVSPGDAELLS 403 Query: 184 PFEVGQEIHVLPSV-SQPRLGWSN 252 FEVG + PS+ ++P WSN Sbjct: 404 GFEVGDWVRSKPSLGNRPSYDWSN 427 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.137 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,495,594 Number of Sequences: 27288 Number of extensions: 130661 Number of successful extensions: 393 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 387 length of database: 11,516,596 effective HSP length: 61 effective length of database: 9,852,028 effective search space used: 236448672 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249104|gb|BI934632.1|BI934632 EST554521 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD20M10 5' end, mRNA sequence (668 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47760.1 Not56-like protein / ; supported by cDNA: gi_162... 281 2e-76 >At2g47760.1 Not56-like protein / ; supported by cDNA: gi_16226530_gb_AF428424.1_AF428424 Length = 438 Score = 281 bits (719), Expect = 2e-76 Identities = 133/197 (67%), Positives = 159/197 (80%) Frame = +3 Query: 63 RKSNRSENFIQKLVKNPKIPFXXXXXXXXXXXXXXXXXYVPYTKIDWDAYMSQVTGFLEG 242 +++NRS+ F K P +PF YVPYTKIDWDAYMSQV+GFL G Sbjct: 20 KETNRSDLF-----KKPAVPFAFALILADAILVALIIAYVPYTKIDWDAYMSQVSGFLGG 74 Query: 243 ERDYSNLKGDTGPLVYPAGFLYIYSAIQYVTGGQVYPAQILFGFLYVLDLAIVLFIYLKT 422 ERDY NLKGDTGPLVYPAGFLY+YSA+Q +TGG+VYPAQILFG LY+++L IVL IY+KT Sbjct: 75 ERDYGNLKGDTGPLVYPAGFLYVYSAVQNLTGGEVYPAQILFGVLYIVNLGIVLIIYVKT 134 Query: 423 DVVPWWALSLLSLSKRVHSIFVLRLFNDCFATTLLHAALVSIICQKWHLGLVIFSGAVSI 602 DVVPWWALSLL LSKR+HSIFVLRLFNDCFA TLLHA++ + +KWHLG+++FSGAVS+ Sbjct: 135 DVVPWWALSLLCLSKRIHSIFVLRLFNDCFAMTLLHASMALFLYRKWHLGMLVFSGAVSV 194 Query: 603 KMNVLLYAPPLVLLMVK 653 KMNVLLYAP L+LL++K Sbjct: 195 KMNVLLYAPTLLLLLLK 211 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,443,275 Number of Sequences: 27288 Number of extensions: 270710 Number of successful extensions: 835 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 822 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 835 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248961|gb|BI934489.1|BI934489 EST554378 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD20A17 5' end, mRNA sequence (745 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39680.1 hypothetical protein / 180 8e-46 >At4g39680.1 hypothetical protein / Length = 633 Score = 180 bits (456), Expect = 8e-46 Identities = 96/185 (51%), Positives = 121/185 (64%), Gaps = 5/185 (2%) Frame = +2 Query: 5 DEAGGGSKEPAKRQRRWNTE--KTAEPQNSSIALTKKVVQPTPIKPILGRTNSTVGGDSP 178 D+ G+ EPAKR RRWN+ K E Q ++ A + T +K R++S+V D P Sbjct: 385 DQEAVGNNEPAKR-RRWNSNSIKVPEAQITNSATPTTTPRSTGLKRDFSRSDSSVSEDGP 443 Query: 179 KERFVPKSSKTATTSLKIENFLRPFTLKAVQELLARTGEVCSFWMDQIKTHCYVTYSSVE 358 KER VP S K T SL+I+ FLRPFTLKAVQELL +TG V SFWMD IKTHCYV+Y SVE Sbjct: 444 KERVVPPSPKEPTNSLRIDRFLRPFTLKAVQELLGKTGNVTSFWMDHIKTHCYVSYPSVE 503 Query: 359 EATETRNAVYNLQWPPNGGRLLVADFVDPQQVQTKIEGREPASP---PKVTSPAVPASSF 529 EA TR AVYNLQWPPNGGR L+A+FV ++V+ K+E P P P+ + + P + Sbjct: 504 EAAATREAVYNLQWPPNGGRHLIAEFVRAEEVKEKLEAPLPPQPQHQPQAQTLSRPPPTA 563 Query: 530 VQTPP 544 + PP Sbjct: 564 LPPPP 568 Score = 49.3 bits (116), Expect = 2e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +1 Query: 670 DPPIVTLDDLFRKTKVTPRIYYLPL 744 +PPIVTLDDLF+KTK PRIYYLPL Sbjct: 594 EPPIVTLDDLFKKTKAIPRIYYLPL 618 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,016,592 Number of Sequences: 27288 Number of extensions: 383070 Number of successful extensions: 1388 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1384 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1330449000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248709|gb|BI934237.1|BI934237 EST554126 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD19O19 5' end, mRNA sequence (760 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g17033.1 Expressed protein / ; supported by cDNA: gi_13877... 154 4e-38 >At2g17033.1 Expressed protein / ; supported by cDNA: gi_13877876_gb_AF370201.1_AF370201 Length = 504 Score = 154 bits (390), Expect = 4e-38 Identities = 93/218 (42%), Positives = 120/218 (54%), Gaps = 1/218 (0%) Frame = +1 Query: 103 LSKQGHRFLSTLIATD-SDDISATRHLLRKFVGSSSKHVALSTLSHLVSPTTTSHYRLCS 279 L K G RFLS+L + + D SA ++KFV +S K VAL+ LSHL+S T SH L Sbjct: 88 LMKHGDRFLSSLSSPALAGDPSAINRHIKKFVAASPKSVALNVLSHLLSDQT-SHPHLSF 146 Query: 280 LALPLYLEISEASWFDWNSKLVAELVALLYKLERFDEAETLVTESVSKLGSRERDLCSFY 459 AL LY EI+EASWFDWN KL+AEL+ALL K ERFDE+ETL++ +VS+L S ERD F Sbjct: 147 FALSLYSEITEASWFDWNPKLIAELIALLNKQERFDESETLLSTAVSRLKSNERDFTLFL 206 Query: 460 SQLIYSQSKHNSERGVLDYCTXXXXXXXXXXXXXXXQRGYASMVEGFCLIGLPRKAXXXX 639 L+ S SK S +G + + Y SMV G C + P A Sbjct: 207 CNLVESNSKQGSIQGFSEASFRLREIIQRSSSVYVKTQAYKSMVSGLCNMDQPHDAERVI 266 Query: 640 XXXXXXXXXXSKFEFRSLVYSYGKSGYLRDMKRIVVEM 753 FE++S++Y YG+ G DM R+V M Sbjct: 267 EEMRMEKIKPGLFEYKSVLYGYGRLGLFDDMNRVVHRM 304 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,977,317 Number of Sequences: 27288 Number of extensions: 229111 Number of successful extensions: 751 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 748 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1374797300 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248526|gb|BI934054.1|BI934054 EST553943 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD18N19 5' end, mRNA sequence (613 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g02410.1 hypothetical protein / predicted by genscan 131 3e-31 >At2g02410.1 hypothetical protein / predicted by genscan Length = 152 Score = 131 bits (329), Expect = 3e-31 Identities = 63/89 (70%), Positives = 70/89 (77%), Gaps = 1/89 (1%) Frame = +1 Query: 349 KPATSYRKKKVEKEELPDDEEIYRDPTLALYYTNQXXXXXXX-XXXXXGYNVCGYWPKLK 525 KPATSYRKKKVEK+ELPDD E+YRDPT LYYTNQ GYNVCGYW KLK Sbjct: 3 KPATSYRKKKVEKDELPDDSELYRDPTNTLYYTNQGLLDDAVPVLLVDGYNVCGYWMKLK 62 Query: 526 KHFMNGSLDIARQKLIDELVSFSLLREVK 612 KHFM G LD+ARQKL+DELVSFS+++EVK Sbjct: 63 KHFMKGRLDVARQKLVDELVSFSMVKEVK 91 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,387,090 Number of Sequences: 27288 Number of extensions: 283425 Number of successful extensions: 1022 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 961 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1019 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 963817488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248369|gb|BI933897.1|BI933897 EST553786 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD18O23 5' end, mRNA sequence (766 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80460.1 putative glycerol kinase / similar to GLYCEROL KI... 391 e-109 >At1g80460.1 putative glycerol kinase / similar to GLYCEROL KINASE GB:O69664 from [Mycobacterium tuberculosis] Length = 522 Score = 391 bits (1004), Expect = e-109 Identities = 193/255 (75%), Positives = 209/255 (81%) Frame = +1 Query: 1 TMLMNLKTLDWDKSTLDTLGISAKMLPKIISNSEIIGNIAKGWPITGIPISGCLGDQHAA 180 TMLMNLKTL WD+ TL TLGI A++LPKI+SNSE+IG I KGWPI GI I+GCLGDQHAA Sbjct: 200 TMLMNLKTLSWDQDTLKTLGIPAEILPKIVSNSEVIGEICKGWPIPGIKIAGCLGDQHAA 259 Query: 181 MVGQSCRKGEAKSTYGTGAFILLNTGEEVVKSNHGLLSTVAYKLGPKAPVNYALEGSIAI 360 M+GQ+CRKGEAKSTYGTGAFILLNTGE +KS HGLL+T+AYKLGP+A NYALEGSIAI Sbjct: 260 MLGQACRKGEAKSTYGTGAFILLNTGEVPIKSGHGLLTTLAYKLGPQAQTNYALEGSIAI 319 Query: 361 AGAAVQWLRDXXXXXXXXXXXXXXXXKVSSTGGVYFVPAFNGLFAPWWRDDARGVCIGIT 540 AGAAVQWLRD V STGGVYFVPAFNGLFAPWWR+DARGVCIGIT Sbjct: 320 AGAAVQWLRDSLGIIKSASEIEDLAAMVDSTGGVYFVPAFNGLFAPWWREDARGVCIGIT 379 Query: 541 RFTNKSHIARAVLESMCFQVKDVLDSMHKDAGTKDEAKSDKTEFLLRVDGGATINNLLMQ 720 RFTNKSHIARAVLESMCFQVKDVLDSM+KDAG K + K EFLLRVDGGAT NNLLMQ Sbjct: 380 RFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLNNGKGEFLLRVDGGATANNLLMQ 439 Query: 721 FRLTWWGSSVVRPAD 765 + GS VVRP D Sbjct: 440 IQADLMGSPVVRPVD 454 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,838,744 Number of Sequences: 27288 Number of extensions: 363448 Number of successful extensions: 1040 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 998 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1039 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1392536620 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248365|gb|BI933893.1|BI933893 EST553782 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD18O15 5' end, mRNA sequence (719 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g22640.1 unknown protein / ; supported by cDNA: gi_20453115 258 2e-69 >At5g22640.1 unknown protein / ; supported by cDNA: gi_20453115 Length = 871 Score = 258 bits (659), Expect = 2e-69 Identities = 129/210 (61%), Positives = 147/210 (69%), Gaps = 1/210 (0%) Frame = +2 Query: 5 YTHDVDEEREMWLNSFYKAPLRLPMPAELEHWWSKDE-KPEFILLNKXXXXXXXXXSKLV 181 Y +VD+EREMWLNSFYKAPLRLPMPAELEHWW E PEF+LLNK SKLV Sbjct: 446 YVGEVDQEREMWLNSFYKAPLRLPMPAELEHWWENVEVTPEFVLLNKEPEPDPNDPSKLV 505 Query: 182 YTEDPVILHTPTGRIINYVEDEEHGLRLFWQPPVKEGEDVDPDKVEFLPLGFDEFYGRGG 361 EDPVILHTPTGRIINYVEDE+HG+RLFWQPP++EGE+VDP KVEFLPLGFDEFYG+ Sbjct: 506 QKEDPVILHTPTGRIINYVEDEKHGIRLFWQPPLEEGEEVDPSKVEFLPLGFDEFYGKEV 565 Query: 362 TVKSDSVWKRFVTSVENACKPMFDKLEKWTEEKKKAGEMKIXXXXXXXXXXXXXXXXXXX 541 VK + K FV +E + KPM D LEKWTEEKKKA E + Sbjct: 566 VVKKEHPIKSFVLGIEKSVKPMLDGLEKWTEEKKKAYEERKEMIQQELELVEAEICLEEA 625 Query: 542 XXDMDDELKRMQEEEEKKVAMGTQEEDDIV 631 DMD+ELK+ ++EEEKK MG EED+ V Sbjct: 626 IEDMDEELKKKEQEEEKKTEMGLTEEDEDV 655 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,434,772 Number of Sequences: 27288 Number of extensions: 227118 Number of successful extensions: 985 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1272263564 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248322|gb|BI933850.1|BI933850 EST553739 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD18G9 5' end, mRNA sequence (798 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g31210.1 DNA topoisomerase I, putative / Bacillus subtilis... 235 3e-73 >At4g31210.1 DNA topoisomerase I, putative / Bacillus subtilis DNA Topoisomerase I; PID:G520753 Length = 1179 Score = 235 bits (600), Expect(3) = 3e-73 Identities = 126/229 (55%), Positives = 154/229 (67%) Frame = +2 Query: 77 ELPGCQSAGRVQSAALSLICDREMEIDGFKPQEYWTVLVEFKKNKNLDLANNFLSSHLTH 256 +LPGC SAGRVQSAAL+L+CDRE EIDGFKPQEYWTV ++ K N + S+HLT Sbjct: 600 KLPGCPSAGRVQSAALALVCDRESEIDGFKPQEYWTVGIKVKGKDN----SATFSAHLTS 655 Query: 257 FDTKKLSQFSVSSHTEAMEIEGKINSSNFEVLSSKITKKQRNPSPPYITSTLQQDAANKL 436 ++K+L+Q S+SS A +IE +I S F V +K + ++NP PYITSTLQQDAANKL Sbjct: 656 LNSKRLNQLSISSEANAQDIEQRIKSEGFLVKGTKTSTTRKNPPTPYITSTLQQDAANKL 715 Query: 437 DFSSTYTMKLAQKLYEGIQLSDGKSTGLITYIRTDGLHISDEATKDIQSYISERYGQNFA 616 FS+ +TMK+A DEA KDIQS ++ERYG+NF Sbjct: 716 HFSTAHTMKIA-----------------------------DEAIKDIQSLVAERYGKNFT 746 Query: 617 SKNGRKYFKKVKNAQEAHEAIRTTDIRRLPSKLCRVLDDDALKLYKLIW 763 S + RKYFKKVKNAQEAHEAIR TDIRRLPS + +LD D+LKLY LIW Sbjct: 747 SDSPRKYFKKVKNAQEAHEAIRPTDIRRLPSTIASLLDADSLKLYTLIW 795 Score = 55.1 bits (131), Expect(3) = 3e-73 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 3 LVHAYLARRALDYLIGFNISPLLWR 77 LVHAYLARRALDYLIGFNISPLLWR Sbjct: 575 LVHAYLARRALDYLIGFNISPLLWR 599 Score = 24.3 bits (51), Expect(3) = 3e-73 Identities = 11/19 (57%), Positives = 12/19 (62%) Frame = +3 Query: 741 LSYTNLYGSRTMACQMEPA 797 L L SR +ACQMEPA Sbjct: 788 LKLYTLIWSRAVACQMEPA 806 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,581,205 Number of Sequences: 27288 Number of extensions: 370944 Number of successful extensions: 1120 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1082 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1117 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1476676124 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248244|gb|BI933772.1|BI933772 EST553661 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17H22 5' end, mRNA sequence (729 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g03560.1 putative calcium channel / ; supported by cDNA: g... 311 3e-85 >At4g03560.1 putative calcium channel / ; supported by cDNA: gi_13786068_gb_AF360372.1_AF360372 Length = 733 Score = 311 bits (796), Expect = 3e-85 Identities = 148/241 (61%), Positives = 178/241 (73%) Frame = +2 Query: 5 LKKAFSLIDDSNTGVLDKKQCILLFEELNKYRTLPKISGDDFESIFNELDDTGDFKINLE 184 L+KAF LID G +DK QCI LFE+L YRTLPKIS ++F IF+ELDDT DFKIN + Sbjct: 327 LEKAFGLIDSDKNGEIDKNQCIKLFEQLTNYRTLPKISKEEFGLIFDELDDTRDFKINKD 386 Query: 185 EFADLCTAIGLRFQKEDSLPIFEACPNFYHSAASEKLRDFVRGDTFEYIIVSVLLVNLVA 364 EFADLC AI LRFQKE+ +FE P YHSA S++LR FVR F Y I +L++N +A Sbjct: 387 EFADLCQAIALRFQKEEVPSLFEHFPQIYHSALSQQLRAFVRSPNFGYAISFILIINFIA 446 Query: 365 VIIETTLDIQNNSGQTFWQKVEFTFGWLYVIEMALKVYTYGFENYWRDGQNQFDFIVTWV 544 V++ETTLDI+ +S Q WQ EF FGW+YV+EMALK+YTYGFENYWR+G N+FDF+VTWV Sbjct: 447 VVVETTLDIEESSAQKPWQVAEFVFGWIYVLEMALKIYTYGFENYWREGANRFDFLVTWV 506 Query: 545 IVIGETATFVAPDDLTFLSNGEWXXXXXXXXXXXXXXXXXHVERYRAFCATFLTLIPSLM 724 IVIGETATF+ PD+ TF SNGEW +V+RYRAF ATF+TLIPSLM Sbjct: 507 IVIGETATFITPDENTFFSNGEWIRYLLLARMLRLIRLLMNVQRYRAFIATFITLIPSLM 566 Query: 725 P 727 P Sbjct: 567 P 567 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,806,904 Number of Sequences: 27288 Number of extensions: 305594 Number of successful extensions: 878 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 876 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1286100700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248241|gb|BI933769.1|BI933769 EST553658 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17H16 5' end, mRNA sequence (721 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04930.1 putative fatty acid desaturase / similar to D. me... 363 e-101 >At4g04930.1 putative fatty acid desaturase / similar to D. melanogaster Des-1 protein, GenBank accession number X94180, regulator of meiosis in spermatogenesis similar to human MLD protein, GenBank accession number AF002668, regulator of EGF receptor biosynthesis as a membrane-bound fatty acid desat Length = 332 Score = 363 bits (931), Expect = e-101 Identities = 170/213 (79%), Positives = 190/213 (88%) Frame = +3 Query: 66 MANDFFWSYTDEPHASRRRQILSQYPQIKQLFGPDPFAFLKISGVVLLQLWTATFLHDAT 245 MA DFFWSYTDEPHASRRRQILS YPQI+QLFGPDP+AFLKI+ VV+LQL TA LH++ Sbjct: 20 MATDFFWSYTDEPHASRRRQILSCYPQIRQLFGPDPWAFLKITLVVILQLSTAAILHNSG 79 Query: 246 WLKILIVAYFFGSFLNHNLFLAIHELSHNLAFSTPTYNRWLGIFANLPVGVPMSVTFQKY 425 WLKIL +AYFFGSFLNHNLFLAIHELSHNLAFSTP YNR LGIFANLP+GVPMSVTFQKY Sbjct: 80 WLKILSIAYFFGSFLNHNLFLAIHELSHNLAFSTPVYNRCLGIFANLPIGVPMSVTFQKY 139 Query: 426 HLEHHRFQGVDGIDMDIPSQTEAHVVKNVLAKSIWVILQLFFYAFRPLFLKPKPPGLWEF 605 HLEHHRFQGVDGIDMD+P+ TEAH+V N+ AK+IWV LQLFFYA RP+F+KPKPPG WEF Sbjct: 140 HLEHHRFQGVDGIDMDVPTYTEAHLVTNIFAKTIWVFLQLFFYALRPIFIKPKPPGYWEF 199 Query: 606 INFTIQLSLDGAMVYFWGWKSLAYLILSTFCWG 704 INF IQ+ LD ++V F+GW+S AYLILSTF G Sbjct: 200 INFLIQIVLDVSVVLFFGWRSFAYLILSTFVGG 232 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,382,319 Number of Sequences: 27288 Number of extensions: 380911 Number of successful extensions: 895 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 869 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 895 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1272263564 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248189|gb|BI933717.1|BI933717 EST553606 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17N15 5' end, mRNA sequence (689 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03555.1 Expressed protein / ; supported by full-length cD... 252 2e-69 >At5g03555.1 Expressed protein / ; supported by full-length cDNA: Ceres: 7425. Length = 502 Score = 252 bits (644), Expect(2) = 2e-69 Identities = 127/168 (75%), Positives = 138/168 (81%), Gaps = 1/168 (0%) Frame = +1 Query: 160 MASSSINQFD-DEFHPDPTLTNDDLKPTSIDQRNFSGWEMSSLWIGLVVGVPSYYLAGSL 336 M S IN DE DP+LTNDDLKPT+ QR FS +MSSLWIGLVVGVP+YYLAGSL Sbjct: 1 MTGSEINDHGYDESQFDPSLTNDDLKPTTPSQRTFSWLDMSSLWIGLVVGVPTYYLAGSL 60 Query: 337 VDLGMSWWQGIAIVVLANLITLLPLVLIGQPGTKFGISFPVLARSSFGIRGAHIPTLLRA 516 VDLGM+WWQGIA VV ANLI L+PLVL QPGT +GISFPVLARSSFGIRGAHIPTLLRA Sbjct: 61 VDLGMAWWQGIATVVTANLILLVPLVLTAQPGTLYGISFPVLARSSFGIRGAHIPTLLRA 120 Query: 517 LVGCGWYGIETWIGGEAIFLLLPKVVKDSHLSQSISWLGTSPVEIWVF 660 LVGCGWYGIETWIGGEAIFLLLP +K S LS ++ WLGTSP+E F Sbjct: 121 LVGCGWYGIETWIGGEAIFLLLPGHIKKSALSHTLPWLGTSPLEFSCF 168 Score = 28.1 bits (61), Expect(2) = 2e-69 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 644 LKFGCFVTFWIAQL 685 L+F CF+ FW+AQL Sbjct: 163 LEFSCFIVFWLAQL 176 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,604,601 Number of Sequences: 27288 Number of extensions: 318051 Number of successful extensions: 958 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 919 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 958 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1183294084 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248184|gb|BI933712.1|BI933712 EST553601 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17N5 5' end, mRNA sequence (670 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g03090.1 NDX1 homeobox protein homolog / 77 1e-14 >At4g03090.1 NDX1 homeobox protein homolog / Length = 925 Score = 76.6 bits (187), Expect = 1e-14 Identities = 61/214 (28%), Positives = 93/214 (42%), Gaps = 3/214 (1%) Frame = +3 Query: 3 LVEKALMGEPDMQRNKNLLEKWAVKLSDHGSEVTKSQLKNWXXXXXXXXXXXXXDGRVLS 182 ++EKAL EPD+QRN + WA K+S + + + D S Sbjct: 733 MIEKALAEEPDLQRNSASRQLWADKISQ--KFIIRLNNRKAKLARANKQTGPAHDNN--S 788 Query: 183 EGDSLDKQGGLLTLLPCGSPGSPVEDVGILSAARENAPRLTGLAPSSTCLTENTTAVPAA 362 GD + G T P +P++D + + TG EN ++ Sbjct: 789 SGDLPESPGDENTWQQ--KPSTPIKDQTVTETPK------TG---------ENLMRTSSS 831 Query: 363 SSEPAVCVAGDYVVLINEKAEEIGRGKVCQVSGKWYQRDLEELGTCVVDIIDLKVERSAK 542 S E G V L++E+ +EIG+G V + G+W LE CVVD+++L Sbjct: 832 SEEGIK--QGQQVRLMDERGDEIGKGTVLRTDGEWNGLSLETRQICVVDVMELSESYDGS 889 Query: 543 ---LPYPSELTGTSFDQAERKFGFMRVLWQSSKL 635 +PY S+ G +F +A +FG MRV W +KL Sbjct: 890 KKMIPYGSDDVGRTFTEANSRFGVMRVAWDVNKL 923 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,181,669 Number of Sequences: 27288 Number of extensions: 292689 Number of successful extensions: 805 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 803 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248132|gb|BI933660.1|BI933660 EST553549 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17D7 5' end, mRNA sequence (785 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g18593.1 Expressed protein / ; supported by full-length cD... 105 4e-23 >At4g18593.1 Expressed protein / ; supported by full-length cDNA: Ceres: 29009. Length = 142 Score = 105 bits (261), Expect = 4e-23 Identities = 51/111 (45%), Positives = 68/111 (60%), Gaps = 1/111 (0%) Frame = +3 Query: 438 ISSDVDVSLSKETTSART-YRCKKCRRVVALQGNVVDHVPGEGETAFEWHKRRSGNPYNK 614 + D + SL + + YRCKKCRR+VA++ N+V H PG+GE F W K+RSGN Sbjct: 8 VEVDTNSSLQESLPKPQVMYRCKKCRRIVAIEENIVPHEPGKGEECFAW-KKRSGN---S 63 Query: 615 PDDECSSVFVEPLKWMRTVEEGAMEGKLLCAHCEARLGYLTGQAFNAVAGA 767 +CSS+FVEP+KWM+T+ +G +E KLLC C RLGY GA Sbjct: 64 EQVQCSSIFVEPMKWMQTIHDGMVEEKLLCFGCNGRLGYFNWAGMQCSCGA 114 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,277,985 Number of Sequences: 27288 Number of extensions: 380724 Number of successful extensions: 1071 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1034 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1070 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248108|gb|BI933636.1|BI933636 EST553525 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17M20 5' end, mRNA sequence (760 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g20410.1 putative protein / gamma-SNAP protein, bovine, PI... 311 3e-85 >At4g20410.1 putative protein / gamma-SNAP protein, bovine, PIR2:S32369;supported by full-length cDNA: Ceres:267158. Length = 291 Score = 311 bits (796), Expect = 3e-85 Identities = 152/235 (64%), Positives = 173/235 (72%) Frame = +1 Query: 43 MGSDPEKLISKADKLTKLSFTRWSIDWKSATGLYEQAANGFRLXXXXXXXXXXXXXXXXG 222 M SDP+K++SKADK+TKL+ TRWS DW+ AT LYEQAANGFR G Sbjct: 1 MSSDPDKMMSKADKMTKLTLTRWSADWRGATELYEQAANGFRASNKYEKAKVALEKASKG 60 Query: 223 QEMLSSPWDAAKHMESAATMAKELGNWKEVADFYRRASELYNECGRPQPASDALGKGARA 402 QEM +SPWDAAKHMESAA +A++L W EVADFYR+ASELY ECGR QPASDALGK ARA Sbjct: 61 QEMQASPWDAAKHMESAAALAQKLSIWNEVADFYRKASELYVECGRAQPASDALGKAARA 120 Query: 403 LEDGAPDVAVQLYTEACAILEEDGKEQMAFDLYRDAARVYLKLEKYEDXXXXXXXXXXXX 582 LED PD A+QLYT+AC ILEEDG++QMAFDLYR A VY+KLEK+ D Sbjct: 121 LEDVKPDDAIQLYTDACEILEEDGRDQMAFDLYRACANVYIKLEKFTDAATFFLRLGVAA 180 Query: 583 DKCSATHSQCKAYLSAIIVYLYAHDFKQAEKCYNDWCQGEVFLNSDQGRCAGNFL 747 DKC AT+SQCKAYLSAII+YLYAHD +QAEKCYND Q + FL SDQ R A L Sbjct: 181 DKCDATNSQCKAYLSAIILYLYAHDLQQAEKCYNDCSQIDAFLKSDQSRSASRLL 235 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.131 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,732,225 Number of Sequences: 27288 Number of extensions: 289572 Number of successful extensions: 790 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 788 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1374797300 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248099|gb|BI933627.1|BI933627 EST553516 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17K20 5' end, mRNA sequence (777 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g31040.1 expressed protein / ; supported by full-length cD... 231 1e-73 >At2g31040.1 expressed protein / ; supported by full-length cDNA: Ceres: 35095. Length = 350 Score = 231 bits (590), Expect(2) = 1e-73 Identities = 123/210 (58%), Positives = 148/210 (69%), Gaps = 8/210 (3%) Frame = +3 Query: 12 YLSVTSTATPKSQESASNSSPTQKLPTKVILPKKKPMKWSTGDAPGEYGGPPTTTKLRKY 191 Y+S TST P Q+ SP +LPTK+ILP KKP KWSTG APGEYGGPPTTTKLRKY Sbjct: 6 YISATSTTPPIPQDQ----SPNSRLPTKIILPNKKPEKWSTGVAPGEYGGPPTTTKLRKY 61 Query: 192 W-GEDKDPLTSDDFIWNKEFMGRMKKYVQDPQEKDTVSRFSPAKEESSGFLSLNRVMSLD 368 W GE +DP+TS D IWN++FM +MKK DP D+ SP+KE+SSGFLS +RVMSLD Sbjct: 62 WGGEKEDPITSTDLIWNRDFMDQMKKLFDDP--NDSSLDPSPSKEKSSGFLSFSRVMSLD 119 Query: 369 SMEIDLTKKLITPSKPT----LDAEVEENKASVS---ASQKWRPAPTRREQEKWVRAAKA 527 SM++DL+K+L + SK LD E K +S S KW+ APTRREQEKW RA KA Sbjct: 120 SMDVDLSKELASSSKSVVKNRLDTSKSEAKKQMSKAIVSPKWKLAPTRREQEKWDRATKA 179 Query: 528 ATGGSEVLLRETRRSQEDPNILAAQSEEQY 617 ATGGS+V+ RE RR + DP + AA+ EQY Sbjct: 180 ATGGSDVMFRELRRPRGDPEVQAAKDREQY 209 Score = 63.2 bits (152), Expect(2) = 1e-73 Identities = 29/41 (70%), Positives = 35/41 (84%) Frame = +1 Query: 652 LGIGGVGIVSAYVSYSPENAASYGAGLLGIVMYMRMFGETV 774 LGIGGVG+VSAY+SY+PE A S+GAGLLG + YMRM G +V Sbjct: 221 LGIGGVGLVSAYISYTPEIALSFGAGLLGSLAYMRMLGNSV 261 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,199,022 Number of Sequences: 27288 Number of extensions: 346384 Number of successful extensions: 1148 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1142 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1428015260 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248032|gb|BI933560.1|BI933560 EST553449 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17M17 5' end, mRNA sequence (746 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22590.1 unknown protein / ; supported by cDNA: gi_17529301 207 6e-54 >At3g22590.1 unknown protein / ; supported by cDNA: gi_17529301 Length = 415 Score = 207 bits (526), Expect = 6e-54 Identities = 113/216 (52%), Positives = 150/216 (69%), Gaps = 14/216 (6%) Frame = +2 Query: 95 MDPLTLLREYTIRNDLHKIVRIGDDYRFGNDYTFPCTIETAYRSKHVQANRYTLETLINF 274 MDPL++L+E+TIR D+ KI R+G +YRFG++Y+FPC ETAYRSK + YTLE L+++ Sbjct: 1 MDPLSVLKEFTIRGDIDKIERVGANYRFGSEYSFPCATETAYRSK--SGSLYTLEALVHY 58 Query: 275 ITNHHLKHTEYIQQSRSLRIPAVTLPDRKPLLDYLTGKTASSDSIEFLKFPQSNDTSVPV 454 + N LKH EY+Q + +PAVTLPDRKPLLDYLTG+ ASSDSI+FL Q N S Sbjct: 59 VKNQQLKHGEYMQSTVKNSVPAVTLPDRKPLLDYLTGRVASSDSIDFLLLQQQNAQSQKQ 118 Query: 455 SV--------SAGVTGNEENVMSDVRVL------ENQNPIELIKAAEKPLKDREAILFCK 592 + SA V + EN ++D+ V E+ + I LI++ E+PLK R+AIL CK Sbjct: 119 NEEYRPDQDNSAFV--SRENAIADMEVEDFGKSGEDVDYIMLIRSNERPLKSRDAILQCK 176 Query: 593 NRDFYSVFTAALRKDEERHRAESLQRKDGLVAKNRI 700 NRDFYSV + +++EER R ES QRKDGLVAK+R+ Sbjct: 177 NRDFYSVLVNSTKREEERQRIESHQRKDGLVAKSRL 212 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,808,950 Number of Sequences: 27288 Number of extensions: 270453 Number of successful extensions: 762 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 759 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248006|gb|BI933534.1|BI933534 EST553423 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17G21 5' end, mRNA sequence (655 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g01350.1 NADC homolog / identical to GP|1216074|gnl|PID|e2... 323 5e-89 >At2g01350.1 NADC homolog / identical to GP|1216074|gnl|PID|e225599|F20096;supported by full-length cDNA: Ceres:2877. Length = 348 Score = 323 bits (828), Expect = 5e-89 Identities = 162/211 (76%), Positives = 181/211 (85%) Frame = +1 Query: 22 PRLVVKMSAMATKNAGRTVESLVVKPPAHPTYDLKGVIQLALSEDAGDLGDVSCKATIPV 201 PR VKMSA AT+ AG S+ +KPP+HPTYDLK VI+LAL+EDAG GDV+C ATIP Sbjct: 16 PRSFVKMSASATQTAGEV--SMGIKPPSHPTYDLKAVIKLALAEDAGHTGDVTCMATIPF 73 Query: 202 ELESEAYFIAKEDGIVAGIALAEMIFAEVDPSLKVEWFIKDGDKVHKGLKFGKVQGKAHN 381 ++E EAYF+AKEDGIVAG+ALA+MIF VDPSLKVEW KDGD VHKGLKFGKV G AH Sbjct: 74 DMEVEAYFLAKEDGIVAGVALADMIFEHVDPSLKVEWMRKDGDYVHKGLKFGKVSGNAHK 133 Query: 382 IVIAERVVLNFMQRMSGIATLTKAMADAAHPAYILETMKTAPGLRLVDKWAVLIGGGKNH 561 IV+AERV+LNFMQRMSGIATLTK MADAA PA ILET KTAPGLRLVDKWAVLIGGG+NH Sbjct: 134 IVVAERVLLNFMQRMSGIATLTKLMADAASPACILETRKTAPGLRLVDKWAVLIGGGRNH 193 Query: 562 RMGLFDMVMIKDNHISAAGSVSKALESVDQY 654 RMGLFDMVMIKDNHISAAG + A++SVD+Y Sbjct: 194 RMGLFDMVMIKDNHISAAGGIVNAVKSVDEY 224 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,416,738 Number of Sequences: 27288 Number of extensions: 313335 Number of successful extensions: 716 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 716 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1088756792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247964|gb|BI933492.1|BI933492 EST553381 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD16N20 5' end, mRNA sequence (774 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20280.1 hypothetical protein / predicted by genefinder 328 1e-90 >At2g20280.1 hypothetical protein / predicted by genefinder Length = 371 Score = 328 bits (842), Expect = 1e-90 Identities = 167/259 (64%), Positives = 186/259 (71%), Gaps = 2/259 (0%) Frame = +3 Query: 3 KVVEDKTFGLKNKNKSKNVQKYVQSLQQNVVXXXXXXXXXXXXXXXXXXXXXXXXSELFK 182 K VEDKTFGLKNKNKSKNVQKYVQSL+Q+V +ELFK Sbjct: 16 KQVEDKTFGLKNKNKSKNVQKYVQSLKQSVQPKPDATKAAAKKKKEEEKAREQELNELFK 75 Query: 183 VAISQPKVPLGVDPKSILCEFFKAGQCVKGFKCKFSHDLNVQRKGEKIDIFSDKRDEDGK 362 VAISQPKVP+GVDPKSILCEFFKAGQC KGFKCKFSHDLN+QRKGEKIDI+SD RDEDG Sbjct: 76 VAISQPKVPVGVDPKSILCEFFKAGQCQKGFKCKFSHDLNIQRKGEKIDIYSDTRDEDG- 134 Query: 363 ETMDDWDQETLEKVVASKSQEYNKNKPTDIVCKFFLDAVEKKQYGWFWACPN-GKECHYR 539 MD+WDQETLEKVV SK EYN+NKPTDIVCK+FLDAVEKKQYGWFW+CPN GKECHYR Sbjct: 135 -DMDEWDQETLEKVVESKKNEYNQNKPTDIVCKYFLDAVEKKQYGWFWSCPNGGKECHYR 193 Query: 540 HALPPGYILKSQMKALLQEEAD-KMPIEEELINSVXXXXXXXXXXXXYLWXXXXXXXXXX 716 HALPPGY+LKSQMKALL+EE+ K+ +E+E+ N Sbjct: 194 HALPPGYVLKSQMKALLEEESSKKLAVEDEIENERAKLQTATQMTPALFMEWKRKKIAER 253 Query: 717 XPIFGQQRADRAKNDRMSG 773 +A+RAKNDRMSG Sbjct: 254 DAGLAASQAERAKNDRMSG 272 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,095,954 Number of Sequences: 27288 Number of extensions: 289973 Number of successful extensions: 1119 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1006 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1111 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247923|gb|BI933451.1|BI933451 EST553340 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD16F8 5' end, mRNA sequence (774 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g08370.1 expressed protein / similar to hypothetical prote... 322 1e-88 >At1g08370.1 expressed protein / similar to hypothetical protein GB:AAC17938 GI:3169719 from [Arabidopsis thaliana]; supported by cDNA: gi_3169718_gb_AF007109.1_AF007109 Length = 367 Score = 322 bits (826), Expect = 1e-88 Identities = 162/208 (77%), Positives = 184/208 (87%) Frame = +1 Query: 58 MSQNGKLMPNLDQNSTKLLNLTVLQRIDPFIEEILITAAHVTLYEFSIDNSQWSRKDIEG 237 MSQNGK++PNLDQNST+LLNLTVLQRIDP+IEEILITAAHVT YEF+I+ SQWSRKD+EG Sbjct: 1 MSQNGKIIPNLDQNSTRLLNLTVLQRIDPYIEEILITAAHVTFYEFNIELSQWSRKDVEG 60 Query: 238 SLFVVKRSSQPRFQFIVMNRRNTDNLVEDLLGDFEYEIQLPYLLYRNASQEVNGIWFYNQ 417 SLFVVKRS+QPRFQFIVMNRRNTDNLVE+LLGDFEYE+Q PYLLYRNASQEVNGIWFYN+ Sbjct: 61 SLFVVKRSTQPRFQFIVMNRRNTDNLVENLLGDFEYEVQGPYLLYRNASQEVNGIWFYNK 120 Query: 418 RECEEVANLFDRILGAYSKVPTKSKVPLTKSEFEELEAVPTMAVIDGPLEPSSSTASDAP 597 RECEEVA LF+RIL AYSKV K K +KSEFEELEA PTMAV+DGPLEP SSTA DA Sbjct: 121 RECEEVATLFNRILSAYSKVNQKPKASSSKSEFEELEAKPTMAVMDGPLEP-SSTARDA- 178 Query: 598 HLPEDNSFVNFFSNALTIGNASNTAVQG 681 P+D +FVNFFS+ + +GN ++ + G Sbjct: 179 --PDDPAFVNFFSSTMNLGNTASGSASG 204 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,962,241 Number of Sequences: 27288 Number of extensions: 374934 Number of successful extensions: 1127 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1092 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1125 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247902|gb|BI933418.1|BI933418 EST553319 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD16B8 5' end, mRNA sequence (724 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g22010.1 unknown protein / 288 2e-78 >At2g22010.1 unknown protein / Length = 343 Score = 288 bits (737), Expect = 2e-78 Identities = 150/242 (61%), Positives = 183/242 (74%), Gaps = 5/242 (2%) Frame = +3 Query: 12 SVIYQKLLREVCLHDEELFSTFLNHLFNTLSWAMTEFSVSVREMQESYKVLEFQQRKCSV 191 S ++Q LLR+ C++D EL STFLN LFNTLSW +TEFSVSVREMQE Y+V+EFQQRKC V Sbjct: 42 STVFQALLRDACINDGELLSTFLNRLFNTLSWTITEFSVSVREMQEKYQVMEFQQRKCCV 101 Query: 192 IFDLSCNLARILEFCTHEIPQAFISGADTNLRRLTEVIVFILNHLISAADQELFDLCHSC 371 IF+LS NLAR+LEFCT+ +PQAF++G DTNLRRLTE+I+FILNH+ SA D E FDL S Sbjct: 102 IFELSSNLARVLEFCTYAMPQAFLAGTDTNLRRLTELILFILNHMTSAVDDEFFDL--SV 159 Query: 372 SFVRRPGQPPEKPNRGMILAPLAGIILNLLEASGESDTR-DNDMVGIFASMDCPDTVVSG 548 +RR GQP EK +RG++LAPL GIILNLLEAS +S + +D++G+FASMDCPDTV G Sbjct: 160 RSLRRQGQPSEKVSRGILLAPLVGIILNLLEASEDSKPKQQHDVIGLFASMDCPDTVYYG 219 Query: 549 FQYLLEYNWASLFRGDD-YLEKIRQLEIFSGLLICRSKVVESERIAYG---G*TDYDDSI 716 FQYLLEYNW GDD Y++K+ QLE F LI R+ E ER TD +D+ Sbjct: 220 FQYLLEYNWDGCVSGDDAYVKKLGQLENFLSHLINRASSQEPERKEESFNKDTTDIEDNT 279 Query: 717 CC 722 CC Sbjct: 280 CC 281 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,724,596 Number of Sequences: 27288 Number of extensions: 344175 Number of successful extensions: 918 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 895 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 915 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1268361380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247883|gb|BI933423.1|BI933423 EST553300 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD16N7 5' end, mRNA sequence (684 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39580.1 unknown protein / 157 6e-39 >At2g39580.1 unknown protein / Length = 1567 Score = 157 bits (396), Expect = 6e-39 Identities = 89/204 (43%), Positives = 123/204 (59%), Gaps = 1/204 (0%) Frame = +3 Query: 6 QALKLLARALEVNPTSAVVWIVYLLLYYSSQKSIGKDDMFKCAVEHAEGSYELWLLYINS 185 QAL LL++ LE +PTS ++W VYLL+Y++ + S GKD MF V+H+ SY +WL+YINS Sbjct: 950 QALSLLSQGLEGDPTSEILWAVYLLIYHAYEGSDGKD-MFSYGVKHSSRSYVIWLMYINS 1008 Query: 186 RTQXXXXXXXXXXXXXXXCRHASVS-DRNALFGSDGILDILLQMMNCLCMSGNIATAIDK 362 R Q C HAS S DRN S ILD+LLQM N LC+SGN++ AI + Sbjct: 1009 RGQLNDQLIAYDTALSALCNHASGSIDRN--HASACILDVLLQMFNLLCISGNVSKAIQR 1066 Query: 363 INELYPTEEKSDSPFRLSLPDIITCLTISDKCVFWVCCVYLVVYRKLPVTVLQRFEYQKE 542 I++L SD P + I+TCLT SDK +YRKLP ++++R E +KE Sbjct: 1067 ISKLQAPAAVSDDPDFSLMSHILTCLTYSDK----------FIYRKLPDSIIRRLEMEKE 1116 Query: 543 LSSIDWPSTDLNFDEKQRGVSLME 614 L I+WP+ +L+ D KQ + L + Sbjct: 1117 LLEIEWPTVNLDGDLKQMALRLFD 1140 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,722,525 Number of Sequences: 27288 Number of extensions: 277431 Number of successful extensions: 757 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 754 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1165500188 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247765|gb|BI933293.1|BI933293 EST553182 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD16G10 5' end, mRNA sequence (716 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g37510.1 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) 76K cha... 363 e-101 >At5g37510.1 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) 76K chain precursor - like protein / NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) 76K chain precursor, potato, PIR:S52737; supported by cDNA: gi_15810150_gb_AY056140.1_ Length = 748 Score = 363 bits (931), Expect = e-101 Identities = 173/185 (93%), Positives = 177/185 (95%) Frame = +1 Query: 160 LPKRNPVGGARVHLPNPDDVIEVFVDGYPVKIPKGMTVLQACEIAGVDIPRFCYHSRLSI 339 LP RNPVGGARVH NP+D IEVFVDGY VK+PKG TVLQACE+AGVDIPRFCYHSRLSI Sbjct: 54 LPPRNPVGGARVHFSNPEDAIEVFVDGYAVKVPKGFTVLQACEVAGVDIPRFCYHSRLSI 113 Query: 340 AGNCRMCLVEVEKSPKPVASCAMPALPGMKIKTDTPIAKKAREGVMEFLLMNHPLDCPIC 519 AGNCRMCLVEVEKSPKPVASCAMPALPGMKIKTDTPIAKKAREGVMEFLLMNHPLDCPIC Sbjct: 114 AGNCRMCLVEVEKSPKPVASCAMPALPGMKIKTDTPIAKKAREGVMEFLLMNHPLDCPIC 173 Query: 520 DQGGECDLQDQSMAFGSDRGRFTEMKRSVVDKNLGPLVKTVMTRCIQCTRCVRFASEVAG 699 DQGGECDLQDQSMAFGSDRGRFTEMKRSVVDKNLGPLVKTVMTRCIQCTRCVRFASEVAG Sbjct: 174 DQGGECDLQDQSMAFGSDRGRFTEMKRSVVDKNLGPLVKTVMTRCIQCTRCVRFASEVAG 233 Query: 700 VEGPG 714 V+ G Sbjct: 234 VQDLG 238 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,901,769 Number of Sequences: 27288 Number of extensions: 353771 Number of successful extensions: 1211 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1201 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1263366616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247692|gb|BI933220.1|BI933220 EST553109 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD16E21 5' end, mRNA sequence (719 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34700.1 putative protein / ; supported by full-length cD... 191 3e-49 >At4g34700.1 putative protein / ; supported by full-length cDNA: Ceres: 18715. Length = 117 Score = 191 bits (486), Expect = 3e-49 Identities = 86/115 (74%), Positives = 101/115 (87%) Frame = +2 Query: 38 MSGIASVSFLARRASQRERVRILYRRALRDTLNWAVHRHLFYPDADALRERFEVNRKVED 217 MSG+++ ++ ARRA+Q+ERVRILYRRAL+DTLNWAVHRH+FY DA LRE+F VN+ VED Sbjct: 1 MSGVSTAAYFARRAAQKERVRILYRRALKDTLNWAVHRHIFYRDASDLREKFNVNQDVED 60 Query: 218 VETIDRLIADGEASYNKWRHPDPYIVPWAPGGSKFNRNPVPPEGIEIVYDYGKEE 382 V+ ID+LIA GEA YNKWRHPDPYIVPWAPGGSKF RNP PP GIEIVY+YG E+ Sbjct: 61 VDRIDKLIAHGEAEYNKWRHPDPYIVPWAPGGSKFCRNPTPPAGIEIVYNYGLED 115 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,928,016 Number of Sequences: 27288 Number of extensions: 319157 Number of successful extensions: 728 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 728 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1272263564 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247615|gb|BI933143.1|BI933143 EST553032 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC25E22 5' end, mRNA sequence (718 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07340.1 expressed protein / supported by full-length Cere... 193 7e-50 >At2g07340.1 expressed protein / supported by full-length Ceres cDNA: Ceres:34060. Length = 128 Score = 193 bits (491), Expect = 7e-50 Identities = 97/128 (75%), Positives = 113/128 (87%) Frame = +3 Query: 30 MADEANRTAFIEIQGRMIETTGKLKQVQTQIRNKETEKKRAYLTLEELKQLSDDTNTYKA 209 MADEA R AF+EIQ MIE TGKLKQVQ Q+RNKE ++KRA+LTLEEL+ L ++TNTYK+ Sbjct: 1 MADEATRAAFMEIQASMIELTGKLKQVQNQMRNKEGDRKRAFLTLEELRPLPEETNTYKS 60 Query: 210 IGRTFVLEPKAVLMNEQEQKLKDGETAIASLQTSKEYLEKHMAEVENNLRELLQQDPGLA 389 IGRTFVLEPK VL EQEQKLKD E A+ASLQTSKEYLEK +AEVENNLRELLQQ+PG+A Sbjct: 61 IGRTFVLEPKTVLEGEQEQKLKDSEAAVASLQTSKEYLEKQVAEVENNLRELLQQEPGIA 120 Query: 390 RQIMTMSV 413 +QIM+MS+ Sbjct: 121 QQIMSMSM 128 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,152,773 Number of Sequences: 27288 Number of extensions: 277904 Number of successful extensions: 995 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 942 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 995 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1263366616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247515|gb|BI933043.1|BI933043 EST552932 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC25C5 5' end, mRNA sequence (706 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54520.1 expressed protein / ;supported by full-length cDN... 117 6e-27 >At1g54520.1 expressed protein / ;supported by full-length cDNA: Ceres:13758. Length = 391 Score = 117 bits (293), Expect = 6e-27 Identities = 86/241 (35%), Positives = 120/241 (49%), Gaps = 10/241 (4%) Frame = +2 Query: 11 AAAPFLLESNLKWN-PLFYTPNPIQCTRLIHYQKLTPSKFSKTSKLTVKCFSKNHKNVCF 187 +++ FL + +WN PL YT P T L++ + P + S + +L + K ++ Sbjct: 3 SSSTFLELTPFQWNQPLPYTQRPHHRTVLLYSK---PQRRSNSIRLQISV--KYKQSTSS 57 Query: 188 NDGDGLEVKNKENPFEIVVKSVMKALKALQKPXXXXXXXXXXXMYDPNSALAAXXXX--- 358 +D D +++ NPFE + V KAL +L+KP YDPNSALAA Sbjct: 58 SDPD---LRSNFNPFEQIAIQVKKALDSLKKPAIAAVLLGLLLFYDPNSALAASGGRIGG 114 Query: 359 -XXXXXXXXXXXXXXXXXXXMRTAEXXXXXXXXXXXXXXXGFSGGGVYVGPAVGFGSSAF 535 RT+ GGG +VGPAVGFG F Sbjct: 115 NSFSSRSRSSSSSSSQSYSVPRTSNPSFSYSARTAPYYGPSPFGGG-FVGPAVGFGFGGF 173 Query: 536 ----LVMMGFAAFIMVSGFLSDRSEG-SVLTATGKTSVLKLQVXXXXXXRSLQKDLNRIA 700 L+++GFAAF++VSGFLSDRS+ S+LT T KTSV+KLQV R+LQ+D NR+A Sbjct: 174 SSFSLILVGFAAFVLVSGFLSDRSQDDSILTDTQKTSVIKLQVGLLGLGRTLQQDFNRLA 233 Query: 701 E 703 E Sbjct: 234 E 234 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,436,625 Number of Sequences: 27288 Number of extensions: 295976 Number of successful extensions: 868 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1227778824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247411|gb|BI932939.1|BI932939 EST552828 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC24P5 5' end, mRNA sequence (725 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11040.1 putative protein / predicted proteins, Arabidopsi... 234 e-101 >At5g11040.1 putative protein / predicted proteins, Arabidopsis thaliana Length = 1186 Score = 234 bits (596), Expect(3) = e-101 Identities = 115/136 (84%), Positives = 129/136 (94%) Frame = +1 Query: 259 VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYTTSLELARLTGDFFWYAGAMEGSVCAL 438 VIKAKKRRLGRAQKTIGDY LLAGSPVDANAHY+T+LELARLTGD+FWYAGA+EGSVCAL Sbjct: 207 VIKAKKRRLGRAQKTIGDYSLLAGSPVDANAHYSTALELARLTGDYFWYAGALEGSVCAL 266 Query: 439 LIDQMGQRDQFLDDEVKHRYNNVILHYRKSFIQDNAQRVSPLSFELEATLKLARYLCRKG 618 L+D+MGQRD L+DEV++RY NVILHYRKSFIQ+ AQRVSPLSFELEATLKLAR+LCR+ Sbjct: 267 LVDRMGQRDVALEDEVRYRYTNVILHYRKSFIQEIAQRVSPLSFELEATLKLARFLCRRE 326 Query: 619 VAKEVVDLLTTAADGA 666 +AKEVV+LLT AADGA Sbjct: 327 LAKEVVELLTNAADGA 342 Score = 139 bits (350), Expect(3) = e-101 Identities = 70/82 (85%), Positives = 75/82 (91%) Frame = +3 Query: 3 QRCFAFCPGDSQLEDESFKGSNLILFPPADRQTQEFHLQTMMQDIAASLLMKFEKSVLQA 182 +RCFAF PGDSQLED KG NLILFPP+D+QTQEFHLQTMMQDIAASLLM+FEK VLQA Sbjct: 126 RRCFAFSPGDSQLEDGDKKGENLILFPPSDKQTQEFHLQTMMQDIAASLLMEFEKWVLQA 185 Query: 183 ESGGTILKTPLDSQASLSSEEV 248 ES GTILKTPLDSQASL+SEEV Sbjct: 186 ESAGTILKTPLDSQASLNSEEV 207 Score = 34.7 bits (78), Expect(3) = e-101 Identities = 15/19 (78%), Positives = 19/19 (99%) Frame = +3 Query: 663 SKSLIDASDRLILFIEIAR 719 +KSLIDASDRLIL++E+AR Sbjct: 342 AKSLIDASDRLILYVEVAR 360 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,453,580 Number of Sequences: 27288 Number of extensions: 303015 Number of successful extensions: 653 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1277231040 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247379|gb|BI932907.1|BI932907 EST552796 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC24H3 5' end, mRNA sequence (673 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g64350.1 G-protein beta family / supported by cDNA: Ceres:... 259 1e-69 At2g30050.1 G-protein beta family / ;supported by full-lengt... 53 2e-07 At3g01340.1 transport protein SEC13, putative / similar to pr... 51 5e-07 >At1g64350.1 G-protein beta family / supported by cDNA: Ceres:35985; supported by cDNA: gi_13877918_gb_AF370222.1_AF370222 Length = 326 Score = 259 bits (661), Expect = 1e-69 Identities = 123/210 (58%), Positives = 155/210 (73%) Frame = +1 Query: 43 MDKAIIKLEEGTTCTAWNYSGHRLAAGSTDGTLFVFDSTDPAXXXXXXXXXXXXHESSIV 222 M K++ L+ GTTC++WN SG RLAAGS +G L +++S+ + ESSIV Sbjct: 1 MAKSMATLDSGTTCSSWNQSGDRLAAGSLNGKLSIYESSTSSSSTFSCTSKVRVSESSIV 60 Query: 223 KVVWAPPEYGDVVACICADGSLLLWEEVVEDSELLQWKLCKCFDRISSLVLDVQFGVSQT 402 K+VW P EYGD VAC+C DGSL +WEE+ ED+ L+WKLCK SS VLDVQFGVS+ Sbjct: 61 KIVWLPSEYGDAVACVCEDGSLSIWEELSEDAHGLEWKLCKSMKNKSSQVLDVQFGVSRK 120 Query: 403 SLKLVAAYSDGQVKVFELLDPFELKNWQLQAEFQNVIESVSKFGNVSCRSASIAWKSLKG 582 SLK+VAAYSDG ++VFELL+P ELKNWQLQAEFQNVI+S+S G S SAS++W +KG Sbjct: 121 SLKMVAAYSDGYLRVFELLNPLELKNWQLQAEFQNVIDSLSTLGKPSSLSASVSWNPMKG 180 Query: 583 EIQQSSFVLGFDSDTPHLNSLKVWGFDQDH 672 E Q+ SFVL F+SD+PHLNS K+W FD+ H Sbjct: 181 EEQEPSFVLAFNSDSPHLNSSKIWEFDEAH 210 >At2g30050.1 G-protein beta family / ;supported by full-length cDNA: Ceres:36577. Length = 302 Score = 52.8 bits (125), Expect = 2e-07 Identities = 32/119 (26%), Positives = 52/119 (42%) Frame = +1 Query: 94 NYSGHRLAAGSTDGTLFVFDSTDPAXXXXXXXXXXXXHESSIVKVVWAPPEYGDVVACIC 273 +Y G R+A S+D T+ + ++ H + +V WA P+YG ++A Sbjct: 20 DYYGKRIATASSDCTIKITGVSNNGGSQQLATLTG--HRGPVWEVAWAHPKYGSILASCS 77 Query: 274 ADGSLLLWEEVVEDSELLQWKLCKCFDRISSLVLDVQFGVSQTSLKLVAAYSDGQVKVF 450 DG ++LW+E ++ QW F S V + + L L SDG + VF Sbjct: 78 YDGQVILWKEGNQN----QWTQDHVFTDHKSSVNSIAWAPHDIGLSLACGSSDGNISVF 132 >At3g01340.1 transport protein SEC13, putative / similar to protein transport protein SEC13 GB:P53024 (Pichia pastoris);supported by full-length cDNA: Ceres:37331. Length = 302 Score = 51.2 bits (121), Expect = 5e-07 Identities = 34/134 (25%), Positives = 58/134 (42%), Gaps = 4/134 (2%) Frame = +1 Query: 61 KLEEGTTCT----AWNYSGHRLAAGSTDGTLFVFDSTDPAXXXXXXXXXXXXHESSIVKV 228 K+E G + T +Y G R+A S+D T+ + ++ H + +V Sbjct: 5 KIETGHSDTIHDVVMDYYGKRVATASSDCTIKITGVSNSGGSQHLATLTG--HRGPVWQV 62 Query: 229 VWAPPEYGDVVACICADGSLLLWEEVVEDSELLQWKLCKCFDRISSLVLDVQFGVSQTSL 408 WA P++G ++A DG ++LW+E ++ QW F V + + + L Sbjct: 63 AWAHPKFGSLLASCSYDGQIILWKEGNQN----QWTQAHVFTDHKVSVNSIAWAPHELGL 118 Query: 409 KLVAAYSDGQVKVF 450 L SDG + VF Sbjct: 119 SLACGASDGNISVF 132 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,416,465 Number of Sequences: 27288 Number of extensions: 294148 Number of successful extensions: 940 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 899 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1129912396 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247365|gb|BI932893.1|BI932893 EST552782 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC24D13 5' end, mRNA sequence (694 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g06430.1 putative protein / similar to unknown protein (sp... 179 2e-45 At4g37200.1 thiol-disulfide interchange like protein / 55 5e-08 >At5g06430.1 putative protein / similar to unknown protein (sp|P73920) Length = 194 Score = 179 bits (453), Expect = 2e-45 Identities = 89/171 (52%), Positives = 109/171 (63%) Frame = +1 Query: 169 STSKNSPFCLKWPWDVHNQNPKNPLPCTFETPWLFKPFKNLGSGVFNFIQNISKPEPLSP 348 STSK+ FCLKWPWD + Q + C F+ PWLF+ + +GS + + + + P Sbjct: 11 STSKDPFFCLKWPWDSNKQPKSSSSVCDFQGPWLFRSMQTIGSIALSSLTSFGQNPNFRP 70 Query: 349 KFNLQSNGGVNQNNXXXXXXXXXXXXEQAELEQSALACALASEKEATVIEFYSPKCRLCN 528 K S+ EQ E EQ A A ALAS+KEATV+EFYS KCRLCN Sbjct: 71 KKKPLSSS------------------EQGEAEQRAFAAALASQKEATVLEFYSHKCRLCN 112 Query: 529 SLVNFVTEVENRNSDWLNIVMADAENDQWLPELLHYDIKYVPCFVLLDKTG 681 SL+ FV EVE RNS+WL+I MADAEN++W PELLHYD+KYVPCFVLLDK G Sbjct: 113 SLLKFVLEVEKRNSNWLSITMADAENEKWFPELLHYDVKYVPCFVLLDKNG 163 >At4g37200.1 thiol-disulfide interchange like protein / Length = 261 Score = 54.7 bits (130), Expect = 5e-08 Identities = 29/83 (34%), Positives = 46/83 (54%), Gaps = 1/83 (1%) Frame = +1 Query: 436 ELEQSALACALA-SEKEATVIEFYSPKCRLCNSLVNFVTEVENRNSDWLNIVMADAENDQ 612 +L SAL A S + TV+EFY+ C +C L V ++E + D +N VM + +N + Sbjct: 123 DLTASALPYEEALSNGKPTVVEFYADWCEVCRELAPDVYKIEQQYKDKVNFVMLNVDNTK 182 Query: 613 WLPELLHYDIKYVPCFVLLDKTG 681 W EL + ++ +P F LD+ G Sbjct: 183 WEQELDEFGVEGIPHFAFLDREG 205 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,051,906 Number of Sequences: 27288 Number of extensions: 325628 Number of successful extensions: 905 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 867 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 903 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1192191032 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247338|gb|BI932866.1|BI932866 EST552755 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC24M18 5' end, mRNA sequence (691 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g27530.1 expressed protein / Similar to gb|AF151884 CGI-12... 348 2e-96 >At1g27530.1 expressed protein / Similar to gb|AF151884 CGI-126 protein from Homo sapiens. EST gb|Z18048 comes from this gene; supported by full-length cDNA: Ceres: 1715. Length = 174 Score = 348 bits (893), Expect = 2e-96 Identities = 158/174 (90%), Positives = 168/174 (95%) Frame = +3 Query: 30 MEGWDPSTKTTLTQIPLLTIKAGPRDGAAWTQRLKEEYKALIAYTSMNKSKDNDWFRISA 209 MEGWDP+TK+TLT+IPLLT KAGPRDGAAWTQRLKEEYK+LIAYT MNKS DNDWFRISA Sbjct: 1 MEGWDPNTKSTLTRIPLLTTKAGPRDGAAWTQRLKEEYKSLIAYTQMNKSNDNDWFRISA 60 Query: 210 ANPEGTRWKGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPELDGKTEKMYRGGKICL 389 +NPEGTRW GKCWYVHNLLKYEFDLQFDIP+TYPATAPELELPE+DGKT+KMYRGGKICL Sbjct: 61 SNPEGTRWTGKCWYVHNLLKYEFDLQFDIPITYPATAPELELPEIDGKTQKMYRGGKICL 120 Query: 390 TVHFKPLWAKNCPRFGIAHALCLGLAPWLAAEIPVLVDSGMIKHKDDVATSSES 551 TVHFKPLWAKNCPRFGIAHALCLGLAPWLAAEIP+LVDSG IKHKDD ATS+ES Sbjct: 121 TVHFKPLWAKNCPRFGIAHALCLGLAPWLAAEIPILVDSGAIKHKDDAATSAES 174 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,125,951 Number of Sequences: 27288 Number of extensions: 321126 Number of successful extensions: 837 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 811 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 837 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1183294084 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247297|gb|BI932825.1|BI932825 EST552714 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC24E22 5' end, mRNA sequence (705 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03780.1 unknown protein / 341 3e-94 >At2g03780.1 unknown protein / Length = 299 Score = 341 bits (874), Expect = 3e-94 Identities = 171/229 (74%), Positives = 194/229 (84%) Frame = +3 Query: 18 MKKARXXXXXXXXXXXXKDGFSKYAEYLNNLNDKRERVVKASRDITMNSKKVIFQVHRMS 197 +KKAR KD FS YA+YLNN N+KRERVVK SRDITMNSKKVIFQVHR+S Sbjct: 50 VKKARTMSTESSM----KDAFSTYADYLNNFNEKRERVVKVSRDITMNSKKVIFQVHRLS 105 Query: 198 KQNKEEVLDKAVKDLAAVTDQYLSRLVKELQGTDFWKLRRAYSPGVQEYVEAATLCNFCK 377 K NKEEVL+KA KDL AV DQ+ +RL+KELQGTDFWKLRRAYSPGVQEYVEAAT FC Sbjct: 106 KDNKEEVLEKAGKDLEAVRDQHFARLMKELQGTDFWKLRRAYSPGVQEYVEAATFYKFCL 165 Query: 378 TGTLLTLDEMNATLLPLSDPSVEPLQINILDYILGLADLTGELMRLAIGRISEGELDFAE 557 +GTL TLDE+N TL+PLSDPS+EPLQINILDYILGLADLTGELMR+AIGRIS+GE++FA+ Sbjct: 166 SGTLCTLDEINTTLVPLSDPSLEPLQINILDYILGLADLTGELMRMAIGRISDGEIEFAQ 225 Query: 558 KICSFVREIYRNLTLIAPEMDDSSDMKQKMETMLQSVMKIENACFSGHV 704 +IC FVR+I+R L L+ P+MDDS DMK KME MLQSV+KIENACFS HV Sbjct: 226 RICQFVRQIHRELMLVVPKMDDSYDMKSKMEVMLQSVIKIENACFSVHV 274 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,473,559 Number of Sequences: 27288 Number of extensions: 265169 Number of successful extensions: 809 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 790 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 809 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1227778824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247200|gb|BI932728.1|BI932728 EST552617 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC24C23 5' end, mRNA sequence (767 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20830.1 expressed protein / ; supported by cDNA: gi_1343... 305 2e-83 >At2g20830.1 expressed protein / ; supported by cDNA: gi_13430685_gb_AF360255.1_AF360255 Length = 297 Score = 305 bits (780), Expect = 2e-83 Identities = 148/255 (58%), Positives = 191/255 (74%) Frame = +2 Query: 2 MLKLMLACCKVYISESRNRGALESIEKAAKLFPESPIINKFEDEIYNRVGYTLVSKISPN 181 ML+ ML CCKVYISE+RN+ ALE+IE+A K FP + I+NKFED Y RVGYT+VS ++ Sbjct: 1 MLREMLGCCKVYISEARNKTALEAIERALKPFPPAAIVNKFEDAAYGRVGYTVVSSLANG 60 Query: 182 SSSGSCSLTLKNASFAMVKAAFETIDLQEHCGTHPRLGVVDHICFHPLGTTSLDMVADTA 361 SSS +LKNA FAMVK A +TI+L+ HCG+HPRLGVVDHICFHPL TS++ V+ A Sbjct: 61 SSS-----SLKNAVFAMVKTALDTINLELHCGSHPRLGVVDHICFHPLSQTSIEQVSSVA 115 Query: 362 KTLAFEVGSNLKVPTFLYGAAQQEGRSLDSIRRELGYFHPNSSENQWIGGTKLETLQLKP 541 +LA ++GS L+VPT+LYGAA++E +LDSIRR+LGYF N ++W GG LE + LKP Sbjct: 116 NSLAMDIGSILRVPTYLYGAAEKEQCTLDSIRRKLGYFKANREGHEWAGGFDLEMVPLKP 175 Query: 542 DEGPPHATQAKGVITIGATRWVDNYNIPVFTNDISIVRKIAKRVSGRRGGLPSVQSMGVT 721 D GP ++AKGV+ +GA WV NYN+PV +ND+ VR+IA++ S R GGL SVQ+M + Sbjct: 176 DAGPQEVSKAKGVVAVGACGWVSNYNVPVMSNDLKAVRRIARKTSERGGGLASVQTMALV 235 Query: 722 HGSGTI*VALHLLEP 766 HG G I VA +LL P Sbjct: 236 HGEGVIEVACNLLNP 250 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,825,416 Number of Sequences: 27288 Number of extensions: 354368 Number of successful extensions: 1209 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1205 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1401406280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247178|gb|BI932706.1|BI932706 EST552595 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23P20 5' end, mRNA sequence (750 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66330.1 expressed protein / ;supported by full-length cDN... 122 2e-28 >At1g66330.1 expressed protein / ;supported by full-length cDNA: Ceres:269548. Length = 417 Score = 122 bits (306), Expect = 2e-28 Identities = 72/139 (51%), Positives = 87/139 (61%) Frame = +1 Query: 331 CGKLSNRVIFRGSPVLCLSTETRDTETECARNSDDCSNISSVQENDQATTVGKVIPSSQA 510 C K V R LC +++DTET S + + Q K SSQ Sbjct: 53 CTKTVTFVSSRRCSTLCFVGKSQDTETN--------SQVVQKEGEKQVMPRRKSSNSSQL 104 Query: 511 IAEACKFAYNDAKFVNERAKNDIVLLSREIMRMDARARQDVAFLGSEVLKLDARAREDTE 690 + E + NDAKFVNERA+ND VLLSR IMR+DARARQDVA LGS LKLDARAREDTE Sbjct: 105 LVE---YVSNDAKFVNERARNDFVLLSRGIMRLDARARQDVAILGSGFLKLDARAREDTE 161 Query: 691 KVDHNVKKRAERIQHVATI 747 K+D +VK++AER+ H+ATI Sbjct: 162 KIDRDVKRKAERLHHIATI 180 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.129 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,032,225 Number of Sequences: 27288 Number of extensions: 384016 Number of successful extensions: 990 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 945 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 987 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247145|gb|BI932673.1|BI932673 EST552562 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23J22 5' end, mRNA sequence (706 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20430.1 unknown protein / 149 2e-36 >At3g20430.1 unknown protein / Length = 265 Score = 149 bits (375), Expect = 2e-36 Identities = 86/193 (44%), Positives = 111/193 (56%), Gaps = 7/193 (3%) Frame = +2 Query: 98 MELEDSILNXXXXXXXXXXXXXVKMNDIEEGELV---EKISKTGLEETGDVCASSENPLP 268 ME E+S+L+ V+M D+EEGE+V + S + GD E L Sbjct: 1 MEGEESLLDAINEEDGFENLEDVEMVDVEEGEIVVDHDLDSGERQNDDGDGVKDKEAILG 60 Query: 269 XXXXXXXXXXXXXXXXXXXXXXPITD----INRFVLDVGRRLKERKSYLIWNAVGCLGLS 436 P+ D ++ FV D RRLKE+KSY+I+ AVGCLG++ Sbjct: 61 EKNGLQQTNKNKRKKKKKKRKGPVMDKPMSVDWFVRDTCRRLKEKKSYMIYTAVGCLGIA 120 Query: 437 ALSDLVKEVDAIQTCGGQKTADGRRFRTGGGILWSILKVRDPNAYKEIMKKGKEFEKQFR 616 ALSDLV EV AI+TCGGQ TADG R RT GG+LW+I+K R P AY+EIMKK KEFEKQFR Sbjct: 121 ALSDLVNEVVAIETCGGQVTADGTRKRTSGGVLWNIIKARQPEAYREIMKKTKEFEKQFR 180 Query: 617 QANLKQEPPPNKE 655 Q N + + P ++ Sbjct: 181 QPNTRPKSGPKRD 193 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,250,341 Number of Sequences: 27288 Number of extensions: 249041 Number of successful extensions: 819 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 818 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1227778824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247117|gb|BI932645.1|BI932645 EST552534 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23D24 5' end, mRNA sequence (694 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05480.1 hypothetical protein / predicted by genemark.hmm 312 1e-85 >At3g05480.1 hypothetical protein / predicted by genemark.hmm Length = 420 Score = 312 bits (799), Expect = 1e-85 Identities = 146/213 (68%), Positives = 177/213 (82%) Frame = +3 Query: 6 ARSITCLARIGNEVAIQASSTQLTFHTLNSSRSAYQSITFKPDYFDVFTVSAPQVQCSVL 185 +RSI CLAR+GNE+ +QAS TQL HTLN+SRSAYQ ITF+ +FDV+TVS PQ SVL Sbjct: 14 SRSIICLARVGNELVVQASPTQLALHTLNASRSAYQCITFQSSFFDVYTVSGPQAHFSVL 73 Query: 186 LKAICSVLRTPIASIDHLTVSLPNPDASKVQWTLNCHNGMRKAYWITCNVEPDIQHLSLD 365 LKA+CSVLRTP+ASIDH++V LP+ DASKV+WTL C++GM+K YWITCNVEPDIQHLSLD Sbjct: 74 LKAVCSVLRTPLASIDHMSVQLPDHDASKVKWTLQCYSGMKKTYWITCNVEPDIQHLSLD 133 Query: 366 RRKLPSNFVVRPRDLNRLLSNFQTTLQEITIIATNPTCLPPDTATEIGGKAVELRSYIDP 545 R + PS V+ PR+L++LL NFQ++LQEITIIAT+ T P D A+EIGGKAVE RSY+DP Sbjct: 134 RGRFPSTLVMHPRNLSKLLGNFQSSLQEITIIATDQTSFPSDAASEIGGKAVEFRSYVDP 193 Query: 546 TKENDSSLHTQLWIDPTEEFVQYNHITNPVDVT 644 TK+ DS LHTQLWIDP+EEF+QY H + VT Sbjct: 194 TKDGDSLLHTQLWIDPSEEFLQYTHAVTILSVT 226 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,326,108 Number of Sequences: 27288 Number of extensions: 321362 Number of successful extensions: 789 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 789 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1192191032 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247061|gb|BI932589.1|BI932589 EST552478 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23J11 5' end, mRNA sequence (718 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24160.1 putative protein / CGI-58 protein - Homo sapiens,... 313 4e-91 At1g64670.1 expressed protein / ;supported by full-length cDN... 52 2e-07 At5g41900.1 putative protein / strong similarity to unknown p... 52 3e-07 At5g38520.1 putative protein / similar to unknown protein (pi... 48 5e-06 >At4g24160.1 putative protein / CGI-58 protein - Homo sapiens,PID:g4929585 Length = 407 Score = 313 bits (803), Expect(2) = 4e-91 Identities = 148/177 (83%), Positives = 162/177 (90%), Gaps = 1/177 (0%) Frame = +2 Query: 98 SSATADGAKRWSF-WPSSLRWIPTSTDHIIAAEKRLLSLVRTPYTQEQVNIGSGPPGSKV 274 S+AT RW WP+SLRWIPTSTD+IIAAEKRLLS+++TPY QEQV+IGSGPPGSK+ Sbjct: 26 SAATNAAKSRWKILWPNSLRWIPTSTDYIIAAEKRLLSILKTPYVQEQVSIGSGPPGSKI 85 Query: 275 RWFRSVSNEPRFINTVTFDSKEGSPTLVMVHGYGASQGFFFRNFDALAKHFKVIAIDQLG 454 RWFRS SNE R+INTVTFD+KEG+PTLVMVHGYGASQGFFFRNFDALA F+VIAIDQLG Sbjct: 86 RWFRSTSNESRYINTVTFDAKEGAPTLVMVHGYGASQGFFFRNFDALASRFRVIAIDQLG 145 Query: 455 WGGSSRPDFTCKSTEETENWFIDSFEEWR*AKNLSNFILLGHSFGGYVAAKYALKHP 625 WGGSSRPDFTC+STEETE WFIDSFEEWR A+NLSNFILLGHSFGGYVAAKYALKHP Sbjct: 146 WGGSSRPDFTCRSTEETEAWFIDSFEEWRKAQNLSNFILLGHSFGGYVAAKYALKHP 202 Score = 39.3 bits (90), Expect(2) = 4e-91 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = +3 Query: 624 PERVQQLILVGPAGFTSQTEHMSERMTQFRA 716 PE VQ LILVG AGF+++ + SE +T+FRA Sbjct: 202 PEHVQHLILVGSAGFSAEADAKSEWLTKFRA 232 >At1g64670.1 expressed protein / ;supported by full-length cDNA: Ceres:11266. Length = 469 Score = 52.4 bits (124), Expect = 2e-07 Identities = 40/128 (31%), Positives = 62/128 (48%), Gaps = 9/128 (7%) Frame = +2 Query: 287 SVSNEPRFINTVTFDSKEGSPTLVMVHGYGASQGFF----FRNFDALAK-HFKVIAIDQL 451 S SN+ F+N + +V +HG+ +S F+ F NF AK +++ +A+D L Sbjct: 163 SSSNQSLFVNVQQPTDNKAQENVVFIHGFLSSSTFWTETLFPNFSDSAKSNYRFLAVDLL 222 Query: 452 GWGGSSRPD---FTCKS-TEETENWFIDSFEEWR*AKNLSNFILLGHSFGGYVAAKYALK 619 G+G S +P+ +T K E E I F L F L+ HS G +A A+K Sbjct: 223 GYGKSPKPNDSLYTLKEHLEMIERSVISQFR-------LKTFHLVAHSLGCILALALAVK 275 Query: 620 HP*ACSAV 643 HP A ++ Sbjct: 276 HPGAIKSL 283 >At5g41900.1 putative protein / strong similarity to unknown protein (gb|AAF19684.1) Length = 471 Score = 52.0 bits (123), Expect = 3e-07 Identities = 39/132 (29%), Positives = 65/132 (48%), Gaps = 10/132 (7%) Frame = +2 Query: 278 WFRSVSNEPRFINTVT-FDSKEGSPTLVMVHGYGASQGFF----FRNFDALAK-HFKVIA 439 W S + + F+ D+K+ +V +HG+ +S F+ F NF AK +++ IA Sbjct: 167 WLTSTNRDSLFVKVQQPKDNKKARDNVVFIHGFVSSSAFWTETLFPNFSDSAKSNYRFIA 226 Query: 440 IDQLGWGGSSRPD---FTCKS-TEETENWFIDSFEEWR*AKNLSNFILLGHSFGGYVAAK 607 +D LG+G S +P+ +T + E E I F+ L F ++ HS G +A Sbjct: 227 VDLLGYGRSPKPNDSLYTLREHLEMIEKSVISKFK-------LKTFHIVAHSLGCILALA 279 Query: 608 YALKHP*ACSAV 643 A+KHP A ++ Sbjct: 280 LAVKHPGAIKSL 291 >At5g38520.1 putative protein / similar to unknown protein (pir||S75227);supported by full-length cDNA: Ceres:22. Length = 362 Score = 48.1 bits (113), Expect = 5e-06 Identities = 29/79 (36%), Positives = 43/79 (53%), Gaps = 4/79 (5%) Frame = +2 Query: 311 INTVTFDSKE----GSPTLVMVHGYGASQGFFFRNFDALAKHFKVIAIDQLGWGGSSRPD 478 +N DS E S T+++VHG+GAS + RN +AL+K+ V AID LG+G S +P Sbjct: 75 VNYFVKDSPEEVTPASQTVLLVHGFGASIPHWRRNINALSKNHTVYAIDLLGFGASDKPP 134 Query: 479 FTCKSTEETENWFIDSFEE 535 + E ++ EE Sbjct: 135 GFSYTMESWAELILNFLEE 153 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,022,907 Number of Sequences: 27288 Number of extensions: 351292 Number of successful extensions: 969 Number of sequences better than 1.0e-05: 8 Number of HSP's better than 0.0 without gapping: 928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 959 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1263366616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247031|gb|BI932559.1|BI932559 EST552448 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23D15 5' end, mRNA sequence (762 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g05385.1 Expressed protein / ; supported by cDNA: gi_13877... 183 1e-46 >At1g05385.1 Expressed protein / ; supported by cDNA: gi_13877958_gb_AF370242.1_AF370242 Length = 199 Score = 183 bits (464), Expect = 1e-46 Identities = 96/151 (63%), Positives = 117/151 (76%), Gaps = 2/151 (1%) Frame = +2 Query: 314 GFASPLVSLLTYSCSLKV--LPAWAEDQEIQDKDESVVGAIKSLFDPNETTKSGKVLPKA 487 GF +V ++ +++ L A A ++++ D+ E VVGA K+LFDPNE TKSGK LPKA Sbjct: 43 GFLKCVVGASSFMATIEFSGLQAQASEEKL-DEGEGVVGAFKTLFDPNERTKSGKELPKA 101 Query: 488 YLNSVREVVKTLRESLKEDPNDMSKFRRTADAAKESIREYLGGWRGQKSVVNEESYVLLE 667 YL S REVVKT+RESLKE+P D +KFRR+ADAAKESIR+YL WRGQK+V EESYV LE Sbjct: 102 YLKSAREVVKTMRESLKENPKDNAKFRRSADAAKESIRDYLSNWRGQKTVAGEESYVELE 161 Query: 668 KAIRSLASFYSKAGPSAALPERVKSEILDDL 760 IR+LA FYSKAGPSA LP+ VK+EILDDL Sbjct: 162 NVIRALAKFYSKAGPSAPLPDEVKTEILDDL 192 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,216,542 Number of Sequences: 27288 Number of extensions: 354682 Number of successful extensions: 1092 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1064 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1092 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1383666960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246978|gb|BI932506.1|BI932506 EST552395 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23I18 5' end, mRNA sequence (688 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16810.1 hypothetical protein / 201 3e-52 >At5g16810.1 hypothetical protein / Length = 351 Score = 201 bits (511), Expect = 3e-52 Identities = 115/203 (56%), Positives = 136/203 (66%), Gaps = 23/203 (11%) Frame = +3 Query: 48 GLRLNLNSNINRTIRPRQAFVGLCVASLITDSDSFEVGRLIGSYGFMNVTS--------- 200 G R+ + NR IR A ASLIT +DSFEVGRLIGSYGFMNVTS Sbjct: 30 GCRIVNSRGRNRPIRRLHAVT----ASLITSADSFEVGRLIGSYGFMNVTSFTLLSAAVF 85 Query: 201 --------------YSGLQSGMAMDYAVSEDIGNFKVQDIGEGSVKIRLYEGRVAQGPLR 338 Y+GLQSG +Y S+DIG K QDIGEG+VKIRLY+GR++QGP R Sbjct: 86 YFVYLAFHHFYTPSYTGLQSGSDFEYT-SDDIGRLKSQDIGEGAVKIRLYQGRISQGPFR 144 Query: 339 GTRVIFKVYPGQQVGGTEADMMAANELNAHASLQSNPKDICPHIQALLGGFETKTGEQWL 518 GT V+FKVYPGQ+ GG EADMMAANELNAH+ LQS K + ++ L+GGFET+ GEQWL Sbjct: 145 GTPVVFKVYPGQRAGGVEADMMAANELNAHSFLQS--KSLPANLLLLVGGFETQLGEQWL 202 Query: 519 AFRDIGKYSAADYAKITSENMSK 587 AFRD GK SAADYA+ SE ++ Sbjct: 203 AFRDGGKDSAADYAQTASEKTTR 225 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,085,681 Number of Sequences: 27288 Number of extensions: 333572 Number of successful extensions: 962 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 959 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1174397136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246952|gb|BI932480.1|BI932480 EST552369 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23E12 5' end, mRNA sequence (717 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g36630.1 hypothetical protein / ; supported by cDNA: gi_20... 298 2e-81 >At4g36630.1 hypothetical protein / ; supported by cDNA: gi_20466825 Length = 519 Score = 298 bits (763), Expect = 2e-81 Identities = 142/230 (61%), Positives = 177/230 (76%), Gaps = 1/230 (0%) Frame = +3 Query: 30 MVHTAYDTFQLLNNSPSKIDAIESYRSNLLIACSDGSLRVYVP-ESSVSDQSDFHSETLG 206 MVH AYD+FQLL + P++IDA+ESY S L C DGSLR+Y P ESS SD S+ H ET Sbjct: 1 MVHNAYDSFQLLKDCPARIDAVESYGSKLFAGCYDGSLRIYSPPESSASDPSELHQET-- 58 Query: 207 LHQGPYVLERTLNGFSRRQMLAMXXXXXXXXXXXXXXXIALHRLPDLETLSVITKAKGAN 386 YVLE+T+ GFS++ ++AM IA H LP+LET++VITKAKGAN Sbjct: 59 -----YVLEKTVAGFSKKPIVAMEVLASRELLLSLSESIAFHGLPNLETVAVITKAKGAN 113 Query: 387 VYSWDDKRGLLCFGRQKRVCIYKHDGGSGFVEVKEFGVPDTVKSMSWCGENICLGIRREY 566 YSWDD+RG LCF RQKRVC++KHDGG GFVEV+++GVPDTVKS+SWCGENICLGI++EY Sbjct: 114 AYSWDDRRGFLCFSRQKRVCVFKHDGGGGFVEVRDYGVPDTVKSISWCGENICLGIKKEY 173 Query: 567 KILNTTNGVLSEVFSSGRIAAPLVVALPPGELLLGQDNIGILVNKTGKLI 716 ILNT NG LSEVF SGR+A PLV++LP GEL+LG++NIG+ V++ GKL+ Sbjct: 174 VILNTANGTLSEVFPSGRVAPPLVISLPSGELILGKENIGVFVDQNGKLL 223 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,382,134 Number of Sequences: 27288 Number of extensions: 414029 Number of successful extensions: 1149 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1093 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1147 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1263366616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246942|gb|BI932470.1|BI932470 EST552359 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23C12 5' end, mRNA sequence (751 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g15980.1 expressed protein / ;supported by full-length cDN... 349 1e-96 >At1g15980.1 expressed protein / ;supported by full-length cDNA: Ceres:122986. Length = 461 Score = 349 bits (895), Expect = 1e-96 Identities = 175/251 (69%), Positives = 193/251 (76%), Gaps = 2/251 (0%) Frame = +1 Query: 4 ISPFFANPPNFPVTHVTNVP--FLNHNPSFPARKSGNFCLNAKKKNPWLDPFDYGDDPEM 177 ISPFF PP T+ P FLN +R S KK NPWLDPFD G+DP+ Sbjct: 12 ISPFFKTPP-----FSTSKPLVFLNFQTRLTSRSSDVSVNLKKKNNPWLDPFDSGEDPDN 66 Query: 178 EYGSLFSEGKQXXXXXXXXXXXXXYGFLKFPMGYSVEIASLGLKIRGDVRRCCCVIDGGV 357 EYGSLF++GKQ YGFLKFP GY+VE+ASL LKIRGDVRRCCCVI GGV Sbjct: 67 EYGSLFADGKQDEDPRPPDNPDNPYGFLKFPKGYTVELASLPLKIRGDVRRCCCVISGGV 126 Query: 358 YENLLFFPVIQMIKDRYPGVQVDILATARGKQTFEMNKNVRWANAYDLDDDFPEPAEYTD 537 YENLLFFP IQ+IKDRYPGVQVDIL T RGKQT+E+NKNVRWAN YD DD +PEPAEYTD Sbjct: 127 YENLLFFPTIQLIKDRYPGVQVDILTTERGKQTYELNKNVRWANVYDPDDHWPEPAEYTD 186 Query: 538 MLGILKSRYYDMILSTKLAGIGHAVFLFMSTARDRVSYIYPNVNSAGAGLFLSETFTPES 717 M+G+LK RYYDM+LSTKLAG+GHA FLFM+TARDRVSYIYPNVNSAGAGL LSETFT E+ Sbjct: 187 MIGLLKGRYYDMVLSTKLAGLGHAAFLFMTTARDRVSYIYPNVNSAGAGLMLSETFTAEN 246 Query: 718 MNLSEGGYHMY 750 NLSE GY MY Sbjct: 247 TNLSELGYSMY 257 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,320,843 Number of Sequences: 27288 Number of extensions: 345375 Number of successful extensions: 921 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 919 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246915|gb|BI932443.1|BI932443 EST552332 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23M21 5' end, mRNA sequence (769 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74470.1 geranylgeranyl reductase / identical to geranylge... 437 e-123 >At1g74470.1 geranylgeranyl reductase / identical to geranylgeranyl reductase GB:Y14044 [Arabidopsis thaliana] (involvement: chlorophyll, the tocopherol and the phylloquinone pathways Eur J Biochem 1998 Jan 15;251(1-2):413-7); supported by cDNA: gi_15292918_gb_AY050893.1_ Length = 467 Score = 437 bits (1124), Expect = e-123 Identities = 212/254 (83%), Positives = 230/254 (90%) Frame = +2 Query: 2 KPCGGAIPLCMVGEFDLPLDIIDRKVTKMKMISPSNVAVDIGQTLKPHEYIGMVRREVLD 181 KPCGGAIPLCMVGEF+LPLDIIDR+VTKMKMISPSN+AVDIG+TLK HEYIGMVRREVLD Sbjct: 92 KPCGGAIPLCMVGEFNLPLDIIDRRVTKMKMISPSNIAVDIGRTLKEHEYIGMVRREVLD 151 Query: 182 AYLRDRAAEAGASVLNGLFLRMDMPKAPNSPYVLHYTSYDSKTNGAGEKCTLEVDAVIGA 361 AYLR+RA ++GA+V+NGLFL+MD P+ +SPY LHYT YD KT G K T+EVDAVIGA Sbjct: 152 AYLRERAEKSGATVINGLFLKMDHPENWDSPYTLHYTEYDGKTGATGTKKTMEVDAVIGA 211 Query: 362 DGANSRVAKSINAGDYEYAIAFQERIRISDDKMKYYENLAEMYVGDDVSPDFYGWVFPKC 541 DGANSRVAKSI+AGDY+YAIAFQERIRI D+KM YYE+LAEMYVGDDVSPDFYGWVFPKC Sbjct: 212 DGANSRVAKSIDAGDYDYAIAFQERIRIPDEKMTYYEDLAEMYVGDDVSPDFYGWVFPKC 271 Query: 542 DHVAVGTGTVTHKADIKKFQLATRLRADSKITGGKIIRVEAHPIPEHPRPRRLQDRVALV 721 DHVAVGTGTVTHK DIKKFQLATR RA KI GGKIIRVEAHPIPEHPRPRRL RVALV Sbjct: 272 DHVAVGTGTVTHKGDIKKFQLATRNRAKDKILGGKIIRVEAHPIPEHPRPRRLSKRVALV 331 Query: 722 GDAAGYVTKCQAKG 763 GDAAGYVTKC +G Sbjct: 332 GDAAGYVTKCSGEG 345 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,400,010 Number of Sequences: 27288 Number of extensions: 391715 Number of successful extensions: 1127 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1091 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1127 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1401406280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246874|gb|BI932402.1|BI932402 EST552291 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23E13 5' end, mRNA sequence (697 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27340.1 hypothetical protein / predicted by genemark.hmm 170 6e-43 >At3g27340.1 hypothetical protein / predicted by genemark.hmm Length = 141 Score = 170 bits (431), Expect = 6e-43 Identities = 78/112 (69%), Positives = 97/112 (85%) Frame = +3 Query: 33 PRLTRFALQPPKFVEVEFENGSLYKLSAEYLRIYSPAVDSKIRSICGEKVISGRRHVGIM 212 P+L+ F++ PK VEVE+ +G+ + S+E+LRI+SPA D K+RSI GEKVISGRR+VGIM Sbjct: 21 PKLSGFSIVSPKQVEVEYADGTKFNFSSEFLRIHSPAADGKVRSIGGEKVISGRRYVGIM 80 Query: 213 SAEPIGNYGVRLLFDDLHKTGIFTWDYFYHLGSNKFALMRNYIRTLKKHGLS 368 SAEP+GNYGVRL+FDDLH+TGI+ WDYFY LGSNKF LMRNYI+TL+KH LS Sbjct: 81 SAEPVGNYGVRLVFDDLHRTGIYPWDYFYELGSNKFGLMRNYIKTLQKHNLS 132 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,721,318 Number of Sequences: 27288 Number of extensions: 301141 Number of successful extensions: 661 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 661 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1201087980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246799|gb|BI932327.1|BI932327 EST552216 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC22F8 5' end, mRNA sequence (702 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g21200.1 expressed protein / ;supported by full-length cD... 255 2e-68 >At3g21200.1 expressed protein / ;supported by full-length cDNA: Ceres:39041. Length = 317 Score = 255 bits (651), Expect = 2e-68 Identities = 125/207 (60%), Positives = 160/207 (76%), Gaps = 3/207 (1%) Frame = +3 Query: 81 PIVRNSHGKPFPAEVSRTILELSSVGTLSTPTQDGWPLGIAVPFAVDPHGTPLLFLNHST 260 P ++H KPFPAEVSR+I+ELSSVGTLST T DGWPLG+ V FAVD GTP+L LN S Sbjct: 51 PATASTH-KPFPAEVSRSIMELSSVGTLSTLTHDGWPLGVGVRFAVDKDGTPVLCLNRSV 109 Query: 261 SNFALNSKSSFLVQLQQYGLRTPQCTIQGTLQKP---TALKMLHSLWENRFGHQVDDDRL 431 S + +S+ VQL+Q GLRTPQCTIQG++ +P T LK L + W +FG +V +D L Sbjct: 110 SP---DKRSALHVQLEQCGLRTPQCTIQGSIGRPGDDTVLKRLSATWREKFGEEVKEDSL 166 Query: 432 FLLSVERVLQMDDFAEDGIWVTSEEYKSANPDPLRDFAERMIDEINTNNREDILRFCNIY 611 ++++V+RVLQM+DF EDGIWV S +YK+A+PDPLRD AE ++++IN NN EDI RFCN+Y Sbjct: 167 YVVAVDRVLQMEDFMEDGIWVASSDYKNASPDPLRDIAEDIVNQINANNMEDIFRFCNVY 226 Query: 612 LDLDFQVCDGKMLWGDRLGFDVRVSSP 692 +DLDF V + KM+W DRLGFD+RV SP Sbjct: 227 VDLDFVVSETKMIWMDRLGFDLRVWSP 253 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,914,125 Number of Sequences: 27288 Number of extensions: 349093 Number of successful extensions: 1026 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 984 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1022 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1218881876 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246783|gb|BI932311.1|BI932311 EST552200 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC22P19 5' end, mRNA sequence (764 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53070.1 putative protein / contains similarity to ribosom... 210 8e-55 >At5g53070.1 putative protein / contains similarity to ribosomal protein L9 Length = 221 Score = 210 bits (534), Expect = 8e-55 Identities = 116/215 (53%), Positives = 148/215 (67%), Gaps = 4/215 (1%) Frame = +1 Query: 97 MACLQYGRNTLRQQLKNVKTPAAIFQNCEGGEVHLHHPLFYAAQGVRYRKLQVILTTGID 276 MA + RN +R +V + + E +HHPL +A QGVRYRKL+VILTTGI+ Sbjct: 1 MAYVGQSRNVIR----HVVSRGTAYHKYENA---IHHPLLFACQGVRYRKLEVILTTGIE 53 Query: 277 KLGKAGETVRVAPGYFRNHLMPKLLAVPNIDKYRHLMEDQRKIYQREEV-EEVKIVPATK 453 KLGKAGETV+VAPGYFRNHLMPKLLAVPNIDKY +L+ +QRK+Y EEV EEVK+V T Sbjct: 54 KLGKAGETVKVAPGYFRNHLMPKLLAVPNIDKYAYLIREQRKMYNHEEVKEEVKVVHKTS 113 Query: 454 EDKMKEYQMAANRLDRTMLVLRKLAKKPLAKD---DNGRTFIQESIGKDEIVAEVARQIS 624 E + KEY+ AA RL LVLRKL K K+ + + +Q I K+EIV+EVARQ+ Sbjct: 114 EVQTKEYEKAAKRLANANLVLRKLVDKEKFKNRSSKDDKPDVQTPITKEEIVSEVARQLC 173 Query: 625 VHIEPEHLVLDTPLHVMGEFESPLRMPRVIHLQKG 729 V I+P+++VL PL GE+E PL+ P+ I L +G Sbjct: 174 VKIDPDNVVLAAPLETFGEYEVPLKFPKTIPLPQG 208 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,458,806 Number of Sequences: 27288 Number of extensions: 394824 Number of successful extensions: 1149 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1099 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1145 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1392536620 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246781|gb|BI932309.1|BI932309 EST552198 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC22P15 5' end, mRNA sequence (767 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g08960.1 hypothetical protein / similar to hypothetical pr... 285 2e-77 >At3g08960.1 hypothetical protein / similar to hypothetical proteins: GB:S61997, [Saccharomyces cerevisiae], GB:CAA22859 [Schizosaccharomyces pombe] Length = 754 Score = 285 bits (728), Expect = 2e-77 Identities = 140/228 (61%), Positives = 172/228 (75%), Gaps = 2/228 (0%) Frame = +2 Query: 2 LCVRLTACRSLYYHIEDATFNENEFLDLLPVCWDLCFKVVDEVQEFDSKVQVLNTISVLI 181 L V+L A RSL H+EDA F+E FLDLLP+CWD CFK+V+ VQEFDSKVQ+LN IS LI Sbjct: 509 LAVKLAASRSLCLHVEDANFSEQSFLDLLPICWDSCFKMVEVVQEFDSKVQILNLISTLI 568 Query: 182 ARVTEITPYANKLMLFFQKAWXXXXXXXXXXXXXXTALKNFVVALGYQSPKSYGMLLPIL 361 V+E+ PYA KL+ FFQK W AL+NFV+ALGYQSP Y +LLPIL Sbjct: 569 GHVSEVIPYAQKLVQFFQKVWEESSGESLLQIQLLVALRNFVIALGYQSPICYSILLPIL 628 Query: 362 RSGINITSPD--ELLEDCMQLWEATLINAPSMVPELLGYFPCLVEILERSFDHLKVATNI 535 + GI+I SPD LLED M LWE TL AP MVP+LL FP +VEI+ERSFDHL+VA +I Sbjct: 629 QKGIDINSPDSLNLLEDSMALWETTLSYAPMMVPQLLALFPYMVEIIERSFDHLQVAVSI 688 Query: 536 IEDYVILGGREFLSLHASNIAKLLDLVVGNVNDRGLLSVIPVIDISSQ 679 ++ Y+IL G EFL++HAS++AK+LDL+VGNVND+GLLS++PVIDI Q Sbjct: 689 MDSYIILDGGEFLNMHASSVAKILDLIVGNVNDKGLLSILPVIDILVQ 736 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,349,640 Number of Sequences: 27288 Number of extensions: 345689 Number of successful extensions: 890 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 863 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 889 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1401406280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246737|gb|BI932265.1|BI932265 EST552154 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC22H7 5' end, mRNA sequence (728 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26200.1 hypothetical protein / ; supported by cDNA: gi_1... 182 2e-46 >At2g26200.1 hypothetical protein / ; supported by cDNA: gi_13605538 Length = 313 Score = 182 bits (461), Expect = 2e-46 Identities = 100/175 (57%), Positives = 114/175 (65%), Gaps = 2/175 (1%) Frame = +3 Query: 3 GICSMVAVRSANLVVTTDGDTKXXXXXXXXXXXXXXXXXXXRLITKKLEWGNTDDVESIK 182 GICSMVA RSANLVV TD DTK +L T LEWGN + +ESIK Sbjct: 137 GICSMVAARSANLVVATDADTKALTLLTENITMNLQSSLLGKLKTSVLEWGNKEHIESIK 196 Query: 183 RLNDRGFDVIIGTDVSYIAEAIAPLFSTAKELIRPSRGD--EEDSTPALILCHVIRRVDE 356 RL GF+VI+GTDV+Y+AEAI PLF TAKELI GD E PALILCHV RRVDE Sbjct: 197 RLACEGFEVIMGTDVTYVAEAIIPLFETAKELILRKMGDDLEVQEKPALILCHVFRRVDE 256 Query: 357 PSILSTASEFGFRLVDRWPNALXXXXXXQNIIQSWFSDGSLETCIPTTALNILYF 521 PS+LS AS+FGF+L DRW A NII SWFS+ L IP++AL+ILYF Sbjct: 257 PSLLSAASKFGFKLADRWA-ANSKESPIGNIIDSWFSEKDLVAEIPSSALHILYF 310 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,184,063 Number of Sequences: 27288 Number of extensions: 316941 Number of successful extensions: 713 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1286100700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246714|gb|BI932242.1|BI932242 EST552131 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC22B21 5' end, mRNA sequence (665 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g19140.1 expressed protein / ;supported by full-length cDN... 173 8e-44 >At1g19140.1 expressed protein / ;supported by full-length cDNA: Ceres:37735. Length = 311 Score = 173 bits (438), Expect = 8e-44 Identities = 102/204 (50%), Positives = 132/204 (64%), Gaps = 4/204 (1%) Frame = +1 Query: 64 MYRSAAKRLLPA--FYRRRQDAVSCIRT--LAADYPTRFMTSAATGNIPDQNPIPVNPIL 231 MYR+AAKRLL R + +R+ + + Y + TS+ GN ++P+ + Sbjct: 1 MYRTAAKRLLAGGGITTTRLLRLPKLRSTIIPSSYTSGLCTSSIGGNT--ESPMGKQSVN 58 Query: 232 XXXXXXXXXXXXXWKEEERTRFQDTDAKSSSRTKRPKAHYKDEEALVLSASLSHVIRLGW 411 E +R +++P+A +++E+A VLSASL HV RLGW Sbjct: 59 PNQSGPTASSSTGTGEGQRRH----------ESRKPRAEFQEEQARVLSASLRHVPRLGW 108 Query: 412 TETAMIAGARDVGVSPSIVGSFPRKEAALVEYFMDECLERLIDIIESRNDLNNLIPSERI 591 TE AM+AG+RDVGVSPSIVGSF RKEAALVE+FMDECL+ L+D I+S DL NLIPSERI Sbjct: 109 TEEAMMAGSRDVGVSPSIVGSFSRKEAALVEFFMDECLQLLMDRIDSGLDLQNLIPSERI 168 Query: 592 AKLVRIRLEMQTPYISKWPQALSI 663 +KL+RIRLEMQ PY+SKWPQALSI Sbjct: 169 SKLIRIRLEMQVPYMSKWPQALSI 192 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,267,022 Number of Sequences: 27288 Number of extensions: 266086 Number of successful extensions: 735 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 734 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1112118500 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246668|gb|BI932196.1|BI932196 EST552085 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC22G24 5' end, mRNA sequence (715 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79975.1 Expressed protein / ; supported by full-length cD... 248 3e-66 >At1g79975.1 Expressed protein / ; supported by full-length cDNA: Ceres: 7260. Length = 152 Score = 248 bits (632), Expect = 3e-66 Identities = 111/151 (73%), Positives = 130/151 (85%) Frame = +3 Query: 129 MFYGTAVWDPWLIVAQIVCFQCLYYLTLGIFMTILVGTRVSRISLVYFFDYATVTASTVT 308 MFYGTAVWDPWLIV QI+C QC YYLTLG+F + +G RV R+SLVYFFDYAT+T ST T Sbjct: 1 MFYGTAVWDPWLIVGQIICLQCSYYLTLGLFTMVFLGLRVPRLSLVYFFDYATLTTSTFT 60 Query: 309 GWCVIASFILSSLAGAGFLLYLIERAKKCLDFSATLYIVHLLICIIYGGWPSSITWWVVN 488 GW VIASF+ SSLAGA ++++L+ERA+KCLDFSATLYI+HL CI+YGGWPSS+ WWVVN Sbjct: 61 GWSVIASFLFSSLAGAVYMIFLVERARKCLDFSATLYIIHLFFCIMYGGWPSSMAWWVVN 120 Query: 489 VTGLAVMALLGEYLCIRRELREIPISKFRSR 581 TGLAVMALL EYLCI+RE REIP+ +F SR Sbjct: 121 GTGLAVMALLAEYLCIKREQREIPMDRFHSR 151 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,064,989 Number of Sequences: 27288 Number of extensions: 322930 Number of successful extensions: 878 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 878 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1254469668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246634|gb|BI932162.1|BI932162 EST552051 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC22A6 5' end, mRNA sequence (713 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32770.1 putative protein / predicted protein, Synechocyst... 243 1e-64 >At4g32770.1 putative protein / predicted protein, Synechocystis sp., PIR2:S74814; supported by cDNA: gi_14334011_gb_AF302188.1_AF302188 Length = 488 Score = 243 bits (619), Expect = 1e-64 Identities = 115/186 (61%), Positives = 140/186 (74%), Gaps = 1/186 (0%) Frame = +2 Query: 158 AVLKLQSQKSRHAFVVKADSAVDTTKKE-NREPVKPVYSSTPSNRPLRTPHSGYHFDGST 334 +++ +S K + + +++ T E ++ VKPVY T NR LRTPHSGYHFDG+ Sbjct: 29 SLVPFRSTKLVPRSISRVSASISTPNSETDKISVKPVYVPTSPNRELRTPHSGYHFDGTP 88 Query: 335 RKFFEGWFFKVSIPECRQSFCFMYSVESPSFTKKLSSLEELQYGPRFTGVGAQILGADDK 514 RKFFEGW+F+VSIPE R+SFCFMYSVE+P+F + LS LE YGPRFTGVGAQILGA+DK Sbjct: 89 RKFFEGWYFRVSIPEKRESFCFMYSVENPAFRQSLSPLEVALYGPRFTGVGAQILGANDK 148 Query: 515 YICQYSEESSNFWGSRHELMLGNTFVAQNSAKPSNKEVSPQEFNRCVTEGFQVTPLWHQG 694 Y+CQY ++S NFWG RHEL+LGNTF A AK NKEV P+EFNR V+EGFQ TP WHQG Sbjct: 149 YLCQYEQDSHNFWGDRHELVLGNTFSAVPGAKAPNKEVPPEEFNRRVSEGFQATPFWHQG 208 Query: 695 SIRDDG 712 I DDG Sbjct: 209 HICDDG 214 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,044,041 Number of Sequences: 27288 Number of extensions: 318116 Number of successful extensions: 902 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 902 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1254469668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246550|gb|BI932078.1|BI932078 EST551967 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC21P14 5' end, mRNA sequence (701 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g51050.1 putative protein / hypothetical protein L1648.04 ... 339 4e-98 >At3g51050.1 putative protein / hypothetical protein L1648.04 - Leishmania major, EMBL:LMFL1648; supported by cDNA: gi_18087607 Length = 698 Score = 339 bits (869), Expect(2) = 4e-98 Identities = 160/186 (86%), Positives = 178/186 (95%) Frame = +1 Query: 52 MRKRDLAILMLSAFAIFFSLQHEGDLSFKEAWYHLFEEYPIKYEAERLPPPIVADLNGDG 231 MRKRDLAILMLS FAIFF+LQHEGD +FKEAW+HL++EYP+KYEA+RLPPPIVADLNGDG Sbjct: 1 MRKRDLAILMLSGFAIFFTLQHEGDFAFKEAWFHLYDEYPVKYEADRLPPPIVADLNGDG 60 Query: 232 KKEVLVATHDAKIQVLEPHSRRVDEGFSEARLLAEVSLLPDKIRIVSGRRAVAMATGVID 411 KKEVLVAT+DAKIQVLEPHSRRVDEGFSEAR+LAE++LLPDKIR+ SGRRAVAMATGVID Sbjct: 61 KKEVLVATNDAKIQVLEPHSRRVDEGFSEARVLAEITLLPDKIRVASGRRAVAMATGVID 120 Query: 412 RNYNHREPRKQVLVVVTSGWSVMCFDHNLKKLWEVNLQEDFPHNAHHREIAISISNYTVK 591 R Y + P+KQV+VVVTSGWSV+CFDHNLKKLWE NLQEDFPHNAHHREIAISISNYT+K Sbjct: 121 RYYKNGTPQKQVVVVVTSGWSVLCFDHNLKKLWETNLQEDFPHNAHHREIAISISNYTLK 180 Query: 592 HGDSGL 609 HGD+GL Sbjct: 181 HGDTGL 186 Score = 37.0 bits (84), Expect(2) = 4e-98 Identities = 16/28 (57%), Positives = 21/28 (74%) Frame = +2 Query: 617 VGGRMEMQPHMHIDPIERD*MAEKSAEQ 700 VGGRMEMQP+ H+DP E M ++A+Q Sbjct: 189 VGGRMEMQPYNHMDPFEELGMTAQNADQ 216 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,959,553 Number of Sequences: 27288 Number of extensions: 367855 Number of successful extensions: 938 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 911 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 937 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1218881876 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246504|gb|BI932032.1|BI932032 EST551921 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC21H4 5' end, mRNA sequence (741 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g33410.1 unknown protein / 311 2e-85 >At1g33410.1 unknown protein / Length = 1459 Score = 311 bits (798), Expect = 2e-85 Identities = 159/257 (61%), Positives = 192/257 (73%), Gaps = 11/257 (4%) Frame = +2 Query: 2 GLHGLKKERKISEAVRCFFRAASVEGAANALQSLPNEAGWLHLGFSQQV-----SPAAWK 166 G G+ +ERKI +A+RCFFRA+S EG+ AL SL EAG+ + S AAWK Sbjct: 875 GASGILRERKIIDAIRCFFRASSGEGSWKALHSLSKEAGFSPATTGPSILDGSTSSAAWK 934 Query: 167 LHYYQWAMQIFEQHNMREAACQFALAALEQVDEALGSGVLDE------SATAVKGRLWAN 328 LHYY+WAMQIFE++N+ E ACQFA AALEQVD+A + E +AT +GRLWAN Sbjct: 935 LHYYEWAMQIFERYNISEGACQFAYAALEQVDDAYNFIEMTEEFDPTKAATYTRGRLWAN 994 Query: 329 VFKFTLDLNYYYDAYCAIISNPDEESKTICLRRFIIVLYERGAVKILCDGQLPFIGLSEK 508 VFKFTLDLN DAYCAIISNPDEE K ICLRRFIIVL+E G KIL DG LPFIGL+EK Sbjct: 995 VFKFTLDLNLLNDAYCAIISNPDEEIKRICLRRFIIVLFECGKTKILSDGHLPFIGLTEK 1054 Query: 509 VERELAWKAERSDVSAKPNPFKLLYAFAMQRHNWRRAASYIYLYSAQLRNHGATQDLQRR 688 + +EL WKA RSD+ KPNP+KLLYA+ M+RHNWR AASY+Y +SA+LR+ GA +D + Sbjct: 1055 ITQELFWKAGRSDIMMKPNPYKLLYAYEMRRHNWRMAASYMYQFSARLRSEGACKDYKHM 1114 Query: 689 SFILQEKLNGLSAAINA 739 S +LQE+LNGLSAA+NA Sbjct: 1115 SLVLQERLNGLSAAMNA 1131 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,229,483 Number of Sequences: 27288 Number of extensions: 300352 Number of successful extensions: 834 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 832 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1321579340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query=