BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18815472|gb|BM536226.1|BM536226 EST589248 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG71P24 5' end, mRNA sequence (133 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g43690.1 unknown protein / ; supported by cDNA: gi_17978984 71 1e-13 >At1g43690.1 unknown protein / ; supported by cDNA: gi_17978984 Length = 599 Score = 70.9 bits (172), Expect = 1e-13 Identities = 30/38 (78%), Positives = 34/38 (88%) Frame = +1 Query: 19 VEVGFITLLESLNFCKVGLHLKCPAWQ*WVVGSESHYT 132 V+VGF+TLLESLNFCKVG +LKCP W WV+GSESHYT Sbjct: 363 VDVGFLTLLESLNFCKVGQNLKCPKWPIWVIGSESHYT 400 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,812,131 Number of Sequences: 27288 Number of extensions: 32871 Number of successful extensions: 98 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 11,516,596 effective HSP length: 19 effective length of database: 10,998,124 effective search space used: 263954976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18815386|gb|BM536175.1|BM536175 EST589197 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG71B2 5' end, mRNA sequence (524 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g43640.1 putative signal recognition particle protein 14kD, A... 167 4e-42 >At2g43640.1 putative signal recognition particle protein 14kD, ATSRP14 / ; supported by full-length cDNA: Ceres: 97249. Length = 121 Score = 167 bits (422), Expect = 4e-42 Identities = 81/118 (68%), Positives = 99/118 (83%) Frame = +2 Query: 26 MVRLQPDPFLNELTSMFERTTEHGSVWVTLKHSSDKSKAQRNKMKTAGETLEFKCLIRAT 205 MV LQ DPFLNELTSMFE++ E GSVWVTLK SS KSK Q+ K+ + GE++E++CLIRAT Sbjct: 1 MVLLQLDPFLNELTSMFEKSKEKGSVWVTLKRSSLKSKVQKRKLSSVGESIEYRCLIRAT 60 Query: 206 DGKKNISTMVGAKDHQRFQASYAILLKARLTALKKRERKDKRKATDSDKKMDISKKKS 379 DGKK +ST VGAKDHQRFQASYA +LKA +TALKKRERKD++K+T+++KK S KS Sbjct: 61 DGKKTVSTSVGAKDHQRFQASYATILKAHMTALKKRERKDRKKSTEAEKKESTSTTKS 118 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,956,204 Number of Sequences: 27288 Number of extensions: 262609 Number of successful extensions: 1031 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 930 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1022 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 727283772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18815158|gb|BM536049.1|BM536049 EST589071 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG71A12 5' end, mRNA sequence (661 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g63810.1 hypothetical protein / similar to hypothetical pr... 146 8e-60 >At1g63810.1 hypothetical protein / similar to hypothetical protein GB:CAA22881 [Schizosaccharomyces pombe] Length = 1026 Score = 146 bits (368), Expect(2) = 8e-60 Identities = 83/162 (51%), Positives = 103/162 (63%), Gaps = 18/162 (11%) Frame = +3 Query: 3 KTAFLLRIAE-------------SLQNNWGMMFTATEDDVDVLMSGYAFRLKISHERALG 143 K+AFLL+IAE +LQN G+ TATED+VDV + GYAFRL+I HER L Sbjct: 625 KSAFLLKIAERWVKLLFVTLQTINLQNVKGIPCTATEDNVDVFIGGYAFRLRILHERGLS 684 Query: 144 LVTGQSNNSRH-----QWSLSADRKLLLQHQHASKINALRGRYPIYGPIVRLAKRWVSAH 308 LV +S S + S D+ L ++ QHAS IN L+GR+P+Y P+ RLAKRWVSAH Sbjct: 685 LVKRESEFSSFGVDPVKHVSSTDKMLFIRSQHASMINGLQGRFPVYAPVARLAKRWVSAH 744 Query: 309 LLSTVLTEEAVELLVSNLFLRPLPFEPPFSRITGFFEVLTII 434 L S L EEA+ELLV+ LFL PLP P SRI GF L ++ Sbjct: 745 LFSGCLAEEAIELLVAYLFLTPLPLGVPSSRINGFLRFLRLL 786 Score = 102 bits (253), Expect(2) = 8e-60 Identities = 48/83 (57%), Positives = 61/83 (72%) Frame = +1 Query: 412 FLRFLRLLSEYDWAFSPLIVDFDGDFSTEEKNKINENFMRSREEHEKDTQKSSPAMFLAT 591 FLRFLRLL++Y+W F PLIVD + DF ++ +IN+NFM SR+ +E+D Q S AMFLA Sbjct: 779 FLRFLRLLADYEWMFYPLIVDINNDFGRNDEKEINDNFMSSRKGYEEDKQNISSAMFLAA 838 Query: 592 KYDVASEAWTRSSPTTAELRRLV 660 YD ASEAWT +SP E +RLV Sbjct: 839 PYDKASEAWTSTSPNLLEQKRLV 861 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,848,747 Number of Sequences: 27288 Number of extensions: 297124 Number of successful extensions: 960 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 959 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1106605264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18814903|gb|BM535903.1|BM535903 EST588925 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG70I17 5' end, mRNA sequence (623 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13040.1 hypothetical protein / 125 2e-29 >At4g13040.1 hypothetical protein / Length = 196 Score = 125 bits (313), Expect = 2e-29 Identities = 60/83 (72%), Positives = 69/83 (82%), Gaps = 3/83 (3%) Frame = +1 Query: 382 EQTAQQFPEVKRRKRHRRKHFENQEPCLMRGVYFKNMKWQAAIKVDKKQIHLGTVGTQEE 561 + + ++ KRRK+HRRK NQEPCLMRGVY+KNMKWQAAIKV+KKQIHLGT +QEE Sbjct: 59 DSISPKYQPPKRRKQHRRKRVHNQEPCLMRGVYYKNMKWQAAIKVEKKQIHLGTFSSQEE 118 Query: 562 AARL---AAFMCGKEPNFELSEE 621 AARL AAFMCG+EPNFELSEE Sbjct: 119 AARLYDRAAFMCGREPNFELSEE 141 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,470,916 Number of Sequences: 27288 Number of extensions: 320377 Number of successful extensions: 936 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 911 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 934 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 999514432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18814463|gb|BM535648.1|BM535648 EST588670 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG67J13 5' end, mRNA sequence (589 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g07910.1 translation elongation factor EF-1 alpha / identi... 317 2e-87 >At1g07910.1 translation elongation factor EF-1 alpha / identical to GB:AAB07881 from [Arabidopsis thaliana] (Mol. Gen. Genet. 219 (1-2), 106-112 (1989)) Length = 1081 Score = 317 bits (813), Expect = 2e-87 Identities = 144/195 (73%), Positives = 175/195 (88%) Frame = +1 Query: 1 IAPSSPNISSKDMVSKNEGLIVFFPGIPGCAKSALCKEILNAPGGLEDDRPIHSLMGDLI 180 + P++P + K+ V K+EGLIVFFPGIPG AKSALCKE+LNAPGG DDRP+H+LMGDL+ Sbjct: 646 VTPATPEPAVKEAVQKDEGLIVFFPGIPGSAKSALCKELLNAPGGFGDDRPVHTLMGDLV 705 Query: 181 KGRYWQKVADERRRKPYSIMLADKNAPNEEVWKQIENMCLSTKASAIPVIPDSEGTEINP 360 KG+YW KVADERR+KP SIMLADKNAPNE+VW+QIE+MC T+ASA+P++ DSEGT+ NP Sbjct: 706 KGKYWPKVADERRKKPQSIMLADKNAPNEDVWRQIEDMCRRTRASAVPIVADSEGTDTNP 765 Query: 361 FSIDALAVFIFRVLQRVNHPGNLDKSSPNAGYVMLMFYHLYDGKSRQEFESELIERFGSL 540 +S+DALAVF+FRVLQRVNHPG LDK S NAGYV+LMFYHLY+GK+R EFESELIERFGSL Sbjct: 766 YSLDALAVFMFRVLQRVNHPGKLDKESSNAGYVLLMFYHLYEGKNRNEFESELIERFGSL 825 Query: 541 VRIPLLKPERSPLPD 585 +++PLLK +R+PLPD Sbjct: 826 IKMPLLKSDRTPLPD 840 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,019,686 Number of Sequences: 27288 Number of extensions: 282012 Number of successful extensions: 762 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 762 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 904103924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18814424|gb|BM535626.1|BM535626 EST588648 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG67F5 5' end, mRNA sequence (394 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46060.1 hypothetical protein / predicted by genscan; supp... 162 4e-41 >At2g46060.1 hypothetical protein / predicted by genscan; supported by cDNA: gi_18087618 Length = 766 Score = 162 bits (411), Expect = 4e-41 Identities = 80/136 (58%), Positives = 100/136 (72%), Gaps = 6/136 (4%) Frame = +1 Query: 4 LYDASDKSVSFYIIYARGGTWSFGLRH------PISNRHSSTVETTMSISLERCPAKCSS 165 LY++S + V FYI+YAR GTWSFGLR P ++R S T+ +S+SLERCP CSS Sbjct: 465 LYNSSKEMVDFYILYAREGTWSFGLRQLIDSNTPAASRGSPTL---VSLSLERCPRGCSS 521 Query: 166 HGACKSVLDSSGLTFYSFCDCDRRTGGFDCSVELVSSSGQMWQSISLIGSNAAALLPAYW 345 +G C+ D++GLT YSFC CDR GGFDCS+E+VS + QSI+LI SNAAALLPAYW Sbjct: 522 YGQCRYAFDANGLTSYSFCSCDRTHGGFDCSIEIVSHQEHIVQSIALIASNAAALLPAYW 581 Query: 346 ALRHKAFAEWVLYTSS 393 ALR + + EWVL+TSS Sbjct: 582 ALRQREYPEWVLFTSS 597 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,162,589 Number of Sequences: 27288 Number of extensions: 186496 Number of successful extensions: 514 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 382840584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18814313|gb|BM535565.1|BM535565 EST588587 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG67E18 5' end, mRNA sequence (246 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18250.1 putative protein / similar to unknown protein (db... 94 2e-20 At3g04040.1 hypothetical protein / predicted by genscan+ 84 1e-17 >At5g18250.1 putative protein / similar to unknown protein (dbj|BAA90342.1);supported by full-length cDNA: Ceres:1816. Length = 133 Score = 93.6 bits (231), Expect = 2e-20 Identities = 41/53 (77%), Positives = 46/53 (86%) Frame = +2 Query: 86 VRCPHCAGPLSKEMETSEWTVPPLIRDSFSMIGSAVGGTTSAFYGFNHVMPIV 244 +RC HCAGPL++ +ETS+WTV P IRDSFSMIGSAVGGT SAF GFNH MPIV Sbjct: 10 IRCHHCAGPLTRNLETSKWTVDPFIRDSFSMIGSAVGGTASAFIGFNHAMPIV 62 >At3g04040.1 hypothetical protein / predicted by genscan+ Length = 128 Score = 84.3 bits (207), Expect = 1e-17 Identities = 37/47 (78%), Positives = 41/47 (86%) Frame = +2 Query: 89 RCPHCAGPLSKEMETSEWTVPPLIRDSFSMIGSAVGGTTSAFYGFNH 229 RC HCAGPL+K +ET+EWTV P IRDSFSMIGSAVGGT SAF GF+H Sbjct: 11 RCHHCAGPLTKNLETNEWTVAPFIRDSFSMIGSAVGGTASAFIGFHH 57 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,328,587 Number of Sequences: 27288 Number of extensions: 93524 Number of successful extensions: 304 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 297 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 304 length of database: 11,516,596 effective HSP length: 57 effective length of database: 9,961,180 effective search space used: 239068320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18813883|gb|BM535323.1|BM535323 EST588345 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG65K16 5' end, mRNA sequence (573 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g63420.1 putative protein / ; supported by cDNA: gi_12034... 102 1e-22 >At3g63420.1 putative protein / ; supported by cDNA: gi_12034687_gb_AF283673.1_AF283673 Length = 98 Score = 102 bits (254), Expect = 1e-22 Identities = 46/80 (57%), Positives = 57/80 (70%) Frame = +1 Query: 64 GKHRISAELKRLEQETRFLEEELELLDKMEKASAACKEMLSNVETRPDPLLPITHGPTNP 243 GKHRI AEL R+EQE FLE+EL+ ++ + S C+E+LS +E PDPLLP+T+GP N Sbjct: 19 GKHRILAELARVEQEVAFLEKELKEVENTDIVSTVCEELLSVIEKGPDPLLPLTNGPLNL 78 Query: 244 SWDRWFEGAQDASGCRCWIL 303 WDRWFEG GCRC IL Sbjct: 79 GWDRWFEGPNGGEGCRCLIL 98 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,173,521 Number of Sequences: 27288 Number of extensions: 259177 Number of successful extensions: 896 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 867 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 895 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 859346304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18813865|gb|BM535314.1|BM535314 EST588336 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG65I16 5' end, mRNA sequence (636 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g30145.1 bcnt-like protein / ; supported by full-length cD... 181 3e-46 >At5g30145.1 bcnt-like protein / ; supported by full-length cDNA: Ceres: 9811. Length = 236 Score = 181 bits (459), Expect = 3e-46 Identities = 94/156 (60%), Positives = 127/156 (81%), Gaps = 6/156 (3%) Frame = +1 Query: 130 SEESKKLAAAALSAVKEAA-TAAASAGRVKV-ITEVRDFAGEDVEIKKYVDHNSAEASDK 303 SEE+K +AAAAL+AV+ A TAAA++ R K+ ITEV+DFAG+++E+K+ V+ +S EA ++ Sbjct: 81 SEEAKSIAAAALAAVRNATVTAAAASSRGKIEITEVKDFAGQEIEVKRLVEADSKEALER 140 Query: 304 GK----GPAAPASAVDIILEQIKKKQKLSVLDKTKKDWEGFKGENRGMEEELDAYKKSSN 471 G +A SAVD +LEQIKKKQKLSVLDKTKKDW +K E++G+E+ELD YKKSS+ Sbjct: 141 GNKGSSSSSAAPSAVDAVLEQIKKKQKLSVLDKTKKDWGEYKEEHKGVEDELDKYKKSSD 200 Query: 472 QYLDRVGFLERADYREFERERDARLGMHAKRKPESM 579 QYLD+VGFLERADYR+FE+ERDARL + +KR+ + + Sbjct: 201 QYLDKVGFLERADYRQFEKERDARLALQSKRRHDDV 236 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,143,571 Number of Sequences: 27288 Number of extensions: 303854 Number of successful extensions: 1345 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1337 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18813374|gb|BM535036.1|BM535036 EST588058 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG64G4 5' end, mRNA sequence (597 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g08780.1 hypothetical protein / predicted by genscan; supp... 175 1e-44 >At3g08780.1 hypothetical protein / predicted by genscan; supported by cDNA: gi_19310496 Length = 313 Score = 175 bits (444), Expect = 1e-44 Identities = 81/165 (49%), Positives = 120/165 (72%) Frame = +3 Query: 3 SLPPSLFLLLSTPFQEQLIHTHEYKAFQYRISTDSFDPKSLDVINIGPSFRSHYGSFSPI 182 ++ S+F LL+ P +Q IHTHEY+A+Q+R S +P+S+ ++NIGP+FR HYGSFSP Sbjct: 146 NMASSVFFLLTMPLTDQCIHTHEYRAYQFRSSKQRLEPRSVGIVNIGPAFRGHYGSFSPK 205 Query: 183 SPFPSMTCDLRGPNAMAEDEKAETLVGIKRGLKDQKELDLCAEGFEIGRLSKLMGSDSSN 362 S FP + C+L +AM+ D +L K+ KDQKE+D AEGF++G L +L+G++++N Sbjct: 206 SGFPPLICELSS-SAMSVDCDESSLSAKKQSAKDQKEIDALAEGFQVGELKRLVGAEAAN 264 Query: 363 YTAELEHLYDKMLLKLDSLARSVETSSAKVLEQEKHNMKLRYKIA 497 YT +E +Y++ML K++SLA VE SSA+V +QEKHN KLR ++A Sbjct: 265 YTGGIEEMYERMLAKIESLASDVEKSSARVFQQEKHNRKLRNRVA 309 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,660,585 Number of Sequences: 27288 Number of extensions: 317881 Number of successful extensions: 1113 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 966 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1093 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 930958496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18813251|gb|BM534973.1|BM534973 EST587995 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG64I15 5' end, mRNA sequence (724 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11980.1 putative protein / predicted protein W02G9.1 Caen... 267 1e-83 >At4g11980.1 putative protein / predicted protein W02G9.1 Caenorhabditis elegans cosmid W02G9, PID:g3165571; supported by cDNA: gi_15450340_gb_AY052271.1_ Length = 309 Score = 267 bits (683), Expect(2) = 1e-83 Identities = 134/191 (70%), Positives = 164/191 (85%) Frame = +2 Query: 11 KMSTTPPSQIADIINLPTQLDQPVSVVAAPGVSDTHFRNAIESSLFKQWLKNIQTETGLL 190 KMS++ S + I LP+Q ++PV V A G+S + FR+AI+SSLF+ WL+N+++E+G+L Sbjct: 35 KMSSSS-SSLTQSITLPSQPNEPVLVSATAGISSSDFRDAIDSSLFRNWLRNLESESGIL 93 Query: 191 ANGALSLKQVLIQGVDMFGERLGFLKFKADIIDKETGQKVPGIVFARGPAVAVLILLDYE 370 A+G+++LKQVLIQGVDMFG+R+GFLKFKADI DKETGQKVPGIVFARGPAVAVLILL+ + Sbjct: 94 ADGSMTLKQVLIQGVDMFGKRIGFLKFKADIFDKETGQKVPGIVFARGPAVAVLILLESD 153 Query: 371 GETYAVLTEQVRVPVGRLILELPAGMLDDDQGDFAGTAVREVEEETGIHLNVHDMVDLTA 550 GETYAVLTEQVRVP G+++LELPAGMLDDD+GDF GTAVREVEEE GI L DMVDLTA Sbjct: 154 GETYAVLTEQVRVPTGKIVLELPAGMLDDDKGDFVGTAVREVEEEIGIKLKKEDMVDLTA 213 Query: 551 FLDASTGGQSF 583 FLD STG + F Sbjct: 214 FLDPSTGYRIF 224 Score = 60.5 bits (145), Expect(2) = 1e-83 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 610 KMSLFLYRGNVSKEKIQQLQGKETGLRDHGELIKVHVV 723 +MS+FLYRG V KE I+QLQGKETGLR+HGE IKV ++ Sbjct: 233 EMSVFLYRGQVEKETIRQLQGKETGLREHGEFIKVRLI 270 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,378,055 Number of Sequences: 27288 Number of extensions: 404703 Number of successful extensions: 1369 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1368 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1268361380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18813232|gb|BM534963.1|BM534963 EST587985 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG64G13 5' end, mRNA sequence (767 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g49540.1 hypothetical protein / similar to hypothetical pr... 345 2e-95 At5g08560.1 WD-repeat protein-like / ; supported by cDNA: gi... 59 2e-09 At5g08390.1 katanin p80 subunit - like protein / katanin p80 ... 57 1e-08 At5g23430.1 putative protein / contains similarity to unknown... 57 1e-08 At3g49660.1 G-protein beta-subunit (transducin) family / beta... 56 2e-08 At4g02730.1 G-protein beta family / similar to C. elegans put... 55 5e-08 At1g18080.1 G-protein beta family / identical to WD-40 repeat... 53 2e-07 At1g61210.1 G-protein beta family / contains similarity to ka... 52 3e-07 At1g48630.1 guanine nucleotide-binding protein, putative / si... 51 8e-07 At5g25150.1 transcription initiation factor IID-associated facto... 51 8e-07 At2g26060.1 G-protein beta family / ;supported by full-length... 50 1e-06 At1g11160.1 hypothetical protein / similar to hypothetical pr... 50 2e-06 At5g52820.1 Notchless protein homolog / 49 4e-06 At2g43770.1 G-protein beta-subunit (transducin) family / 49 4e-06 At3g18130.1 protein kinase C-receptor/G-protein, putative / s... 48 5e-06 At5g64630.1 FAS2 (dbj|BAA77766.1) / ; supported by cDNA: gi_... 47 9e-06 At2g01330.1 putative stress protein / 47 9e-06 >At1g49540.1 hypothetical protein / similar to hypothetical protein GB:AAD43147 GI:5430747 from [Arabidopsis thaliana] Length = 840 Score = 345 bits (884), Expect = 2e-95 Identities = 164/254 (64%), Positives = 200/254 (78%), Gaps = 3/254 (1%) Frame = +2 Query: 14 EGFDTLETVPEAVPVVLTEPPIEEQLAWHTLWPESHKLYGHGNELFSLCCDHDGKLVASS 193 EG DT ETVPEA P L EPPIE+QLA+HTLWPESHKLYGHGNELFSLC DH G LVASS Sbjct: 559 EGLDTFETVPEAAPAELKEPPIEDQLAFHTLWPESHKLYGHGNELFSLCSDHKGNLVASS 618 Query: 194 CKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEFSHDNKYLLAVSRDRHFSVFQINH 373 CKAQSA +AEIWLW+VG+WK+VGRL+SHSLTVT +EFS+D+ LL+VSRDRHFSVF I Sbjct: 619 CKAQSASMAEIWLWEVGTWKAVGRLQSHSLTVTHLEFSYDDTLLLSVSRDRHFSVFSIQR 678 Query: 374 KGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGSRDKTVKIWAVGTETSVKLLLTLP 553 E+ ++L+AK EAHKRIIW+CSWNPFGH+FAT SRDKTVKIW+V + +K +L LP Sbjct: 679 TDNGEVSHKLMAKVEAHKRIIWACSWNPFGHQFATSSRDKTVKIWSVENDARIKQILVLP 738 Query: 554 PFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWN---LDSRGGDGHLSVQNASPAVKF 724 PF SSVTA++W LD + G +AVGME+GLIEL N +++ G + A+ A++ Sbjct: 739 PFGSSVTAVAWTGLDRNEKSGCVAVGMESGLIELSNVKIIETEEG----TTATAALALRL 794 Query: 725 DPFLCHVSTVQRLS 766 +PF+CHVS V RL+ Sbjct: 795 EPFMCHVSAVNRLA 808 >At5g08560.1 WD-repeat protein-like / ; supported by cDNA: gi_15450909_gb_AY054535.1_ Length = 589 Score = 59.3 bits (142), Expect = 2e-09 Identities = 50/169 (29%), Positives = 76/169 (44%), Gaps = 3/169 (1%) Frame = +2 Query: 170 DGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEFSHDNKYLLAVSRDRH 349 DGK + S CK + + +V RL +T S+DNKY+L ++ Sbjct: 414 DGKWLVSVCKDSVISLFD-------REATVERLIEEEDMITSFSLSNDNKYILVNLLNQE 466 Query: 350 FSVFQINHKGTDEIDYQLVAKQEAHKR---IIWSCSWNPFGHEFATGSRDKTVKIWAVGT 520 ++ I E D ++V++ + HKR II SC A+GS D V IW T Sbjct: 467 IRLWNI------EGDPKIVSRYKGHKRSRFIIRSCFGGYKQAFIASGSEDSQVYIWHRST 520 Query: 521 ETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNLD 667 KL++ LP +V +SW + H +LA ++G I +W LD Sbjct: 521 G---KLIVELPGHAGAVNCVSWSPTNLH----MLASASDDGTIRIWGLD 562 Score = 47.4 bits (111), Expect = 9e-06 Identities = 35/138 (25%), Positives = 67/138 (48%), Gaps = 2/138 (1%) Frame = +2 Query: 266 LRSHSLTVTQMEFSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSC 445 L SH+ V ++FSH+ KYL + S+D+ +++I+ G + + LV H + + + Sbjct: 270 LESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADGHISLKHTLV----GHHKPVIAI 325 Query: 446 SWNPFGHEFATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTALS--WLSLDNHSNHGL 619 W+P + T ++ ++ W V + V + K ++ +S W G+ Sbjct: 326 LWSPDDRQVLTCGAEEVIRRWDVDSGDCVHMY-----EKGGISPISCGWYP----DGQGI 376 Query: 620 LAVGMENGLIELWNLDSR 673 +A GM + I +W+LD R Sbjct: 377 IA-GMTDRSICMWDLDGR 393 >At5g08390.1 katanin p80 subunit - like protein / katanin p80 subunit, Strongylocentrotus purpuratus, EMBL:AF052433 Length = 871 Score = 57.0 bits (136), Expect = 1e-08 Identities = 49/182 (26%), Positives = 77/182 (41%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 LYGH + + S+ D LVA+ A I LW + K V L H + F Sbjct: 148 LYGHSSGIDSVTFDASEGLVAAG-----AASGTIKLWDLEEAKVVRTLTGHRSNCVSVNF 202 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 ++ + S D + ++ I KG + + H R + + P G +G Sbjct: 203 HPFGEFFASGSLDTNLKIWDIRKKGC-------IHTYKGHTRGVNVLRFTPDGRWIVSGG 255 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 D VK+W + T+ KLL FKS + SLD H + LLA G + ++ W+L Sbjct: 256 EDNVVKVWDL---TAGKLL---HEFKSHEGKIQ--SLDFHPHEFLLATGSADKTVKFWDL 307 Query: 665 DS 670 ++ Sbjct: 308 ET 309 >At5g23430.1 putative protein / contains similarity to unknown protein (gb|AAB71474.1) Length = 922 Score = 57.0 bits (136), Expect = 1e-08 Identities = 46/182 (25%), Positives = 76/182 (41%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 LYGH + + S+ D LVA+ A I LW + K V L H ++F Sbjct: 55 LYGHSSGIDSVTFDASEVLVAAG-----AASGTIKLWDLEEAKIVRTLTGHRSNCISVDF 109 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 ++ + S D + ++ I KG + + H R + + P G +G Sbjct: 110 HPFGEFFASGSLDTNLKIWDIRKKGC-------IHTYKGHTRGVNVLRFTPDGRWVVSGG 162 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 D VK+W + T+ KLL + + SLD H + LLA G + ++ W+L Sbjct: 163 EDNIVKVWDL---TAGKLLTEFKSHEGQIQ-----SLDFHPHEFLLATGSADRTVKFWDL 214 Query: 665 DS 670 ++ Sbjct: 215 ET 216 >At3g49660.1 G-protein beta-subunit (transducin) family / beta-transducin, Schizosaccharomyces pombe, EMBL:CAA17803 Length = 317 Score = 55.8 bits (133), Expect = 2e-08 Identities = 50/214 (23%), Positives = 90/214 (41%), Gaps = 3/214 (1%) Frame = +2 Query: 101 TLWPESHKLYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHS 280 T + S L H + S+ DG+L+AS+ ++ I + V H Sbjct: 12 TPYVHSQTLTSHNRAVSSVKFSSDGRLLASASADKTIRTYTINTINDPIAEPVQEFTGHE 71 Query: 281 LTVTQMEFSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPF 460 ++ + FS D +++++ S D+ ++ + L+ H + ++NP Sbjct: 72 NGISDVAFSSDARFIVSASDDKTLKLWDVETGS-------LIKTLIGHTNYAFCVNFNPQ 124 Query: 461 GHEFATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMEN 640 + +GS D+TV+IW V T+ K L LP VTA +D + + L+ + Sbjct: 125 SNMIVSGSFDETVRIWDV---TTGKCLKVLPAHSDPVTA-----VDFNRDGSLIVSSSYD 176 Query: 641 GLIELWNLDSRGGDGH---LSVQNASPAVKFDPF 733 GL +W+ G GH + + +P V F F Sbjct: 177 GLCRIWD----SGTGHCVKTLIDDENPPVSFVRF 206 >At4g02730.1 G-protein beta family / similar to C. elegans putative WD-repeat protein C14B1.4, GenBank accession number Q17963;supported by full-length cDNA: Ceres:41490. Length = 333 Score = 54.7 bits (130), Expect = 5e-08 Identities = 44/203 (21%), Positives = 89/203 (43%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 L GH + + +DG L+AS+ ++ + LW ++ + R HS ++ + + Sbjct: 39 LEGHTAAISCVKFSNDGNLLASASVDKT-----MILWSATNYSLIHRYEGHSSGISDLAW 93 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 S D+ Y + S D ++ Y+ + H ++ ++NP + +GS Sbjct: 94 SSDSHYTCSASDDCTLRIWDARSP------YECLKVLRGHTNFVFCVNFNPPSNLIVSGS 147 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 D+T++IW V T V+++ K+ +S S+ + + L+ +G ++W+ Sbjct: 148 FDETIRIWEVKTGKCVRMI------KAHSMPIS--SVHFNRDGSLIVSASHDGSCKIWDA 199 Query: 665 DSRGGDGHLSVQNASPAVKFDPF 733 G + + SPAV F F Sbjct: 200 -KEGTCLKTLIDDKSPAVSFAKF 221 >At1g18080.1 G-protein beta family / identical to WD-40 repeat protein GI:2289095 from (Arabidopsis thaliana);supported by full-length cDNA: Ceres:7026. Length = 327 Score = 52.8 bits (125), Expect = 2e-07 Identities = 50/184 (27%), Positives = 83/184 (44%), Gaps = 3/184 (1%) Frame = +2 Query: 122 KLYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQME 301 +L GH + + + DG+ S E+ LW + + S R H+ V + Sbjct: 58 RLTGHSHFVEDVVLSSDGQFALSGSWD-----GELRLWDLAAGVSTRRFVGHTKDVLSVA 112 Query: 302 FSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSC---SWNPFGHEF 472 FS DN+ +++ SRDR ++ E Y + E H+ + SC S N Sbjct: 113 FSLDNRQIVSASRDRTIKLWNT----LGECKYTISEGGEGHRDWV-SCVRFSPNTLQPTI 167 Query: 473 ATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIE 652 + S DKTVK+W + ++ KL TL V+ ++ +S D L A G ++G++ Sbjct: 168 VSASWDKTVKVWNL---SNCKLRSTLAGHTGYVSTVA-VSPDG----SLCASGGKDGVVL 219 Query: 653 LWNL 664 LW+L Sbjct: 220 LWDL 223 >At1g61210.1 G-protein beta family / contains similarity to katanin p80 subunit GI:3005601 from [Strongylocentrotus purpuratus] Length = 282 Score = 52.4 bits (124), Expect = 3e-07 Identities = 46/182 (25%), Positives = 75/182 (40%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 L GH + + S+ D LV + + I LW V K V H + +EF Sbjct: 84 LCGHTSAVDSVAFDSAEVLVLAGASS-----GVIKLWDVEEAKMVRAFTGHRSNCSAVEF 138 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 ++L + S D + ++ I KG + + H R I + + P G +G Sbjct: 139 HPFGEFLASGSSDANLKIWDIRKKG-------CIQTYKGHSRGISTIRFTPDGRWVVSGG 191 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 D VK+W + T+ KLL + + SLD H LLA G + ++ W+L Sbjct: 192 LDNVVKVWDL---TAGKLLHEFKFHEGPIR-----SLDFHPLEFLLATGSADRTVKFWDL 243 Query: 665 DS 670 ++ Sbjct: 244 ET 245 >At1g48630.1 guanine nucleotide-binding protein, putative / similar to guanine nucleotide-binding protein GI:9294068 from (Arabidopsis thaliana); supported by cDNA: 38966. Length = 326 Score = 50.8 bits (120), Expect = 8e-07 Identities = 49/184 (26%), Positives = 84/184 (45%), Gaps = 3/184 (1%) Frame = +2 Query: 122 KLYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQME 301 ++ GH + + + DG+ S E+ LW + + +S R H+ V + Sbjct: 58 RMTGHSHFVQDVVLSSDGQFALSGSWD-----GELRLWDLATGESTRRFVGHTKDVLSVA 112 Query: 302 FSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSC---SWNPFGHEF 472 FS DN+ +++ SRDR ++ E Y +++ + HK + SC S N Sbjct: 113 FSTDNRQIVSASRDRTIKLWNT----LGECKY-TISEADGHKEWV-SCVRFSPNTLVPTI 166 Query: 473 ATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIE 652 + S DKTVK+W + + KL TL + ++ +S D L A G ++G+I Sbjct: 167 VSASWDKTVKVWNL---QNCKLRNTLAGHSGYLNTVA-VSPDG----SLCASGGKDGVIL 218 Query: 653 LWNL 664 LW+L Sbjct: 219 LWDL 222 >At5g25150.1 transcription initiation factor IID-associated factor-like protein / 100 kDa subunit of Pol II transcription factor - Homo sapiens, EMBL:X95525 Length = 700 Score = 50.8 bits (120), Expect = 8e-07 Identities = 46/187 (24%), Positives = 77/187 (40%), Gaps = 19/187 (10%) Frame = +2 Query: 167 HDGKLVASSCKAQSAPVAEIW-LWQVGSW------------------KSVGRLRSHSLTV 289 HDG LVA S V ++ + Q GS +S L HS V Sbjct: 362 HDGSLVAGGFSDSSIKVWDMAKIGQAGSGALQAENDSSDQSIGPNGRRSYTLLLGHSGPV 421 Query: 290 TQMEFSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHE 469 FS ++L+ S D ++ + +++ LV + H +W ++PFGH Sbjct: 422 YSATFSPPGDFVLSSSADTTIRLW------STKLNANLVC-YKGHNYPVWDAQFSPFGHY 474 Query: 470 FATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLI 649 FA+ S D+T +IW++ + P + LS +D H N +A G + + Sbjct: 475 FASCSHDRTARIWSMD---------RIQPLRIMAGHLS--DVDWHPNCNYIATGSSDKTV 523 Query: 650 ELWNLDS 670 LW++ + Sbjct: 524 RLWDVQT 530 Score = 49.7 bits (117), Expect = 2e-06 Identities = 47/182 (25%), Positives = 76/182 (40%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 L GH ++S G V SS + I LW ++ + H+ V +F Sbjct: 414 LLGHSGPVYSATFSPPGDFVLSSSADTT-----IRLWSTKLNANLVCYKGHNYPVWDAQF 468 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 S Y + S DR ++ ++ Q + H + W+P + ATGS Sbjct: 469 SPFGHYFASCSHDRTARIWSMDR-------IQPLRIMAGH---LSDVDWHPNCNYIATGS 518 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 DKTV++W V T V++ + +S V LSL + +A G E+G I +W+L Sbjct: 519 SDKTVRLWDVQTGECVRIFI---GHRSMV-----LSLAMSPDGRYMASGDEDGTIMMWDL 570 Query: 665 DS 670 + Sbjct: 571 ST 572 >At2g26060.1 G-protein beta family / ;supported by full-length cDNA: Ceres:142426. Length = 352 Score = 50.1 bits (118), Expect = 1e-06 Identities = 36/135 (26%), Positives = 59/135 (43%), Gaps = 7/135 (5%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQV---GSWKSVGRLRSHSLTVTQ 295 L GH NE+ S+ + G +A+ + +S +W+W+V + L H+ V Sbjct: 114 LEGHENEVKSVSWNASGSCLATCSRDKS-----VWIWEVLEGNEYDCAAVLTGHTQDVKM 168 Query: 296 MEFSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVA----KQEAHKRIIWSCSWNPFG 463 +++ L + S D V+ D+ +YQ V H +WS S+N G Sbjct: 169 VQWHPTMDVLFSCSYDNTIKVWWSED---DDGEYQCVQTLGESNNGHSSTVWSISFNAAG 225 Query: 464 HEFATGSRDKTVKIW 508 + T S D T+KIW Sbjct: 226 DKMVTCSDDLTLKIW 240 >At1g11160.1 hypothetical protein / similar to hypothetical protein GB:AAD49999 GI:5734734 from [Arabidopsis thaliana] Length = 974 Score = 49.7 bits (117), Expect = 2e-06 Identities = 44/182 (24%), Positives = 76/182 (41%) Frame = +2 Query: 125 LYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQMEF 304 L GH + + S+ + + LV + + I LW + K V H + +EF Sbjct: 3 LCGHTSPVDSVAFNSEEVLVLAGASS-----GVIKLWDLEESKMVRAFTGHRSNCSAVEF 57 Query: 305 SHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFATGS 484 ++L + S D + V+ KG + + H R I + ++P G +G Sbjct: 58 HPFGEFLASGSSDTNLRVWDTRKKG-------CIQTYKGHTRGISTIEFSPDGRWVVSGG 110 Query: 485 RDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIELWNL 664 D VK+W + T+ KLL + + SLD H LLA G + ++ W+L Sbjct: 111 LDNVVKVWDL---TAGKLLHEFKCHEGPIR-----SLDFHPLEFLLATGSADRTVKFWDL 162 Query: 665 DS 670 ++ Sbjct: 163 ET 164 >At5g52820.1 Notchless protein homolog / Length = 473 Score = 48.5 bits (114), Expect = 4e-06 Identities = 39/146 (26%), Positives = 66/146 (44%), Gaps = 1/146 (0%) Frame = +2 Query: 224 IWLWQVG-SWKSVGRLRSHSLTVTQMEFSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQ 400 ++LW+ S + RL H V + FS D K++ + S D+ ++ + I Q Sbjct: 341 MFLWEPSVSKQPKKRLTGHQQLVNHVYFSPDGKWIASASFDKSVRLW-------NGITGQ 393 Query: 401 LVAKQEAHKRIIWSCSWNPFGHEFATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTAL 580 V H ++ SW+ +GS+D T+KIW + T+ KL LP V A+ Sbjct: 394 FVTVFRGHVGPVYQVSWSADSRLLLSGSKDSTLKIWEIRTK---KLKQDLPGHADEVFAV 450 Query: 581 SWLSLDNHSNHGLLAVGMENGLIELW 658 W S D + G ++ +++LW Sbjct: 451 DW-SPDGEK----VVSGGKDRVLKLW 471 >At2g43770.1 G-protein beta-subunit (transducin) family / Length = 343 Score = 48.5 bits (114), Expect = 4e-06 Identities = 31/118 (26%), Positives = 50/118 (42%), Gaps = 1/118 (0%) Frame = +2 Query: 221 EIWLWQVGSWKSVGRLRSHSLTVTQMEFSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQ 400 ++ +W + ++ L H T+T M S D YLL D V+ + + Sbjct: 203 DVKVWDLRKGEATMTLEGHQDTITGMSLSPDGSYLLTNGMDNKLCVWDMRPYAPQNRCVK 262 Query: 401 LV-AKQEAHKRIIWSCSWNPFGHEFATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSV 571 + Q ++ + CSW+P G + GS D+ V IW TS + + LP SV Sbjct: 263 IFEGHQHNFEKNLLKCSWSPDGTKVTAGSSDRMVHIW---DTTSRRTIYKLPGHTGSV 317 >At3g18130.1 protein kinase C-receptor/G-protein, putative / similar to uanine nucleotide binding protein (G protein), beta polypeptide GB:NP_006089 [Homo sapiens]; contains Pfam profile: PF00400 WD domain, G-beta repeat (7 copies); supported by cDNA: gi_15215619_gb_AY050338.1_ Length = 326 Score = 48.1 bits (113), Expect = 5e-06 Identities = 48/184 (26%), Positives = 84/184 (45%), Gaps = 3/184 (1%) Frame = +2 Query: 122 KLYGHGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVGSWKSVGRLRSHSLTVTQME 301 +L GH + + + DG+ S E+ LW + + ++ R H+ V + Sbjct: 58 RLTGHSHFVEDVVLSSDGQFALSGSWD-----GELRLWDLATGETTRRFVGHTKDVLSVA 112 Query: 302 FSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSC---SWNPFGHEF 472 FS DN+ +++ SRDR ++ E Y +++ + HK + SC S N Sbjct: 113 FSTDNRQIVSASRDRTIKLWNT----LGECKY-TISEGDGHKEWV-SCVRFSPNTLVPTI 166 Query: 473 ATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAVGMENGLIE 652 + S DKTVK+W + + KL +L + ++ +S D L A G ++G+I Sbjct: 167 VSASWDKTVKVWNL---QNCKLRNSLVGHSGYLNTVA-VSPDG----SLCASGGKDGVIL 218 Query: 653 LWNL 664 LW+L Sbjct: 219 LWDL 222 >At5g64630.1 FAS2 (dbj|BAA77766.1) / ; supported by cDNA: gi_14030688_gb_AF375435.1_AF375435 Length = 397 Score = 47.4 bits (111), Expect = 9e-06 Identities = 35/140 (25%), Positives = 64/140 (45%), Gaps = 6/140 (4%) Frame = +2 Query: 134 HGNELFSLCCDHDGKLVASSCKAQSAPVAEIWLWQVG------SWKSVGRLRSHSLTVTQ 295 HG + ++ G+L+AS A E+++W++ SWK L H V Sbjct: 63 HGCAVNTIRFSPSGELLASG-----ADGGELFIWKLHPSETNQSWKVHKSLSFHRKDVLD 117 Query: 296 MEFSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCSWNPFGHEFA 475 +++S D+ YL++ S D ++ +N +I +AH + +W+P A Sbjct: 118 LQWSPDDAYLISGSVDNSCIIWDVNKGSVHQI-------LDAHCHYVQGVAWDPLAKYVA 170 Query: 476 TGSRDKTVKIWAVGTETSVK 535 + S D+T +I+A +T K Sbjct: 171 SLSSDRTCRIYANKPQTKSK 190 >At2g01330.1 putative stress protein / Length = 611 Score = 47.4 bits (111), Expect = 9e-06 Identities = 35/133 (26%), Positives = 62/133 (46%) Frame = +2 Query: 269 RSHSLTVTQMEFSHDNKYLLAVSRDRHFSVFQINHKGTDEIDYQLVAKQEAHKRIIWSCS 448 R HS V + +S D + VS D+ ++ + K D++ +A ++ HK I++ S Sbjct: 185 REHSNFVNCIRYSPDGTKFITVSSDKKGMIY--DGKTGDKVGE--LASEDGHKGSIYAVS 240 Query: 449 WNPFGHEFATGSRDKTVKIWAVGTETSVKLLLTLPPFKSSVTALSWLSLDNHSNHGLLAV 628 W+P T S DK+ K+W V + ++ ++ F S A L N L+ V Sbjct: 241 WSPDSKRVLTVSADKSAKVWEVAEDGTIGSVIKTLSFMESGGAEDMLVGCLWQNDHLITV 300 Query: 629 GMENGLIELWNLD 667 + G + L++ D Sbjct: 301 SL-GGTMSLFSAD 312 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,047,473 Number of Sequences: 27288 Number of extensions: 406396 Number of successful extensions: 1563 Number of sequences better than 1.0e-05: 34 Number of HSP's better than 0.0 without gapping: 1212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1472 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1401406280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18265080|gb|BM413450.1|BM413450 EST587777 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG63I20 5' end, mRNA sequence (744 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g71860.1 protein tyrosine phosphatase / identical to GB:C... 350 5e-97 >At1g71860.1 protein tyrosine phosphatase / identical to GB:CAA06978 GI:3413425 from [Arabidopsis thaliana] (Plant Mol. Biol. 39 (3), 593-605 (1999)); supported by cDNA: gi_3800745_gb_AF055635.1_AF055635 Length = 340 Score = 350 bits (898), Expect = 5e-97 Identities = 168/245 (68%), Positives = 200/245 (81%), Gaps = 3/245 (1%) Frame = +2 Query: 17 RCHSPDKIASEFSTLQENRLKASEMKSRCLVALDSTNISKNRYTDVIPFDNNRVVLDPCK 196 + +PD IA EF+ LQ NR+ SE+ VA++S N+ KNRY+DV+PFD NR+VL+PCK Sbjct: 51 KIQNPDSIAHEFTGLQANRMWPSELLLNSTVAMNSVNVEKNRYSDVVPFDKNRIVLNPCK 110 Query: 197 DYRPSAKGYINASFIEISEG--VSRFVATQGPLAHTFEDFWEMIIQQRCPVIVMLTRLVD 370 D SAKGY+NAS I+ SE +S+F+ATQGPL HT EDFWEM+IQQ CP+IVMLTRLVD Sbjct: 111 D--SSAKGYVNASLIKTSESESISQFIATQGPLPHTMEDFWEMVIQQHCPIIVMLTRLVD 168 Query: 371 NYKMVKCGDYFQAEDGPRTFGNICIVTKYM-TSDASLVLRTLEVNYIESEEPPLCVLHIQ 547 N + VKCGDYFQ EDGPR FGNI + TK++ T+D SL+LR LEVNY E+E+ P+ VLHIQ Sbjct: 169 NNRTVKCGDYFQDEDGPREFGNISLTTKWIKTTDTSLMLRNLEVNYKETEDQPMSVLHIQ 228 Query: 548 YPEWPDHGVPRDTLAVREILKRTYNLPLGLGPIVVHCSAGIGRTGTYCTIHNTIQRILGG 727 YPEWPDHGVP+DT+AVREILKR Y +P LGPI+VHCSAGIGRTGTYC IHNTIQRIL G Sbjct: 229 YPEWPDHGVPKDTVAVREILKRLYQVPPSLGPIIVHCSAGIGRTGTYCAIHNTIQRILAG 288 Query: 728 DMSAL 742 DMSAL Sbjct: 289 DMSAL 293 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,752,855 Number of Sequences: 27288 Number of extensions: 407233 Number of successful extensions: 1167 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1164 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1330449000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264914|gb|BM413284.1|BM413284 EST587611 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62H12 5' end, mRNA sequence (656 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g53645.1 Expressed protein / ; supported by full-length cD... 228 2e-60 >At1g53645.1 Expressed protein / ; supported by full-length cDNA: Ceres: 41453. Length = 523 Score = 228 bits (582), Expect = 2e-60 Identities = 106/142 (74%), Positives = 124/142 (86%) Frame = +2 Query: 8 TNMMIECEPEYLMGDFESNPDIDETPPIPLRDALEKMKPFLMAYEGIKDQEEWEEVIKET 187 TN+MIECEPEY+M DF SNPDIDE PP+ LR+ LEK+KPF++AYEGIKDQEEWEE I E Sbjct: 382 TNLMIECEPEYIMPDFGSNPDIDEKPPMSLRECLEKVKPFIVAYEGIKDQEEWEEAINEA 441 Query: 188 METVPLMKEIVDYYSGPDRVTAKQQQQELERVAKTLPESAPNSVKRFTERAVLSLQSNPG 367 M PLMKEIVD+YSGPDRVTAK+Q +EL+R+A TLP SAP+SVKRF +RA L+L+SNPG Sbjct: 442 MTQAPLMKEIVDHYSGPDRVTAKKQNEELDRIATTLPASAPDSVKRFADRAALTLKSNPG 501 Query: 368 WGFDKKCQFMDKVVMEVSQHYK 433 WGFDKK QFMDK+V+EVSQ YK Sbjct: 502 WGFDKKYQFMDKLVLEVSQSYK 523 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,663,443 Number of Sequences: 27288 Number of extensions: 322687 Number of successful extensions: 1123 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1067 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1121 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1097681028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264842|gb|BM413212.1|BM413212 EST587539 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62J13 5' end, mRNA sequence (785 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g50100.1 putative protein / similar to unknown protein (pi... 244 5e-65 >At5g50100.1 putative protein / similar to unknown protein (pir||S75732);supported by full-length cDNA: Ceres:35710. Length = 214 Score = 244 bits (622), Expect = 5e-65 Identities = 130/220 (59%), Positives = 163/220 (74%), Gaps = 6/220 (2%) Frame = +1 Query: 25 AFRAASSPVFR-RANISLFSLPPYITTKSPYSKFLPNPNPNLLNQHGPRYSIRAISGTT- 198 A AA+S +++ R N SL SL + F PN N ++ G +Y +RAI GT+ Sbjct: 6 AVAAAASTIWKHRRNPSLRSLSRH---------FNPNFNHRIIPT-GFKYQVRAIQGTST 55 Query: 199 ---VAPNKDINEEKSPENWKIKMLYDGECPLCMREVDMLRERNKSYGTIKFLDISSDEYR 369 + P K+ EE P+NWKIKMLYDG+CPLCMREV+ML ERN+ +GTIKF+DISS++Y Sbjct: 56 DPVITPLKN-REEPKPQNWKIKMLYDGDCPLCMREVNMLMERNEKHGTIKFVDISSNDYS 114 Query: 370 PDENEGLDYETVMGRIHAILSDGTVVTDVEAFRRLYEAVGLGWVYAITKYEPIATIADAV 549 P++N+GLDY+TVMG+IHAI SDG VV VEAFRRLYE VGLGWVY ITK+EPI +AD V Sbjct: 115 PEDNQGLDYKTVMGQIHAIQSDGNVVKGVEAFRRLYEEVGLGWVYTITKFEPIGKLADVV 174 Query: 550 YGVWAKYRLQVTGRPSLEEVLKARRK-KEEMCKDSKACKM 666 Y VWAKYRLQVTGRPS+E +L+AR+K K E C +SK CK+ Sbjct: 175 YDVWAKYRLQVTGRPSIEAILEARKKDKVETCGESKNCKI 214 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,773,577 Number of Sequences: 27288 Number of extensions: 409346 Number of successful extensions: 1389 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1382 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264811|gb|BM413181.1|BM413181 EST587508 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62D15 5' end, mRNA sequence (741 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72550.1 putative phenylalanyl-tRNA synthetase beta-subunit; ... 368 e-102 >At1g72550.1 putative phenylalanyl-tRNA synthetase beta-subunit; PheHB / similar to phenylalanyl-tRNA synthetase beta-subunit (PheHB) GB:5032011 [Homo sapiens]; supported by cDNA: gi_17065261 Length = 598 Score = 368 bits (945), Expect = e-102 Identities = 178/244 (72%), Positives = 211/244 (85%) Frame = +3 Query: 3 TYEALPPAEINFVPLKQTKNFRADELMEFYKSDLKLKKFLHIIENSPVYPVIYDCKRTVL 182 TYEALPP +INFVPLKQTK+FRADEL+EFYKSD+KLKKFLHIIENSPV+PV+YD KRTVL Sbjct: 173 TYEALPPTDINFVPLKQTKSFRADELIEFYKSDMKLKKFLHIIENSPVFPVLYDSKRTVL 232 Query: 183 SLPPIINGAHSAISLKTKNVFIECTATDLTKANIVLNTMVTMFSVYCERKFEVEPVKVTY 362 SLPPIINGAHSAI+L+TKNVFIECTATDLTKA IVLNTMVT FS +C RKFE+EPV+VTY Sbjct: 233 SLPPIINGAHSAITLQTKNVFIECTATDLTKAKIVLNTMVTTFSEFCARKFEIEPVEVTY 292 Query: 363 PDGRSYVCPDLSIYNMNVPLSYITGIIGVQLPEDKVASLLHKMQLRAEKSVSEDKEVKFV 542 DG+SY+ PDL++Y+M VPLS+IT IGV L ++V SLL +MQL+AE++ S D + Sbjct: 293 DDGKSYIYPDLAVYDMEVPLSFITDSIGVSLKVEQVTSLLTRMQLQAEQAKSSDNQCAIK 352 Query: 543 VSVPPTRSDVLHPCDVTEDVAIAYGYHEIPKRKPASLNPLPLSQFSDLIRTEIAMTGYTE 722 V VPP+RSDVLHPCDV EDVAIAYG++ IP RKPAS+ PL L++ +DL+R EIAM YTE Sbjct: 353 VHVPPSRSDVLHPCDVMEDVAIAYGFNNIPTRKPASIKPLTLNELTDLLRIEIAMCVYTE 412 Query: 723 VLTW 734 V+TW Sbjct: 413 VVTW 416 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,451,579 Number of Sequences: 27288 Number of extensions: 364863 Number of successful extensions: 1098 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1053 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1098 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1321579340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264791|gb|BM413161.1|BM413161 EST587488 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62O16 5' end, mRNA sequence (702 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56040.1 putative protein / predicted protein, Arabidopsis... 243 9e-65 >At3g56040.1 putative protein / predicted protein, Arabidopsis thaliana; supported by cDNA: gi_14596046_gb_AY042811.1_ Length = 883 Score = 243 bits (619), Expect = 9e-65 Identities = 104/178 (58%), Positives = 146/178 (81%) Frame = +2 Query: 2 LGPLWEVIRQKFYRGSISKGSELLIEVAEFLWRDVQLDGSLIILAENVLGSPRIDENGET 181 LGPLWEV RQKF GSIS SEL +E+AEF W +VQ+DGSLI+ AEN +GS ++NGE Sbjct: 703 LGPLWEVSRQKFKGGSISSCSELQLEIAEFSWNNVQVDGSLIVTAENAMGSTTPNDNGEP 762 Query: 182 VLHYGKRCGRCKLENVKILNDGIDWNARENLYWKHDVQRFEAVKVILHGNAEFEAVDVIL 361 +L YG RCG+CKL NV ++N GIDWN++ N+YW++DV R E K+ILHGNAEFEA +V + Sbjct: 763 ILQYGLRCGKCKLHNVNVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEFEASNVTI 822 Query: 362 QGNHVFEVPDGYKMKITTGDSGLAVELKPIENKLMESGSWFWNYKIMGNHVQLELVEL 535 +G+HVFEVPDG+K+KIT+G++GL++ L+ ++ ++ME+GSW+WNY++ G+H+ L+ VE+ Sbjct: 823 EGHHVFEVPDGHKLKITSGNAGLSINLEALKEEVMETGSWYWNYQLNGSHIHLQQVEV 880 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,757,748 Number of Sequences: 27288 Number of extensions: 354989 Number of successful extensions: 1105 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1043 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1104 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1218881876 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264727|gb|BM413097.1|BM413097 EST587424 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62A18 5' end, mRNA sequence (807 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g46450.1 SEC14 cytosolic factor, putative / supported by c... 270 5e-73 At4g36640.1 putative protein / 58 5e-09 At3g24840.1 phosphatidylinositol transfer protein, putative / ... 58 7e-09 At4g39180.1 SEC14 - like protein / phosphatidylinositol-phosp... 57 9e-09 At4g08690.1 putative phosphoglyceride transfer protein / simi... 57 2e-08 At4g36490.1 expressed protein / ; supported by cDNA: gi_15215... 56 2e-08 At5g47510.1 SEC14 cytosolic factor, putative / contains simil... 56 2e-08 At2g21540.1 putative phosphatidylinositol phophatidylcholine tra... 56 3e-08 At1g75170.1 unknown protein / ; supported by cDNA: gi_17979168 55 3e-08 At1g75370.1 sec14 cytosolic factor, putative / similar to SP:... 54 8e-08 At2g18180.1 putative phosphatidylinositol/phophatidylcholine tra... 54 1e-07 At2g21520.1 putative phosphatidylinositol/phosphatidylcholine tr... 53 2e-07 At1g22180.1 hypothetical protein / contains Pfam profile: PF0... 52 3e-07 At1g19650.1 sec14 cytosolic factor, putative / similar to SP:... 51 6e-07 At4g34580.1 putative protein / SEC14 protein, Saccharomyces c... 50 2e-06 At5g56160.1 putative protein / contains similarity to phospha... 49 2e-06 >At3g46450.1 SEC14 cytosolic factor, putative / supported by cDNA: gi_20453103 Length = 486 Score = 270 bits (691), Expect = 5e-73 Identities = 124/254 (48%), Positives = 177/254 (68%) Frame = +2 Query: 2 SDQSSSTGETTPNDFHHSQAYPQARSHDEVQDDGYPQRWLLELHKELREESISVPERLND 181 ++ +S+ + +D Q+ R DE Q WL +L++EL ++ +S+PERLN+ Sbjct: 145 TNSHASSESESQSDSQTLQSPSDIRIEDEAPLPVISQDWLRKLYEELEKQRLSLPERLNE 204 Query: 182 DELRQFYAAANGDFARLLSSVKKTIKWRQNYTFLSPEELKAWSPFIFWHGHDANQRPCLI 361 DEL +FY +NGDF LLSS+KKTI WR+ Y LS EEL+ WS +FWHG+D NQRPCLI Sbjct: 205 DELHRFYRVSNGDFTSLLSSIKKTIHWRETYRILSEEELETWSSLLFWHGYDKNQRPCLI 264 Query: 362 IRLGLACSNLRSNGKSLLIKAVVSQIEHGILRMVNVEHPQITVLMDCEGLSPFGFPIHMM 541 +RLGLA L S+ + +A++SQ+EHG+L ++ E+ ++TVL+DCEGLSP P+ MM Sbjct: 265 VRLGLAFLKLPSHERPRFAQAIISQVEHGVLHLLTPENSELTVLVDCEGLSPLRIPMQMM 324 Query: 542 RSCAMLLQDHYPNRLSSLIIVRLPQVAQIIMQTFFQVLKPSTRQKVRIIGRNHLEFLSNH 721 RSC+ +LQDH+PNRL L I+RLP V ++I QTF Q+L+P+TR+K+RI G LS + Sbjct: 325 RSCSSILQDHFPNRLGCLFIIRLPPVVRVISQTFIQILRPTTRKKLRIEGETFHRVLSEY 384 Query: 722 LNSIPPFLGGNCSC 763 L ++P +LG NC+C Sbjct: 385 LQTLPSYLGSNCNC 398 >At4g36640.1 putative protein / Length = 294 Score = 58.2 bits (139), Expect = 5e-09 Identities = 60/260 (23%), Positives = 110/260 (42%), Gaps = 16/260 (6%) Frame = +2 Query: 62 YPQARSHDEVQDDGYPQRWLLELHKELREESISVPERLNDDELRQFYAAANGDFARLLSS 241 + + +H DD + EL + S +D LR+F A N D + Sbjct: 2 FRRRNAHQLDNDDSQQDNKVRELKSAIGPLSGHSLVFCSDASLRRFLDARNWDVEKAKKM 61 Query: 242 VKKTIKWRQNYTFLSPEELKAWSPFIFWHG----------HDANQRPCLIIRLGLACSNL 391 +++T+KWR Y P+E++ W+ + G HD R LI+R + S Sbjct: 62 IQETLKWRSTY---KPQEIR-WNQ-VAHEGETGKASRASFHDRQGRVVLIMRPAMQNSTS 116 Query: 392 RSNGKSLLIKAVVSQIEHGILRMVNVEHPQITVLMDCEGLS-PFGFPIHMMRSCAMLLQD 568 + I+ +V +E+ I+ + + Q++ L+D G S P+ R +LQ+ Sbjct: 117 QEGN----IRHLVYLLENAIINLPKGQ-KQMSWLIDFTGWSMAVNPPMKTTREIIHILQN 171 Query: 569 HYPNRLSSLIIVRLPQVAQIIMQTFFQVLKPSTRQKVRII---GRNHLEFLSNH--LNSI 733 +YP RL + P++ Q + + L P T +KV+ + + E ++ H + ++ Sbjct: 172 YYPERLGIAFLYNPPRLFQAVYRAAKYFLDPRTAEKVKFVYPKDKASDELMTTHFDVENL 231 Query: 734 PPFLGGNCSCSNAQTDGCRK 793 P GG + D R+ Sbjct: 232 PKEFGGEATLEYDHEDFSRQ 251 >At3g24840.1 phosphatidylinositol transfer protein, putative / similar to SEC14 CYTOSOLIC FACTOR (PHOSPHATIDYLINOSITOL/PHOSPHATIDYLCHOLINE TRANSFER PROTEIN) GB:P46250 from [Candida albicans] (Yeast (1996) 12(11), 1097-1105) Length = 535 Score = 57.8 bits (138), Expect = 7e-09 Identities = 56/241 (23%), Positives = 101/241 (41%), Gaps = 30/241 (12%) Frame = +2 Query: 161 VPERLND-DELRQFYAAANGDFARLLSSVKKTIKWR---------QNYTFLSPEELKAWS 310 +P R +D + +F A D + + ++ +KWR Q++ + EE++ + Sbjct: 99 LPPRHDDYHTMLRFLKARRFDLEKTVQMWEEMLKWRKENGVDTIIQDFVYDEYEEVQQYY 158 Query: 311 PFIFWHGHDANQRPCLIIRLGLACSNLRSNGKSLLIKAVVSQIEH---GILRMVNVEHP- 478 P + HG D RP I RLG GK + + + + + G + + + P Sbjct: 159 PHGY-HGVDREGRPVYIERLGKI-----DPGKLMKVTTLERFLRYHVQGFEKTFSEKFPA 212 Query: 479 ----------QITVLMDCEGLSPFGFPIHMMRSCAMLLQ----DHYPNRLSSLIIVRLPQ 616 T ++D G+S F + + M +Q D+YP L+ + I+ Sbjct: 213 CSIAAKRHINSSTTIIDVHGVSWMSFR-KLAQDLVMRMQKIDGDNYPETLNQMYIINAGN 271 Query: 617 VAQIIMQTFFQVLKPSTRQKVRIIGRNHLEFLSNHL--NSIPPFLGGNCSCSNAQTDGCR 790 +++ T L P T K+ ++G + L + + +P FLGGNC C A GC Sbjct: 272 GFKLVWNTVKGFLDPKTTSKIHVLGNKYRSHLLEIIDPSELPEFLGGNCKC--AHEGGCM 329 Query: 791 K 793 + Sbjct: 330 R 330 >At4g39180.1 SEC14 - like protein / phosphatidylinositol-phosphatidylcholine transfer protein SEC14, Yarrowia lipolytica, PIR2:S43745 Length = 550 Score = 57.4 bits (137), Expect = 9e-09 Identities = 58/241 (24%), Positives = 98/241 (40%), Gaps = 30/241 (12%) Frame = +2 Query: 161 VPERLNDDELR-QFYAAANGDFARLLSSVKKTIKWRQNY---------TFLSPEELKAWS 310 +P + +D + +F A D + + WR+ Y F EE+ + Sbjct: 87 LPSKHDDHHMMLRFLRARKFDLEKAKQMWSDMLNWRKEYGADTIMEDFDFKEIEEVVKYY 146 Query: 311 PFIFWHGHDANQRPCLIIRLGL--ACSNLRSNGKSLLIKAVVSQIEHGILRMVNVEHP-- 478 P + HG D RP I RLG A ++ +K V + E + NV+ P Sbjct: 147 PQGY-HGVDKEGRPIYIERLGQVDATKLMKVTTIDRYVKYHVKEFE----KTFNVKFPAC 201 Query: 479 ---------QITVLMDCEGLSPFGF---PIHMMRSCAMLLQDHYPNRLSSLIIVRLPQVA 622 Q T ++D +G+ F +++S + D+YP L+ + I+ Sbjct: 202 SIAAKRHIDQSTTILDVQGVGLSNFNKAAKDLLQSIQKIDNDNYPETLNRMFIINAGCGF 261 Query: 623 QIIMQTFFQVLKPSTRQKVRIIGRNH----LEFLSNHLNSIPPFLGGNCSCSNAQTDGCR 790 +++ T L P T K+ ++G + LE + N +P FLGG C+C A GC Sbjct: 262 RLLWNTVKSFLDPKTTAKIHVLGNKYQTKLLEIID--ANELPEFLGGKCTC--ADKGGCM 317 Query: 791 K 793 + Sbjct: 318 R 318 >At4g08690.1 putative phosphoglyceride transfer protein / similar to SEC14-like protein of D. discoideum, GenBank accession number U82515 Length = 301 Score = 56.6 bits (135), Expect = 2e-08 Identities = 48/195 (24%), Positives = 87/195 (44%), Gaps = 10/195 (5%) Frame = +2 Query: 134 KELREESISVPERLN----DDELRQFYAAANGDFARLLSSVKKTIKWRQNYTFLSPEELK 301 +E+R+ +PE+L+ DD + ++ A N + +K+T+KWR Y PEE+ Sbjct: 24 EEVRKLLGPLPEKLSSFCSDDAVLRYLRARNWHVKKATKMLKETLKWRVQY---KPEEI- 79 Query: 302 AWSPFIFWHGHDANQRPCLIIRLGLACSNLRSNGKSLLIKAVVSQIEHGILRMVNVEH-- 475 W R + +LG +R + ++ K+V QI + + M N Sbjct: 80 CWEEVAGEAETGKIYRSSCVDKLGRPVLIMRPSVENS--KSVKGQIRYLVYCMENAVQNL 137 Query: 476 ----PQITVLMDCEGLSPFGFPIHMMRSCAMLLQDHYPNRLSSLIIVRLPQVAQIIMQTF 643 Q+ ++D G S + + A +LQ+HYP RL+ ++ P+ + + Sbjct: 138 PPGEEQMVWMIDFHGYSLANVSLRTTKETAHVLQEHYPERLAFAVLYNPPKFFEPFWKVA 197 Query: 644 FQVLKPSTRQKVRII 688 L+P TR KV+ + Sbjct: 198 RPFLEPKTRNKVKFV 212 >At4g36490.1 expressed protein / ; supported by cDNA: gi_15215779_gb_AY050419.1_ Length = 543 Score = 56.2 bits (134), Expect = 2e-08 Identities = 57/242 (23%), Positives = 101/242 (41%), Gaps = 31/242 (12%) Frame = +2 Query: 161 VPERLNDDELR-QFYAAANGDFARLLSSVKKTIKWRQNY---TFLSPEELKAWSPFIFW- 325 +PE+ +D + +F A D + + ++WR+ + T + + K + + Sbjct: 69 LPEKHDDYHMMLRFLKARKFDLEKTKQMWTEMLRWRKEFGADTVMEEFDFKEIDEVLKYY 128 Query: 326 ----HGHDANQRPCLIIRLGLACSNLRSNGKSLLIKAVVSQIEHGIL---RMVNVEHP-- 478 HG D RP I RLGL S K + + + + + ++ R NV+ P Sbjct: 129 PQGHHGVDKEGRPVYIERLGLVDST-----KLMQVTTMDRYVNYHVMEFERTFNVKFPAC 183 Query: 479 ---------QITVLMDCEGLSPFGFPIHMMRSCAMLLQ----DHYPNRLSSLIIVRLPQV 619 Q T ++D +G+ F R LQ D+YP L+ + I+ Sbjct: 184 SIAAKKHIDQSTTILDVQGVGLKNFN-KAARDLITRLQKVDGDNYPETLNRMFIINAGSG 242 Query: 620 AQIIMQTFFQVLKPSTRQKVRIIGRNH----LEFLSNHLNSIPPFLGGNCSCSNAQTDGC 787 +++ T L P T K+ ++G + LE + + +P FLGG+C+C A GC Sbjct: 243 FRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDE--SELPEFLGGSCTC--ADNGGC 298 Query: 788 RK 793 + Sbjct: 299 MR 300 >At5g47510.1 SEC14 cytosolic factor, putative / contains similarity to phosphatidylinositol/phosphatidylcholine transfer protein Length = 403 Score = 56.2 bits (134), Expect = 2e-08 Identities = 65/248 (26%), Positives = 107/248 (42%), Gaps = 29/248 (11%) Frame = +2 Query: 113 RWLLELHKELREESISVPERLND-DELRQFYAAANGDFARLLSSVKKTIKWR-------- 265 R LL LH L P++ D + LR+F + D + + +KWR Sbjct: 32 RNLLLLHGHL-------PDKHGDHNTLRRFLKMRDFDLEKSKEAFLNYMKWRVDYKVDLI 84 Query: 266 -QNYTFLSPEELKAWSPFIFWHGHDANQRPCLIIRLGLACSNLRSNGKSLLIKAVVSQIE 442 Q + F E+K P F H D RP I RLG+ ++L + K+ I+ V+ Sbjct: 85 SQKFKFEEYGEVKKHYPHGF-HKVDKTGRPIYIERLGM--TDLNAFLKATTIERYVNYHI 141 Query: 443 HGILRMVNVEHPQITVLMDCE-------------GLSPFGFPIHMMRSCAMLLQ----DH 571 + +++ +P ++ D G+S F P RS M +Q ++ Sbjct: 142 KEQEKTMSLRYPACSIASDKHVSSTTTILDVSGVGMSNFSKPA---RSLFMEIQKIDSNY 198 Query: 572 YPNRLSSLIIVRLPQVAQIIMQTFFQVLKPSTRQKVRIIGRNHLEFLSNHL--NSIPPFL 745 YP L L +V +++ L T KV+++G N+L L + +++P FL Sbjct: 199 YPETLHRLFVVNASSGFRMLWLALKTFLDARTLAKVQVLGPNYLGELLEAIEPSNLPTFL 258 Query: 746 GGNCSCSN 769 GGNC+CS+ Sbjct: 259 GGNCTCSD 266 >At2g21540.1 putative phosphatidylinositol phophatidylcholine transfer protein / ; supported by cDNA: gi_16209641_gb_AY057587.1_ Length = 548 Score = 55.8 bits (133), Expect = 3e-08 Identities = 56/241 (23%), Positives = 101/241 (41%), Gaps = 30/241 (12%) Frame = +2 Query: 161 VPERLNDDELR-QFYAAANGDFARLLSSVKKTIKWR---------QNYTFLSPEELKAWS 310 +P + +D + +F A D + I WR +++ F +E+ + Sbjct: 86 LPSKHDDHHMMLRFLRARKFDLEKAKQMWTDMIHWRKEFGVDTIMEDFDFKEIDEVLKYY 145 Query: 311 PFIFWHGHDANQRPCLIIRLGL--ACSNLRSNGKSLLIKAVVSQIEHGILRMVNVEHP-- 478 P + HG D + RP I RLG A ++ +K V + E + N++ P Sbjct: 146 PQGY-HGVDKDGRPVYIERLGQVDATKLMQVTTIDRYVKYHVREFE----KTFNIKLPAC 200 Query: 479 ---------QITVLMDCEGLSPFGFPI---HMMRSCAMLLQDHYPNRLSSLIIVRLPQVA 622 Q T ++D +G+ F +++ + D+YP L+ + I+ Sbjct: 201 SIAAKKHIDQSTTILDVQGVGLKSFSKAARDLLQRIQKIDSDNYPETLNRMFIINAGSGF 260 Query: 623 QIIMQTFFQVLKPSTRQKVRIIGRNH----LEFLSNHLNSIPPFLGGNCSCSNAQTDGCR 790 +++ T L P T K+ ++G + LE + + N +P FLGGNC+C A GC Sbjct: 261 RLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDS--NELPEFLGGNCTC--ADKGGCM 316 Query: 791 K 793 + Sbjct: 317 R 317 >At1g75170.1 unknown protein / ; supported by cDNA: gi_17979168 Length = 296 Score = 55.5 bits (132), Expect = 3e-08 Identities = 55/209 (26%), Positives = 98/209 (46%), Gaps = 17/209 (8%) Frame = +2 Query: 176 NDDELRQFYAAANGDFARLLSSVKKTIKWRQNYTFLSPEELKAWSPF--------IFWHG 331 +D L+++ A N + + +++T+KWR ++ PEE++ W+ ++ G Sbjct: 43 SDACLKRYLEARNWNVGKAKKMLEETLKWRSSF---KPEEIR-WNEVSGEGETGKVYKAG 98 Query: 332 -HDANQRPCLIIRLGLACSNLRSNGKSL--LIKAVVSQIEHGILRMVNVEHPQITVLMDC 502 HD + R LI+R GL N KSL +K +V IE+ IL + + Q++ L+D Sbjct: 99 FHDRHGRTVLILRPGL------QNTKSLENQMKHLVYLIENAILNLPE-DQEQMSWLIDF 151 Query: 503 EGLS-PFGFPIHMMRSCAMLLQDHYPNRLSSLIIVRLPQVAQIIMQTFFQVLKPSTRQKV 679 G S PI R +LQ+HYP RL+ + P++ + + + T KV Sbjct: 152 TGWSMSTSVPIKSARETINILQNHYPERLAVAFLYNPPRLFEAFWKIVKYFIDAKTFVKV 211 Query: 680 RII---GRNHLEFLSNHLN--SIPPFLGG 751 + + +E +S + ++P GG Sbjct: 212 KFVYPKNSESVELMSTFFDEENLPTEFGG 240 >At1g75370.1 sec14 cytosolic factor, putative / similar to SP:P24859 from [Kluyveromyces lactis] Length = 530 Score = 54.3 bits (129), Expect = 8e-08 Identities = 56/231 (24%), Positives = 95/231 (40%), Gaps = 31/231 (13%) Frame = +2 Query: 194 QFYAAANGDFARLLSSVKKTIKWR---------QNYTFLSPEELKAWSPFIFWHGHDANQ 346 +F A D + IKWR +++ F +E+ + P + HG D Sbjct: 3 RFLKARKFDIGKTKLMWSNMIKWRKDFGTDTIFEDFEFEEFDEVLKYYPHGY-HGVDKEG 61 Query: 347 RPCLIIRLGLACSNLRSNGKSLLIKAVVSQIEHGIL---RMVNVEHPQI----------- 484 RP I RLGL K + + V I + + + VN++ P Sbjct: 62 RPVYIERLGLV-----DPAKLMQVTTVERFIRYHVREFEKTVNIKLPACCIAAKRHIDSS 116 Query: 485 TVLMDCEGLSPFGFPIHMMRSCAMLLQ------DHYPNRLSSLIIVRLPQVAQIIMQTFF 646 T ++D +G+ GF + +++Q D+YP L + I+ +++ T Sbjct: 117 TTILDVQGV---GFKNFSKPARDLIIQLQKIDNDNYPETLHRMFIINGGSGFKLVWATVK 173 Query: 647 QVLKPSTRQKVRIIGRNHLEFLSNHLNS--IPPFLGGNCSCSNAQTDGCRK 793 Q L P T K+ +IG + L +++ +P FLGG C+C A GC + Sbjct: 174 QFLDPKTVTKIHVIGNKYQNKLLEIIDASQLPDFLGGTCTC--ADRGGCMR 222 >At2g18180.1 putative phosphatidylinositol/phophatidylcholine transfer protein / Length = 558 Score = 53.5 bits (127), Expect = 1e-07 Identities = 55/240 (22%), Positives = 99/240 (40%), Gaps = 29/240 (12%) Frame = +2 Query: 161 VPERLNDDELR-QFYAAANGDFARLLSSVKKTIKWRQNY---TFLSPEELKAWSPFIFW- 325 +P++ +D + +F A D + ++WR+ + T + E K + + Sbjct: 72 LPDKHDDYHMMLRFLKARKFDLEKTNQMWSDMLRWRKEFGADTVMEDFEFKEIDEVLKYY 131 Query: 326 ----HGHDANQRPCLIIRLGLACSNLRSNGKSLLIKAVVSQIEHGIL---RMVNVEHP-- 478 HG D RP I RLG S K + + + + + ++ R NV+ P Sbjct: 132 PQGHHGVDKEGRPVYIERLGQVDST-----KLMQVTTMDRYVNYHVMEFERTFNVKFPAC 186 Query: 479 ---------QITVLMDCEGLSPFGFPIHMMRSCAMLLQ----DHYPNRLSSLIIVRLPQV 619 Q T ++D +G+ F R LQ D+YP L+ + I+ Sbjct: 187 SIAAKKHIDQSTTILDVQGVGLKNFN-KAARDLITRLQKVDGDNYPETLNRMFIINAGSG 245 Query: 620 AQIIMQTFFQVLKPSTRQKVRIIGRNHLEFLSNHLNS--IPPFLGGNCSCSNAQTDGCRK 793 +++ T L P T K+ ++G + L +++ +P FLGG+C+C A GC + Sbjct: 246 FRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELPEFLGGSCTC--ADNGGCMR 303 >At2g21520.1 putative phosphatidylinositol/phosphatidylcholine transfer protein / Length = 531 Score = 53.1 bits (126), Expect = 2e-07 Identities = 57/238 (23%), Positives = 94/238 (38%), Gaps = 29/238 (12%) Frame = +2 Query: 161 VPERLNDDELR-QFYAAANGDFARLLSSVKKTIKWR---------QNYTFLSPEELKAWS 310 +P+R +D + +F A D + I+WR Q++ F E+ Sbjct: 5 LPDRHDDYHMMLRFLKARKFDVEKAKQMWADMIQWRKEFGTDTIIQDFDFEEINEVLKHY 64 Query: 311 PFIFWHGHDANQRPCLIIRLGLACSN--LRSNGKSLLIKAVVSQIEHGILRMVNVEHPQI 484 P + HG D RP I RLG N ++ ++ V + E + ++ P Sbjct: 65 PQCY-HGVDKEGRPIYIERLGKVDPNRLMQVTSMDRYVRYHVKEFERSFM----IKFPSC 119 Query: 485 TV-----------LMDCEGLSPFGFPIHMMRSCAMLLQ----DHYPNRLSSLIIVRLPQV 619 T+ ++D +G+ F R LQ D+YP L + I+ Sbjct: 120 TISAKRHIDSSTTILDVQGVGLKNFN-KSARDLITRLQKIDGDNYPETLHQMFIINAGPG 178 Query: 620 AQIIMQTFFQVLKPSTRQKVRIIGRNHLEFLSN--HLNSIPPFLGGNCSCSNAQTDGC 787 +++ T L P T K+ ++G +L L +N +P FLGG C+C A GC Sbjct: 179 FRLLWNTVKSFLDPKTSAKIHVLGYKYLSKLLEVIDVNELPEFLGGACTC--ADQGGC 234 >At1g22180.1 hypothetical protein / contains Pfam profile: PF00650 CRAL/TRIO domain; supported by cDNA: gi_18253034 Length = 249 Score = 52.4 bits (124), Expect = 3e-07 Identities = 38/156 (24%), Positives = 74/156 (47%), Gaps = 7/156 (4%) Frame = +2 Query: 242 VKKTIKWRQNYTFLSPEELKAWSPFI-------FWHGHDANQRPCLIIRLGLACSNLRSN 400 +K+T+KWR Y PEE++ W + + ++ ++ + +C N +S Sbjct: 2 LKETLKWRAQY---KPEEIR-WEEIAREAETGKIYRANCTDKYGRTVLVMRPSCQNTKSY 57 Query: 401 GKSLLIKAVVSQIEHGILRMVNVEHPQITVLMDCEGLSPFGFPIHMMRSCAMLLQDHYPN 580 I+ +V +E+ IL + + + Q+ L+D G + + + R A +LQ+HYP Sbjct: 58 KGQ--IRILVYCMENAILNLPDNQE-QMVWLIDFHGFNMSHISLKVSRETAHVLQEHYPE 114 Query: 581 RLSSLIIVRLPQVAQIIMQTFFQVLKPSTRQKVRII 688 RL I+ P++ + + L+P T KV+ + Sbjct: 115 RLGLAIVYNPPKIFESFYKMVKPFLEPKTSNKVKFV 150 >At1g19650.1 sec14 cytosolic factor, putative / similar to SP:P24859 from [Kluyveromyces lactis]; supported by cDNA: gi_15810424_gb_AY056251.1_ Length = 608 Score = 51.2 bits (121), Expect = 6e-07 Identities = 65/292 (22%), Positives = 117/292 (39%), Gaps = 36/292 (12%) Frame = +2 Query: 26 ETTPNDFHHSQAYPQARSHDEVQD-------DGYPQRWLLELHKELREESISVPERLNDD 184 +++ + F HS +RS D D R++ E + L + + +P L+D Sbjct: 44 KSSKSKFRHSLKRRGSRSIDRTLSLTFEDIHDAEELRYVSEFRQSLISDHL-LPPNLDDY 102 Query: 185 ELR-QFYAAANGDFARLLSSVKKTIKWR---------QNYTFLSPEELKAWSPFIFWHGH 334 + +F A D + I+WR +++ F +E+ + P + HG Sbjct: 103 HIMLRFLFARKFDLGKAKLMWTNMIQWRRDFGTDTILEDFEFPELDEVLRYYPQGY-HGV 161 Query: 335 DANQRPCLIIRLGLACSNLRSNGKSL--LIKAVVSQIEHGILRMVNVEHPQI-------- 484 D RP I RLG ++ +L ++ V + E + + V+ P Sbjct: 162 DKEGRPVYIERLGKVDASKLMQVTTLERYLRYHVKEFE----KTITVKFPACCIAAKRHI 217 Query: 485 ---TVLMDCEGLSPFGFPIHMMRSCAMLLQ----DHYPNRLSSLIIVRLPQVAQIIMQTF 643 T ++D +GL F R + LQ D+YP L + I+ +++ T Sbjct: 218 DSSTTILDVQGLGLKNFT-KTARDLIIQLQKIDSDNYPETLHRMFIINAGSGFKLLWGTV 276 Query: 644 FQVLKPSTRQKVRIIGRNHLEFLSNHLNS--IPPFLGGNCSCSNAQTDGCRK 793 L P T K+ ++G + L +++ +P F GG C+C A GC + Sbjct: 277 KSFLDPKTVSKIHVLGNKYQNKLLEMIDASQLPDFFGGTCTC--ADQGGCMR 326 >At4g34580.1 putative protein / SEC14 protein, Saccharomyces cerevisiae, PIR2:A30106 Length = 560 Score = 49.7 bits (117), Expect = 2e-06 Identities = 51/235 (21%), Positives = 95/235 (39%), Gaps = 24/235 (10%) Frame = +2 Query: 161 VPERLNDDELR-QFYAAANGDFARLLSSVKKTIKWR---------QNYTFLSPEELKAWS 310 +P +L+D + +F A D + I+WR +++ F +E+ Sbjct: 79 LPSKLDDLHMMLRFLRARKFDIEKAKQMWSDMIQWRKDFGADTIIEDFDFEEIDEVMKHY 138 Query: 311 PFIFWHGHDANQRPCLIIRLGLACSN--LRSNGKSLLIKAVVSQIEH-------GILRMV 463 P + HG D RP I RLG +N L+ +K V + E Sbjct: 139 PQGY-HGVDKEGRPVYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTFKVKFPSCSVAA 197 Query: 464 NVEHPQITVLMDCEGLSPFGFPI---HMMRSCAMLLQDHYPNRLSSLIIVRLPQVAQIIM 634 N Q T ++D +G+ F +++ + ++YP L+ + I+ +++ Sbjct: 198 NKHIDQSTTILDVQGVGLKNFSKSARELLQRLCKIDNENYPETLNRMFIINAGSGFRLLW 257 Query: 635 QTFFQVLKPSTRQKVRIIGRNHLEFLSNHLNS--IPPFLGGNCSCSNAQTDGCRK 793 T L P T K+ ++G + L +++ +P F GG C+C + GC + Sbjct: 258 STVKSFLDPKTTAKIHVLGNKYHSKLLEVIDASELPEFFGGACTCED--KGGCMR 310 >At5g56160.1 putative protein / contains similarity to phosphatidylinositol/phosphatidylcholine transfer protein Length = 592 Score = 49.3 bits (116), Expect = 2e-06 Identities = 56/262 (21%), Positives = 114/262 (43%), Gaps = 33/262 (12%) Frame = +2 Query: 83 DEVQDDGYPQRWLLELHKELREESISVPERLNDDELRQFYAAANGDFARLLSSVKKTIKW 262 ++V+D+ ++ + +L ++L ++ + P + L +F + +++ ++ +KW Sbjct: 76 EDVRDEK-EEKLVSKLRQQLLQKDLLPPVHDDYHMLLRFLKTMEFKIEKTVTAWEEMLKW 134 Query: 263 R---------QNYTFLSPEELKAWSPFIFWHGHDANQRPCLIIRLGLACSNLRSNGKSLL 415 R Q++ F +E+ P + HG D + RP I RLG A GK + Sbjct: 135 RKEFGTDRIIQDFNFKELDEVTRHYPQGY-HGVDKDGRPIYIERLGKA-----HPGKLME 188 Query: 416 IKAVVSQIEHGILRMVNVEHPQI--------------TVLMDCEGLSPFGFP---IHMMR 544 + + +++ + ++ T ++D EGL F +++ Sbjct: 189 VTTIERYLKYHVQEFERTLQEKLPACSVAAKRRVTTTTTILDVEGLGMKNFTPTAANLLA 248 Query: 545 SCAMLLQDHYPNRLSSLIIVRLPQVAQIIMQTFF-----QVLKPSTRQKVRIIGRNHLEF 709 + A + ++YP L + IV A I ++F ++L P T K++++ L Sbjct: 249 TIAKVDCNYYPETLHRMFIVN----AGIGFRSFLWPAAQKLLDPMTIAKIQVLEPRSLSK 304 Query: 710 LSNHLNS--IPPFLGGNCSCSN 769 L ++S +P FLGG C C N Sbjct: 305 LLEAIDSSQLPEFLGGLCKCPN 326 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,227,801 Number of Sequences: 27288 Number of extensions: 407399 Number of successful extensions: 1199 Number of sequences better than 1.0e-05: 32 Number of HSP's better than 0.0 without gapping: 1125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1175 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1503203240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264702|gb|BM413072.1|BM413072 EST587399 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62K15 5' end, mRNA sequence (775 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g08640.1 expressed protein / ;supported by full-length cDN... 246 1e-66 >At1g08640.1 expressed protein / ;supported by full-length cDNA: Ceres:35718. Length = 294 Score = 246 bits (629), Expect(2) = 1e-66 Identities = 121/191 (63%), Positives = 149/191 (77%), Gaps = 2/191 (1%) Frame = +1 Query: 178 YIRFSVKSRLNKRMVC-AAASAAGSSSSSDDSNPYEVLGVNPIEGFDMVKAAYARRRKDA 354 ++R + L R+V AA+SAAG+ S D NPYEVLGVNPIEGFD +K Y R+ KDA Sbjct: 42 FVRLPLGKVLQSRIVIRAASSAAGNPQSDADFNPYEVLGVNPIEGFDKIKQTYGRKLKDA 101 Query: 355 ERRGDEATLAQLEKAYDKIMMSQLTKRKQGVTFGSFKVSKEVRYADKQPILPWGPRFTKS 534 +R GDEAT A LEKAYDK+M +QL RK+GVTFGSFKVSK+++YADKQPI+PWGPRF++S Sbjct: 102 QRSGDEATAALLEKAYDKLMYAQLMNRKKGVTFGSFKVSKDIKYADKQPIIPWGPRFSRS 161 Query: 535 DDKDIKINLAISAVFIAWVFINRNAEWKPLQFLAFAFVYRIFEKLKAFE-PPTPTFTEEG 711 D+ INLAIS VF AW+ I RN E+KPLQF++F FVYRIFEKLK+FE P +P + EEG Sbjct: 162 SKNDMLINLAISVVFSAWIAIKRNVEYKPLQFMSFVFVYRIFEKLKSFEAPSSPIYNEEG 221 Query: 712 EDEGTMMRMGK 744 E+ G +RMGK Sbjct: 222 EESGRGLRMGK 232 Score = 24.6 bits (52), Expect(2) = 1e-66 Identities = 11/12 (91%), Positives = 12/12 (99%) Frame = +3 Query: 738 GKRLLRSLALVF 773 GKRLLRSL+LVF Sbjct: 231 GKRLLRSLSLVF 242 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,890,493 Number of Sequences: 27288 Number of extensions: 367036 Number of successful extensions: 1169 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1163 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264689|gb|BM413059.1|BM413059 EST587386 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62G23 5' end, mRNA sequence (784 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01220.1 hypothetical protein / similar to unknown protein... 244 e-100 >At1g01220.1 hypothetical protein / similar to unknown protein GB:AAF32477 GI:6957733 from [Arabidopsis thaliana] Length = 1055 Score = 244 bits (622), Expect(2) = e-100 Identities = 122/159 (76%), Positives = 135/159 (84%) Frame = +3 Query: 3 KIELPVRVDFVGGWSDTPPWSLERAGCVLNMAITLEDSLPIGTVIEIEKGTGIFISDDVG 182 K+ELPVRVDFVGGWSDTPPWSLERAG VLNMAITLE SLPIGT+IE GI I DD G Sbjct: 714 KVELPVRVDFVGGWSDTPPWSLERAGYVLNMAITLEGSLPIGTIIETTNQMGISIQDDAG 773 Query: 183 NQLSIEDLSSIALPFEISDPFRLVKSALLVTSVIHEKILQSVALQIRTWANVPRGSGLGT 362 N+L IED SI PFE++DPFRLVKSALLVT ++ E + S L I+TWANVPRGSGLGT Sbjct: 774 NELHIEDPISIKTPFEVNDPFRLVKSALLVTGIVQENFVDSTGLAIKTWANVPRGSGLGT 833 Query: 363 SSILAAAVVKGLLRITDGDESNENVTRLVLVLEQLMGTG 479 SSILAAAVVKGLL+I++GDESNEN+ RLVLVLEQLMGTG Sbjct: 834 SSILAAAVVKGLLQISNGDESNENIARLVLVLEQLMGTG 872 Score = 139 bits (349), Expect(2) = e-100 Identities = 71/101 (70%), Positives = 80/101 (78%) Frame = +1 Query: 478 GGGWQDQIGGLYAGIKFTASFPGIPLRLQVIPLLASPQLIKELQQRLSCSFHWSSSTCTP 657 GGGWQDQIGGLY GIKFT+SFPGIP+RLQV+PLLASPQLI EL+QRL F Sbjct: 872 GGGWQDQIGGLYPGIKFTSSFPGIPMRLQVVPLLASPQLISELEQRLLVVF-TGQVRLAH 930 Query: 658 GACIRVVTRYLQRDNLLVSSIKRLTELAKIAREAFMSCDID 780 +VVTRYLQRDNLL+SSIKRLTELAK REA M+C++D Sbjct: 931 QVLHKVVTRYLQRDNLLISSIKRLTELAKSGREALMNCEVD 971 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,644,838 Number of Sequences: 27288 Number of extensions: 404472 Number of successful extensions: 1205 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1202 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1445754580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264667|gb|BM413037.1|BM413037 EST587364 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG62C23 5' end, mRNA sequence (803 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18420.1 putative protein / non-consensus GC donor splice ... 226 8e-60 >At5g18420.1 putative protein / non-consensus GC donor splice site at exon 1, unknown (C40) protein, Homo sapiens, EMBL:AF103798 Length = 441 Score = 226 bits (577), Expect = 8e-60 Identities = 113/235 (48%), Positives = 162/235 (68%), Gaps = 1/235 (0%) Frame = +2 Query: 26 EESNMLLTMLKAGDHRPFDEIVADFISSFPPHRQFYTCFSLALIL-DEKLLKPAQRLVAF 202 EES ++L++LK+ D RP ++++++F S F R C SL+++L D+++ K +RL+AF Sbjct: 12 EESAIVLSLLKS-DLRPMEDVLSEFDSKFESARYLSVCNSLSMMLQDQQMFKNTERLIAF 70 Query: 203 AILLQVYSSQEPSSNPFISLLVNAACDEGAEQCERAFILQLLSSASSTSSREVLKQSATD 382 I+ Q YSSQ+PS NPF+S +++AAC+E E+ ERAF+L LL S + +E+LK SA D Sbjct: 71 GIIYQCYSSQKPSFNPFLSEMISAACNEQLEKSERAFLLHLLQWNSYNNVKEILKLSAVD 130 Query: 383 YMKMFDTSQLSFPQREQLQQQYGSKALPEEFQCLIGNNSVKNSIPDPDVPRGCDSNSLEF 562 Y++ FD S FP+ +LQ++YG KA P + + S+K + DPDVPRGCD NS EF Sbjct: 131 YIRSFDPSTHDFPELGELQREYGDKADPGPSSHIFADYSLKKLLHDPDVPRGCDPNSPEF 190 Query: 563 DLLPGSKPKIGSGDVDETITGLLSNLSFEGLGPQWIRPHPPRLPVLDGELVWLTP 727 D+ G P+IGSGD DE ++G L NL+ GLGP+WIRP PPR PV EL+W+ P Sbjct: 191 DVQAGVNPRIGSGDRDEALSGFLGNLTMGGLGPRWIRPCPPRYPVHQSELLWIDP 245 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,812,703 Number of Sequences: 27288 Number of extensions: 405211 Number of successful extensions: 1153 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1153 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1494360868 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264578|gb|BM412948.1|BM412948 EST587275 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61B12 5' end, mRNA sequence (682 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50000.1 hypothetical protein / predicted by genemark.hmm 248 2e-66 >At1g50000.1 hypothetical protein / predicted by genemark.hmm Length = 277 Score = 248 bits (634), Expect = 2e-66 Identities = 130/211 (61%), Positives = 160/211 (75%) Frame = +2 Query: 2 LSRSRQTTNSLRAFSSSSSSNQSRGGLPRFYSDKLPPSKDGVVRVKGDEFWHMTRVLRLR 181 L RS T+S ++F++ SSS S L ++ VVRV+G EFWHM +VLRL+ Sbjct: 19 LVRSWLPTSSFKSFATVSSSPPSDLNLR---------NQSRVVRVQGSEFWHMAKVLRLK 69 Query: 182 IHDRVELFDGKGGLVEGCIQNIDQNGLDIVALENPKSVSPHNTQWHVYAAFGTLKGGRAD 361 DRVELF+GKGGLVEGCIQ+ID+ G+D +A E+ K + P QW V+AAFGTLKGGRAD Sbjct: 70 QEDRVELFNGKGGLVEGCIQSIDKTGVDFIAQEDQKVILPQGMQWQVFAAFGTLKGGRAD 129 Query: 362 WLVEKCTELGACSVTPLLTDRSPSISENRVDRLQRVNLAAAKQCQRLHEMVLNPPIKIGG 541 WL+EKCTELGA SVTPLLT+RSP ISENRVDRL+RV+ AAAKQCQRLH+MVLNPPIK G Sbjct: 130 WLIEKCTELGASSVTPLLTERSPIISENRVDRLERVSFAAAKQCQRLHQMVLNPPIKFGT 189 Query: 542 LLPLVKNSKLSFIATAEAKPVFSALSSIKKD 634 LL +SKL +ATAEAKP+ +A++S K+ Sbjct: 190 LL---DHSKLCLVATAEAKPLLNAVNSSAKE 217 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,673,595 Number of Sequences: 27288 Number of extensions: 359587 Number of successful extensions: 1049 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1047 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1156603240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264527|gb|BM412897.1|BM412897 EST587224 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61F3 5' end, mRNA sequence (750 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01760.1 double-stranded RNA-specific editase, putative / ... 121 1e-48 >At1g01760.1 double-stranded RNA-specific editase, putative / similar to double-stranded RNA-specific editase GB:AAF69673 GI:7770275 from [Danio rerio] Length = 325 Score = 121 bits (304), Expect(3) = 1e-48 Identities = 57/72 (79%), Positives = 62/72 (85%) Frame = +3 Query: 402 SFHLW*PLVFVASIPPEEFQHSETALTTLTCGYSICWNNSGLHEVILGTTGRKQGTSAKG 581 SF L PL FVA +PP EFQHSETA TLTCGYS+CWN SGLHEVILGTTGRKQGTSAKG Sbjct: 254 SFRLNKPLFFVAPVPPSEFQHSETAQATLTCGYSLCWNYSGLHEVILGTTGRKQGTSAKG 313 Query: 582 AMSPSTESSLCK 617 A+ PST+SS+CK Sbjct: 314 ALYPSTQSSICK 325 Score = 58.2 bits (139), Expect(3) = 1e-48 Identities = 27/58 (46%), Positives = 42/58 (71%) Frame = +1 Query: 163 RGALLSYFLEPIYISSVTIGQSHIASKTSIIEDEVMRATYERILPLSNKLMDPFQVNK 336 +GALL L+P+YIS++T+GQS + + D + R+ YERILPLS++L+ F++NK Sbjct: 202 QGALLYQVLQPVYISTITVGQSLHSPDNFSLADHLRRSLYERILPLSDELLTSFRLNK 259 Score = 52.4 bits (124), Expect(3) = 1e-48 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 92 VMRKPGRGDTTLSVSCSDKIARWNV 166 V RKPGRG+TTLSVSCSDKIARWNV Sbjct: 174 VQRKPGRGETTLSVSCSDKIARWNV 198 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,574,447 Number of Sequences: 27288 Number of extensions: 406861 Number of successful extensions: 1125 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1082 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1125 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264514|gb|BM412884.1|BM412884 EST587211 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61B15 5' end, mRNA sequence (735 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g46220.1 putative protein / KIAA0776 protein, Homo sapiens... 305 2e-83 >At3g46220.1 putative protein / KIAA0776 protein, Homo sapiens, EMBL:AB018319; supported by cDNA: gi_14334491_gb_AY034937.1_ Length = 530 Score = 305 bits (780), Expect = 2e-83 Identities = 152/228 (66%), Positives = 196/228 (85%), Gaps = 1/228 (0%) Frame = +1 Query: 31 KIKKLLDNLQKKLDESFLNMQLYEKALDLFEDEPSTSVLLHKHLLRTTGTSIVDTLLLNL 210 ++++L+D+LQKKLDESFLNMQLYEKALDLFED+ ST+V+LH+HLLRTT +I DTLL L Sbjct: 267 RMRRLIDDLQKKLDESFLNMQLYEKALDLFEDDQSTAVVLHRHLLRTTAATIADTLLHGL 326 Query: 211 DMLNKLKNGVPVEPQAPES-ILLSPGDRSALAKSLTGSMSAKAIATVEALEGKRVESFMS 387 D+ NK+KNG VE + +LL +R+ALAK+L GS+S KA+A VEALEGKRV++FM Sbjct: 327 DIHNKMKNGTEVEESKTQDLVLLDSSERTALAKNLNGSLSKKALALVEALEGKRVDTFMV 386 Query: 388 ALREVAEESGLALKKLDKKLERTLLHSYRKDLTSQVSAETDPVSLLPQVISLLYVQVHGK 567 R++AEESGL LKKLDKKLERTLLHSYRKDL SQVS E+DP++LL +V+SLL++++H K Sbjct: 387 TFRDLAEESGLVLKKLDKKLERTLLHSYRKDLISQVSTESDPIALLAKVVSLLFIKIHNK 446 Query: 568 ALQAPGRAISAAVSRLKDKLDDSAFKTLVDYQSGTVSVLALMAAATGE 711 ALQAPGRAI+AA+S LK+KLD+SA+KTL DYQ+ TV++LALM+A++GE Sbjct: 447 ALQAPGRAIAAAISHLKEKLDESAYKTLTDYQTATVTLLALMSASSGE 494 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.133 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,916,403 Number of Sequences: 27288 Number of extensions: 351185 Number of successful extensions: 1005 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 978 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1002 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264458|gb|BM412828.1|BM412828 EST587155 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61C22 5' end, mRNA sequence (621 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28200.1 putative protein / hypothetical protein - Schizos... 292 8e-80 >At4g28200.1 putative protein / hypothetical protein - Schizosaccharomyces pombe, PID:e1295810; supported by cDNA: gi_18252168 Length = 648 Score = 292 bits (748), Expect = 8e-80 Identities = 139/212 (65%), Positives = 170/212 (79%), Gaps = 6/212 (2%) Frame = +3 Query: 3 EIYRLATTRFKGDIELWFQYLEFCRERRNGRMKKALAQVIRFHPKVPGVWIYAAAWEFDN 182 EIYRLAT R+KGDI LWF+YLEFC+++R+GRMKKALAQ IRFHPKV GVWIYAA+WEFD Sbjct: 98 EIYRLATMRYKGDINLWFRYLEFCKQKRHGRMKKALAQAIRFHPKVAGVWIYAASWEFDR 157 Query: 183 NLNAAAARALMHSGLRACPTSEDLWVEYLRMELTYLNKLKARKVVLGEDEGTLARSGNSA 362 NLN AARALM +GLR C SEDLWVEYLRMELT+LNKLKARKV LGED+G+L R + Sbjct: 158 NLNVTAARALMLNGLRVCSNSEDLWVEYLRMELTFLNKLKARKVALGEDKGSLVRDTKTV 217 Query: 363 KEEQWRDENKELFIVLDDKREEDKLSNLHDG------DSKEKLDLFRKQGLSVLQTVYGG 524 ++EQW+DENKELF+ LD+K +K N D D EK+D +++G +VLQT+Y G Sbjct: 218 EDEQWKDENKELFMSLDEKEGNEKEENDEDSIVEDVEDVTEKVDFLKEKGSNVLQTIYSG 277 Query: 525 SIRALPSSFSLRTKFLDILEATDLCHSEDMRN 620 ++ A+PSSF LR +FL+ILEATDL HS++MRN Sbjct: 278 AVEAIPSSFDLRKRFLEILEATDLAHSDEMRN 309 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,611,782 Number of Sequences: 27288 Number of extensions: 304298 Number of successful extensions: 1024 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1019 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 990590196 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264438|gb|BM412808.1|BM412808 EST587135 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61O17 5' end, mRNA sequence (763 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g48050.1 regulatory protein, putative / contains Pfam prof... 260 5e-88 >At1g48050.1 regulatory protein, putative / contains Pfam profile: PF02197 Regulatory subunit of type II PKA R-subunit; supported by cDNA: gi_12006421_gb_AF283758.1_AF283758 Length = 680 Score = 260 bits (664), Expect(3) = 5e-88 Identities = 115/195 (58%), Positives = 161/195 (81%) Frame = +2 Query: 2 MSVFSNKSSSKVVYVESPTSLLGALRTRNISPVTIYRGDLEISAQLKIKVWVYKKTSEEK 181 +++FS+ + +K V V+SP SLLG+L+TR ++PVT++RGDLEI+ +KIKVWVYKK +EE+ Sbjct: 184 LTLFSSNAIAKTVNVDSPLSLLGSLKTRRVAPVTLFRGDLEINPTMKIKVWVYKKVAEER 243 Query: 182 FPTLKKYSERTPTTDKFGAHDIKVEYENKIIEDPNKVVPPEQRIKGFQYGPQVVPISSAE 361 PTLK YS++ P TDKF H++KV+Y+ K+ + +V+ PE+RIKGF+YGPQV+PIS + Sbjct: 244 LPTLKMYSDKAPPTDKFAKHEVKVDYDYKVTAESTEVIAPEERIKGFRYGPQVIPISPDQ 303 Query: 362 LEAVKFKPEKSVKLLGFTDSSNIMRHYYLKDVNIFIAEPGNKNAILALSALARAMKEMNK 541 +E +KFK +K +KLLGFT++SNI+RHYY+KDVNI + +P + ++LA+SA+AR MKE NK Sbjct: 304 IETLKFKTDKGMKLLGFTEASNILRHYYMKDVNIVVPDPSKEKSVLAVSAIAREMKETNK 363 Query: 542 VAIVRCVWRQGQGNV 586 VAIVRCVWR GQGNV Sbjct: 364 VAIVRCVWRNGQGNV 378 Score = 66.2 bits (160), Expect(3) = 5e-88 Identities = 29/39 (74%), Positives = 34/39 (86%) Frame = +3 Query: 591 VGVLTPNVSDKDNTPDSFYFNILPFAEDVRGFPVSFFQQ 707 VGVLTPNVS++D+TPDSFYFN+LPFAEDVR FP F + Sbjct: 380 VGVLTPNVSERDDTPDSFYFNVLPFAEDVREFPFPSFNK 418 Score = 37.7 bits (86), Expect(3) = 5e-88 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = +1 Query: 682 DFQFPSFSNLPSSMQPNEKQQDAADKL 762 +F FPSF+ LPSS +P+E+QQ AD L Sbjct: 410 EFPFPSFNKLPSSWKPDEQQQAVADNL 436 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,967,208 Number of Sequences: 27288 Number of extensions: 384188 Number of successful extensions: 1075 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1037 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1075 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1383666960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264423|gb|BM412793.1|BM412793 EST587120 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61M9 5' end, mRNA sequence (736 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g07950.1 expressed protein / ;supported by full-length cD... 339 1e-93 >At3g07950.1 expressed protein / ;supported by full-length cDNA: Ceres:13017. Length = 304 Score = 339 bits (869), Expect = 1e-93 Identities = 158/234 (67%), Positives = 195/234 (82%) Frame = +3 Query: 6 TVYGAIISTIGLLFLGKLLEPIWGSREFLKFIFIVNFLTSVFVFITAISLYYVTRLEIYL 185 +VYG + ST+ LLF+GK LEP+WGS EFLKFIF+VNFLT + VF+TAI+LYY+TRLE+YL Sbjct: 63 SVYGVVFSTVSLLFMGKFLEPVWGSTEFLKFIFVVNFLTYLCVFVTAIALYYITRLEVYL 122 Query: 186 YMPISGFQGVLSGFLVGVKQIMPDQELSILKLKAKWLPSLALLFSIAISFFTADSVSYLP 365 YMP +GF GVL+G LVG+KQI+PDQE+ +LK+KAKWLPS+ L+ SIA SFFT DS +YLP Sbjct: 123 YMPFAGFHGVLAGLLVGIKQIIPDQEILLLKIKAKWLPSIMLILSIASSFFTLDSAAYLP 182 Query: 366 TIVFGTYLGWIYLRYWQKKPETKLKGDPSDEFSFSSFFPEFLRPVIDPIATIFERMLCGR 545 T++FGTY+GW+YLRY Q++PETKL+GDPSD+F+FS+FFPE LRPVIDPIA IF RMLCGR Sbjct: 183 TLIFGTYMGWLYLRYLQRRPETKLRGDPSDDFAFSTFFPELLRPVIDPIALIFHRMLCGR 242 Query: 546 RSETSNEERGYTLGGSTLPGSDPIEASRRRERSARALEERLAAELLASGKKGEE 707 + TS E+ Y+ G+ LPGSD EASRRRER ARALEERL E L + +E Sbjct: 243 SNATS-EDHDYSTSGAPLPGSDSAEASRRRERGARALEERLGTERLVPARNKDE 295 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,165,196 Number of Sequences: 27288 Number of extensions: 391580 Number of successful extensions: 1334 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1332 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264401|gb|BM412771.1|BM412771 EST587098 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61G19 5' end, mRNA sequence (593 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04780.1 hypothetical protein / 181 2e-46 >At4g04780.1 hypothetical protein / Length = 381 Score = 181 bits (460), Expect = 2e-46 Identities = 95/121 (78%), Positives = 101/121 (82%), Gaps = 1/121 (0%) Frame = +2 Query: 2 NTFGTLQRDAPPVRLSPNYPEPPPANP-TEDSANVAEQPKQMSAAFVKAAKQQFDVLVAA 178 N FGTLQRDAPPV+LSPNYPEPP T+D+ EQPKQ+SA VKAAK QFD LVAA Sbjct: 262 NAFGTLQRDAPPVQLSPNYPEPPATTTVTDDATPFPEQPKQLSAGLVKAAK-QFDALVAA 320 Query: 179 LPLSDGSEEAQLKRIAELQAENDAVGQELQKQLEAAEKELKQVQELFNQATDNCLNLKKP 358 LPLS+G E AQLKRIAELQ END VGQELQKQLEAAEKELKQVQELF QA DNCLN+KKP Sbjct: 321 LPLSEGGEGAQLKRIAELQVENDLVGQELQKQLEAAEKELKQVQELFGQAADNCLNMKKP 380 Query: 359 E 361 E Sbjct: 381 E 381 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,582,441 Number of Sequences: 27288 Number of extensions: 305000 Number of successful extensions: 1361 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1346 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 922006972 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264365|gb|BM412735.1|BM412735 EST587062 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG61A11 5' end, mRNA sequence (627 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g28120.1 expressed protein / ;supported by full-length cDN... 262 9e-71 >At1g28120.1 expressed protein / ;supported by full-length cDNA: Ceres:106626. Length = 306 Score = 262 bits (670), Expect = 9e-71 Identities = 125/195 (64%), Positives = 158/195 (80%) Frame = +3 Query: 42 LKLMTGKKYKDDDIMQQHSAIQAEQAVKVPFLGDKEPLSSLEAEYHLGNSIVLEKIKVLS 221 + + G+++ + ++ + Q E+A KVP++GDKEPLSSL AEY G+ I+LEKIK+L Sbjct: 18 ISAIKGEEWGNCSSVEDQPSFQEEEAAKVPYVGDKEPLSSLAAEYQSGSPILLEKIKILD 77 Query: 222 EQYAAIRRTRGDGNCFFRSFMFGYLEHILESQDHNEVQHIKSNIEECKKTLQSLGYAEFT 401 QY IRRTRGDGNCFFRSFMF YLEHILESQD EV IK N+E+C+KTLQ+LGY +FT Sbjct: 78 SQYIGIRRTRGDGNCFFRSFMFSYLEHILESQDRAEVDRIKVNVEKCRKTLQNLGYTDFT 137 Query: 402 FEDFFALFLEQLDSVLSGSEDSISHDELLCRSRDPSISDYGVMFFRFVTSGEIRKRSEFF 581 FEDFFALFLEQLD +L G+E+SIS+DEL+ RSRD S+SDY VMFFRFVT+G+IR R++FF Sbjct: 138 FEDFFALFLEQLDDILQGTEESISYDELVNRSRDQSVSDYIVMFFRFVTAGDIRTRADFF 197 Query: 582 EPFILRLNNTSVEQF 626 EPFI L+N +V+QF Sbjct: 198 EPFITGLSNATVDQF 212 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,430,847 Number of Sequences: 27288 Number of extensions: 282497 Number of successful extensions: 864 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1008438668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264348|gb|BM412729.1|BM412729 EST587045 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG60N20 5' end, mRNA sequence (751 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39690.1 putative protein / ; supported by cDNA: gi_13605... 309 9e-85 At1g67230.1 nuclear matrix constituent protein 1, putative / ... 48 5e-06 >At4g39690.1 putative protein / ; supported by cDNA: gi_13605658_gb_AF361810.1_AF361810 Length = 650 Score = 309 bits (792), Expect(2) = 9e-85 Identities = 156/238 (65%), Positives = 196/238 (81%) Frame = +2 Query: 2 YISKDGKLVLDVLQVIHETESRQAELDARLFAEEKKYMKERYEKELKDARARELMYAERE 181 Y+++DGKLVLD L IH E +QA LDA++FAEE + +KE+YE EL+D RARELM E Sbjct: 318 YMTEDGKLVLDFLAAIHAAEKQQAHLDAQVFAEELRALKEKYENELRDLRARELMRIEEA 377 Query: 182 ALLDKELKKERAKAIAALKSLKEKLEEEHKTELEEKEDEAELKLKKAQELGKAQLDAAIA 361 A+LDKELK+ER KA AA+K+++E++E++ K ELE+KE EA+L L KA+EL KA++ + IA Sbjct: 378 AILDKELKRERTKAAAAIKAIQERMEDKLKAELEQKETEAQLALSKAEELAKAEMISTIA 437 Query: 362 SEKASQIEKMAEANLHINALCMAFYARSEEVRQTHSVHKLALGVLALEDALSRGLPIQKE 541 EKA+QIEKMAEA+L+I AL MAFYARSEE RQ+HSVHKLALG LAL+D LS+GLP+QKE Sbjct: 438 KEKAAQIEKMAEADLNIKALSMAFYARSEEARQSHSVHKLALGALALDDTLSKGLPVQKE 497 Query: 542 LENLHTSLEGIDNNSLLDVVLSSLPEETQRYGSDTVLQLNHKFDTLKGTLRHFSLIPP 715 ++ L T LEG +S+L +VLSSLPEE + G+DTVLQLN KFDTLKGTLRHFSLIPP Sbjct: 498 IDTLQTYLEGTHKDSILGLVLSSLPEEARSNGTDTVLQLNQKFDTLKGTLRHFSLIPP 555 Score = 22.3 bits (46), Expect(2) = 9e-85 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 721 GGGILTHSLA 750 GGGIL HSLA Sbjct: 557 GGGILAHSLA 566 >At1g67230.1 nuclear matrix constituent protein 1, putative / similar to nuclear matrix constituent protein 1 GI:2190186 from [Daucus carota] Length = 1132 Score = 48.1 bits (113), Expect = 5e-06 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 4/102 (3%) Frame = +2 Query: 53 ETESRQAELDARLFAEEKKYMKERYEKELKDARARELMYAE----REALLDKELKKERAK 220 E R L+ +EK+ E E+EL+ + +AE ++L K+ + ER++ Sbjct: 547 EKLERHIHLEEERLKKEKQAANENMERELETLEVAKASFAETMEYERSMLSKKAESERSQ 606 Query: 221 AIAALKSLKEKLEEEHKTELEEKEDEAELKLKKAQELGKAQL 346 + ++ K KLE + +T LEEKE E + K K +E + +L Sbjct: 607 LLHDIEMRKRKLESDMQTILEEKERELQAKKKLFEEEREKEL 648 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,171,691 Number of Sequences: 27288 Number of extensions: 391210 Number of successful extensions: 3075 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 2175 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2639 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264301|gb|BM412671.1|BM412671 EST586998 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG60F2 5' end, mRNA sequence (637 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g17690.1 expressed protein / ; supported by cDNA: gi_15810... 298 1e-81 >At1g17690.1 expressed protein / ; supported by cDNA: gi_15810522_gb_AY056300.1_ Length = 754 Score = 298 bits (764), Expect = 1e-81 Identities = 141/213 (66%), Positives = 176/213 (82%), Gaps = 4/213 (1%) Frame = +3 Query: 9 YLDGQAPFYRQSIILSSHINPDINGLFNHHCLNHEGKVKLASEYKGVLPKVVLQIRQIYE 188 YLDG A FYRQSIILSS++ P++N LF HCLN++GK+K+A EYKGVL KV+L +RQIYE Sbjct: 527 YLDGHARFYRQSIILSSYLTPEMNSLFGRHCLNYKGKMKMACEYKGVLEKVLLPVRQIYE 586 Query: 189 RFDANTAEDADDARFDYFTKKVFPKIKDSTQGGIMLFISSYFEFIRVRNFLKSQEASFCL 368 RFDA + DDAR +YFTKK+FPKIKDS QGG+M+FI SYFEF+R+RNFL +Q SFCL Sbjct: 587 RFDAASITQVDDARLEYFTKKIFPKIKDSVQGGVMIFIHSYFEFVRLRNFLNTQNTSFCL 646 Query: 369 LGEYTEQSDISRARGWFFDGKKKIMLYTERAHFYHRYKIRGIQNLIIYSLPERKEFYPEV 548 LG+Y + +DISRAR FF G +KIMLYTERA+FY RYKIRGI+NLI+YSLPERKEFYPE+ Sbjct: 647 LGDYAKNADISRAREQFFVGSRKIMLYTERAYFYKRYKIRGIKNLILYSLPERKEFYPEI 706 Query: 549 VNLLQGSA----CTVLFSRYDQLRLDRIVGTAA 635 +N+L+ + T LFSR+D L+L+RIVG+ + Sbjct: 707 MNMLEEGSHDMMSTALFSRFDMLQLERIVGSTS 739 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,706,963 Number of Sequences: 27288 Number of extensions: 288183 Number of successful extensions: 754 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 753 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264265|gb|BM412635.1|BM412635 EST586962 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG60N15 5' end, mRNA sequence (785 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g42990.1 bZIP family transcription factor / contains Pfam ... 151 3e-37 At2g40950.1 bZIP family transcription factor / similar to Atb... 50 1e-06 At3g17610.1 bZIP family transcription factor / similar to TGA... 47 9e-06 >At1g42990.1 bZIP family transcription factor / contains Pfam profile: PF00170: bZIP transcription factor; supported by cDNA: gi_15028322_gb_AY045964.1_ Length = 295 Score = 151 bits (382), Expect = 3e-37 Identities = 103/247 (41%), Positives = 137/247 (54%), Gaps = 16/247 (6%) Frame = +2 Query: 11 EQLLMNDDDFGLVS----DPQFAAESLSDFLVDSPLHSDHSHSPAEQAIGFSDPKVSSAD 178 E LMND++ S D Q ++ ++D LVD P S A + D ++ D Sbjct: 47 ENQLMNDENHQEESFVELDQQSVSDFIADLLVDYPTSDSGSVDLAADKVLTVDSPAAADD 106 Query: 179 QDKH--------KVSQSPS---DGDDELNNHDPVDKKRKRQLRNRDAAVRSRERKKLYVR 325 K K + S S D DDE + D V KKR+R++RNRDAAVRSRERKK YV+ Sbjct: 107 SGKENSDLVVEKKSNDSGSEIHDDDDEEGDDDAVAKKRRRRVRNRDAAVRSRERKKEYVQ 166 Query: 326 DLELKSRYFESECKRLGFVLQCCLAENQALRFSLHNSSANGVS-MTKQESAVLFLESLLL 502 DLE KS+Y E EC RLG +L+C +AENQ+LR+ L + N + M+KQESAVL LESLLL Sbjct: 167 DLEKKSKYLERECLRLGRMLECFVAENQSLRYCLQKGNGNNTTMMSKQESAVLLLESLLL 226 Query: 503 GSLLWFLGITCLLILPSQTWSVPEESQGSRNHGLLVPIKEGKKTSRILLFLSFMMSKRCK 682 GSLLW LG+ + + P + + + +L + K S +S+RCK Sbjct: 227 GSLLWLLGVNFICLFPYMSHTKCCLLRPEPEKLVLNGLGSSSKPSYT------GVSRRCK 280 Query: 683 ASRSRMK 703 SR RMK Sbjct: 281 GSRPRMK 287 >At2g40950.1 bZIP family transcription factor / similar to AtbZIP transcription factor GI:17065880 from [Arabidopsis thaliana]; contains Pfam profile: bZIP transcription factor PF00170 Length = 721 Score = 50.1 bits (118), Expect = 1e-06 Identities = 31/79 (39%), Positives = 41/79 (51%) Frame = +2 Query: 191 KVSQSPSDGDDELNNHDPVDKKRKRQLRNRDAAVRSRERKKLYVRDLELKSRYFESECKR 370 K +S D D + +KKR R +RNR++A SR+RKK YV +LE K R S Sbjct: 210 KYRRSGEDADASAVTGEEDEKKRARLMRNRESAQLSRQRKKHYVEELEEKVRNMHSTITD 269 Query: 371 LGFVLQCCLAENQALRFSL 427 L + +AEN LR L Sbjct: 270 LNGKISYFMAENATLRQQL 288 >At3g17610.1 bZIP family transcription factor / similar to TGACG-motif binding factor GI:2934884 from [Glycine max]; contains Pfam profile: PF00170 bZIP transcription factor; supported by full-length cDNA: Ceres: 35429. Length = 135 Score = 47.4 bits (111), Expect = 9e-06 Identities = 38/116 (32%), Positives = 54/116 (45%), Gaps = 26/116 (22%) Frame = +2 Query: 167 SSADQDKHKVSQSP-----SDGDDELNN------------------HDPVDKKR---KRQ 268 SS+ KHK + S DD +NN +PVDK+ KR Sbjct: 12 SSSSHKKHKTAAGSTCVLSSSADDGVNNPELDQTQNGVSTAKRRRGRNPVDKEYRSLKRL 71 Query: 269 LRNRDAAVRSRERKKLYVRDLELKSRYFESECKRLGFVLQCCLAENQALRFSLHNS 436 LRNR +A ++RERKK+YV DLE ++ ++ +L + EN LR L N+ Sbjct: 72 LRNRVSAQQARERKKVYVSDLESRANELQNNNDQLEEKISTLTNENTMLRKMLINT 127 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,382,418 Number of Sequences: 27288 Number of extensions: 426396 Number of successful extensions: 2028 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 1827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2009 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264249|gb|BM412619.1|BM412619 EST586946 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG60J23 5' end, mRNA sequence (658 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18410.1 putative protein / p53 inducible protein PIR121, ... 337 4e-93 >At5g18410.1 putative protein / p53 inducible protein PIR121, Homo sapiens, EMBL:AF160973 Length = 1235 Score = 337 bits (863), Expect = 4e-93 Identities = 165/218 (75%), Positives = 191/218 (86%) Frame = +1 Query: 1 LGLIPGADGQILHSQEGGDSPMVTLFKSATTATMSNPNCTNPTSFHTISRQAEAADLLYK 180 LGLIPGA+GQI+++Q+G +SP+V L KSAT+A +S+P C NP +F+T+S+QAEAADLLYK Sbjct: 989 LGLIPGAEGQIVNAQDG-ESPLVNLLKSATSAVVSSPGCLNPAAFYTMSKQAEAADLLYK 1047 Query: 181 ANINTGSVLEYALAFTSAALDKYCSKWSAAPKTGFIDITTSKDFYRIFSGLQIEYLEESI 360 AN+N GSVLEY LAFTSA+LDKYCSKWSA PKTGF+DITTSKDFYRI+ GLQI YLEE Sbjct: 1048 ANMNGGSVLEYTLAFTSASLDKYCSKWSAPPKTGFVDITTSKDFYRIYGGLQIGYLEEIT 1107 Query: 361 QLQSNTYEMLGDSVAWGGCTIIYLLGQQLHFELFDFSHQVLNVAEVESVAISPTQKNPNF 540 QS +E+LGDS+AWGGCTIIYLLGQQLHFELFDFS+QVLNV+EVE+V+ S T +NP Sbjct: 1108 APQSAQHEVLGDSIAWGGCTIIYLLGQQLHFELFDFSYQVLNVSEVETVSASHTHRNPQI 1167 Query: 541 LQGIEGLLEAMKKARRLNNHVFSMLKARCPLEDKQACA 654 QG EGLLE MKKARRLNNHVFSMLKARCPLEDK ACA Sbjct: 1168 HQGWEGLLEGMKKARRLNNHVFSMLKARCPLEDKTACA 1205 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,214,677 Number of Sequences: 27288 Number of extensions: 337084 Number of successful extensions: 825 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 823 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1097681028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264154|gb|BM412524.1|BM412524 EST586851 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG60G20 5' end, mRNA sequence (763 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g15140.1 expressed protein / Contains a PF|00175 Oxidoredu... 317 6e-87 >At1g15140.1 expressed protein / Contains a PF|00175 Oxidoreductase FAD/NADH-binding domain. ESTs gb|H76345 and gb|AA651465 come from this gene; supported by cDNA: gi_15451091_gb_AY054626.1_ Length = 295 Score = 317 bits (812), Expect(2) = 6e-87 Identities = 158/226 (69%), Positives = 188/226 (82%), Gaps = 7/226 (3%) Frame = +1 Query: 70 HPSSSMTLLK--PLHHHLR-----RRLSISAAAAVRQDTNLWTTAPLVTVSPAAESLFHV 228 H S M +L+ PL HLR R S+ +AAAVRQD +LWT APL + AAESLFH+ Sbjct: 17 HSLSPMFILRHLPLTRHLRLSRNNRVASVVSAAAVRQDASLWTPAPLSLIESAAESLFHI 76 Query: 229 TIDVSDYPDLANSHTKAGQYLQLRIPDVEKPSFLAIASPPSLAAAKGVFEFLVKSISGST 408 +ID+S+ PDL S+T+ GQYLQ+R+PDVEKPSF+AIASPPSLA+++G FEFLVKSI+GST Sbjct: 77 SIDISNAPDLVASYTRPGQYLQIRVPDVEKPSFMAIASPPSLASSRGAFEFLVKSIAGST 136 Query: 409 AELLCGLQKGDVVELSQVMGKGFDLDQISPAEEYQTVVIFATGSGISPIRSLIEAGFGAD 588 AE+LCGL+KG+ VELS VMG GF++D I P EEY TV+IFATGSGISPIRSLIE+GFGAD Sbjct: 137 AEILCGLKKGETVELSSVMGNGFNIDLIDPPEEYPTVLIFATGSGISPIRSLIESGFGAD 196 Query: 589 RRSDVRVYYGARNLKRMAYQDKFENWASSGVKVVPVLSQPDDAWKG 726 RRSDVR+YYGARNL RMAYQ+KF+ W S+GVKVVPVLSQPDD WKG Sbjct: 197 RRSDVRLYYGARNLNRMAYQEKFKEWESAGVKVVPVLSQPDDGWKG 242 Score = 21.9 bits (45), Expect(2) = 6e-87 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +3 Query: 735 GYVQAAFAR 761 GYVQAAFAR Sbjct: 245 GYVQAAFAR 253 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,469,488 Number of Sequences: 27288 Number of extensions: 514998 Number of successful extensions: 3633 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3289 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1383666960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18264015|gb|BM412385.1|BM412385 EST586712 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG59L20 5' end, mRNA sequence (721 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g17930.1 expressed protein / ;supported by full-length cDN... 187 5e-48 >At3g17930.1 expressed protein / ;supported by full-length cDNA: Ceres:20484. Length = 190 Score = 187 bits (475), Expect = 5e-48 Identities = 95/141 (67%), Positives = 117/141 (82%), Gaps = 1/141 (0%) Frame = +3 Query: 144 VSHNMSMKKVPRMITRASSEPSGSSDGALGQNKT-PFGYTRKDVILIGVGVTLLGVGLKS 320 +S ++ + RM R SS + + D + + KT PFGYTRKDVILIGVGVT LG+GL+S Sbjct: 49 LSSSVEKGEKQRMRCRVSSNSTETEDDSATKTKTTPFGYTRKDVILIGVGVTALGIGLES 108 Query: 321 GLEFLGFDPLQAGNVVQLVLVLGLTVGWISTYIFRVSNKEMTYAQQLRDYESKVMEKRLE 500 GLE++G DPLQAGN VQL+LVLGLT+GWISTYIFRV NKEMTYAQQLRDYES+VM+KRLE Sbjct: 109 GLEYVGVDPLQAGNAVQLILVLGLTLGWISTYIFRVGNKEMTYAQQLRDYESQVMQKRLE 168 Query: 501 SLTEAELQVLLEQVEEEKTRL 563 SL+EAEL+ L+ QV+EEKT++ Sbjct: 169 SLSEAELEALMAQVDEEKTKV 189 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,254,793 Number of Sequences: 27288 Number of extensions: 376584 Number of successful extensions: 1349 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1269 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1344 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1272263564 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263890|gb|BM412260.1|BM412260 EST586587 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG59B7 5' end, mRNA sequence (724 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g18340.1 expressed protein / similar to hypothetical prote... 308 2e-84 >At1g18340.1 expressed protein / similar to hypothetical protein GB:AAF25986 GI:6714290 from [Arabidopsis thaliana];supported by full-length cDNA: Ceres:126051. Length = 301 Score = 308 bits (788), Expect = 2e-84 Identities = 163/240 (67%), Positives = 193/240 (79%), Gaps = 13/240 (5%) Frame = +1 Query: 43 MTPVSSKLYADDVSLLMVLVDTNPYFWSSMKNTAFTFPKFISHVLAFLNSILLLNQMNQV 222 M ++SK Y+DDVSLL++L+DTNP FWS+ T+ TF +F+SHVLAFLN++L LNQ+NQV Sbjct: 1 MPAIASKQYSDDVSLLVLLLDTNPLFWST---TSITFSQFLSHVLAFLNAVLGLNQLNQV 57 Query: 223 VVIATGYNSCDYVFDSS-TSSMQRAEC-----------LLEKLEDFVDKDESLSQED-SV 363 VVIATGY+SCDY++DSS TS+ E LL+KLE+FV KDE LS+E+ S Sbjct: 58 VVIATGYSSCDYIYDSSLTSNHGNFESNGTGMPAIFGSLLKKLEEFVTKDEELSKEEVSE 117 Query: 364 DGVGFSLLSGALSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAVMNSIFSAQRS 543 D + LLSG+LSMALCYIQRVFRSG LHPQPRILCL GSPDGP QYVAVMNSIFSAQR Sbjct: 118 DRIPSCLLSGSLSMALCYIQRVFRSGHLHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRL 177 Query: 544 MVPIDSCVIGSQHSAFLQQASYITGGVYLKPQVSDGLFQYLSTVFATDLHSRSFLALPRP 723 MVPIDSC IG Q+SAFLQQASYITGGV+ P+ DGLFQYL+T+FATDLHSR F+ LP+P Sbjct: 178 MVPIDSCYIGVQNSAFLQQASYITGGVHHTPKQLDGLFQYLTTIFATDLHSRGFVQLPKP 237 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,517,797 Number of Sequences: 27288 Number of extensions: 370509 Number of successful extensions: 1185 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1179 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1268361380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263881|gb|BM412251.1|BM412251 EST586578 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG59O8 5' end, mRNA sequence (750 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39370.1 ubiquitin-specific protease 27 (UBP27), putative /... 114 6e-26 >At4g39370.1 ubiquitin-specific protease 27 (UBP27), putative / similar to GI:11993494; ubiquitin specific protease 66 - Gallus gallus,PID:g3800764; supported by cDNA: gi_11993493_gb_AF302675.1_AF302675 Length = 494 Score = 114 bits (285), Expect = 6e-26 Identities = 58/121 (47%), Positives = 80/121 (65%) Frame = +2 Query: 2 WHTAAEKYVSAMDENEAIVEKLKLCNEEDSCDCKQLACLAKFPWSNSFSRTFKQLSIGRS 181 WH AA KY+S + E +EKL+ C ED CDCK L + PWSNS+S KQL I R Sbjct: 298 WHGAALKYLSVIGAAETEIEKLRSCGGEDQCDCKTSLHLQRMPWSNSYSHILKQLIIARF 357 Query: 182 PKVLCLHLQRASINVFGEQNKLQGHISFPLILDLAPFVKSGVGTKSWEENLQIGQITHQQ 361 PK+LC+ +QRAS N+F E+ KL GHI+FPL+L+L+ F S +G + EE +++ +Q+ Sbjct: 358 PKLLCIQVQRASFNMF-EEFKLSGHIAFPLVLNLSLFTPSSIGV-NIEERIEMSS-EYQK 414 Query: 362 P 364 P Sbjct: 415 P 415 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,424,698 Number of Sequences: 27288 Number of extensions: 356809 Number of successful extensions: 1053 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1012 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1051 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263470|gb|BM411840.1|BM411840 EST586167 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG58G19 5' end, mRNA sequence (807 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54540.1 putative protein / similar to unknown protein (pi... 120 7e-28 >At5g54540.1 putative protein / similar to unknown protein (pir||T05538); supported by cDNA: gi_16648815_gb_AY058185.1_ Length = 297 Score = 120 bits (302), Expect = 7e-28 Identities = 90/252 (35%), Positives = 132/252 (51%), Gaps = 4/252 (1%) Frame = +1 Query: 40 MGGGGAFRAAAKVAGAAAVNSGFRSVTAEHPLYAAARNVARPVSISGLSSTSEDVKSGMV 219 MGGG A AAKVAG GF+ + A R V + +++S+ V + + Sbjct: 1 MGGGRAMATAAKVAGIGVGKGGFKGFG-----FPPATEQFR-VKTAAAAASSKPVSASIT 54 Query: 220 TASHGGSLDVSHVPKMVSDFDDWEMAGGEEEMMVNPGEPLPRLVFGGAPSLQEATEATSD 399 +A H S++ + +DDWE A EE EP+PR+VF PSL+EA EAT D Sbjct: 55 SAVHP-SVEEDGMIMQRPVWDDWEFA---EE------EPIPRVVFSKPPSLEEAKEATED 104 Query: 400 LKDA--LVYLSG--SANGNGGSCISGSSSSPVSKACVVSETIVTKSVPKHAVQAYRVLSE 567 LK+A LVY+S S+ GS GS S +S V +VP+ A+QA+ LSE Sbjct: 105 LKEAINLVYMSSPKSSAAMEGSNDGGSVSKMLSGFQSSENRAVESAVPQVALQAFAFLSE 164 Query: 568 IPAAQNVVASIACDPNVWNAVLQNPALQDFLESQRSSEKCASFPDSDQERDESVANTDYF 747 AAQ VVASIA DP VW+AV++N L FL++ +++ D+D + + S Sbjct: 165 NTAAQTVVASIASDPKVWDAVMENKDLMKFLQTNKTAVSSQVESDNDDQSERSSTTECEV 224 Query: 748 SESSPLKAVPLI 783 E+ P++ + ++ Sbjct: 225 VETKPMELLEIL 236 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,812,658 Number of Sequences: 27288 Number of extensions: 486093 Number of successful extensions: 1844 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1833 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1503203240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263413|gb|BM411783.1|BM411783 EST586110 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57N6 5' end, mRNA sequence (786 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03210.1 unknown protein / 147 2e-52 >At3g03210.1 unknown protein / Length = 368 Score = 147 bits (372), Expect(2) = 2e-52 Identities = 82/150 (54%), Positives = 102/150 (67%), Gaps = 15/150 (10%) Frame = +1 Query: 190 MLGAVQLGLFAAGVVLFVPMGMAGWHLSRNKMLFFSCALFITLAVGVHLVPYFPSVTSFL 369 MLGA+ LG+ AA VLFVPM MAGWHLSRNKMLFFS ALFI+LAV VHL PYFPSV+ + Sbjct: 1 MLGAIHLGVLAACFVLFVPMAMAGWHLSRNKMLFFSGALFISLAVCVHLTPYFPSVSDIV 60 Query: 370 SSGSDSLSSVIV--NRDSCFSLLHQVAFDFQELSN----NSKRGS---------WKWVES 504 + S+SSV+V +R SC + ++Q+ +D + + N GS W W++S Sbjct: 61 A----SVSSVVVYDHRISCINEVNQIVWDVKPVPNPESVRRNNGSTKLDYFVKNWDWMKS 116 Query: 505 ENVVDCDFQKLTMNDASDLLNGSWVVVAGD 594 V+ C+FQKL D SDLLNGSWVVVAGD Sbjct: 117 RKVLSCEFQKLDKFDVSDLLNGSWVVVAGD 146 Score = 76.3 bits (186), Expect(2) = 2e-52 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 2/66 (3%) Frame = +3 Query: 594 SQARLMVVSLLELLLG-DSK-MELIKKDLFLRHSDYNIFGDEIGMKLDFIWAPYMSNLTD 767 SQAR + +SLL L+LG DSK M+ ++ DLF RHSDY+I EIGMKLDF+WAPY +L D Sbjct: 147 SQARFVALSLLNLVLGSDSKAMDSVRGDLFRRHSDYSIVVKEIGMKLDFVWAPYEKDLDD 206 Query: 768 LIMRFK 785 L++ +K Sbjct: 207 LVVSYK 212 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,885,379 Number of Sequences: 27288 Number of extensions: 408054 Number of successful extensions: 1386 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1383 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263404|gb|BM411774.1|BM411774 EST586101 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57L6 5' end, mRNA sequence (767 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g19990.1 hypothetical protein / predicted by genemark.hmm 397 e-111 >At3g19990.1 hypothetical protein / predicted by genemark.hmm Length = 425 Score = 397 bits (1020), Expect = e-111 Identities = 191/257 (74%), Positives = 223/257 (86%), Gaps = 2/257 (0%) Frame = +2 Query: 2 GAGECWHKHGSFLDHLIDIYKILKIWEAPNSVCLCGLFHSAYSNSYVNLAIFDPSTGRET 181 GAGECWHKHGSFLDHLIDIYKILK+W+AP SVCLCGLFHSAYSNSYVNLAIFDPSTGR+ Sbjct: 43 GAGECWHKHGSFLDHLIDIYKILKLWKAPESVCLCGLFHSAYSNSYVNLAIFDPSTGRDV 102 Query: 182 VRRHVGEAAERLIHLFCIVPRQSLIHDDLLFRYADSELVEHLELSMASLSNAKEKGLFNE 361 VR HVGEAAE LIHLFC+VPRQ+LIHD+LLF+Y+D ELVEHL+ S SL NAKEKG+F+ Sbjct: 103 VRDHVGEAAESLIHLFCVVPRQTLIHDELLFKYSDCELVEHLDCSEVSLRNAKEKGIFDG 162 Query: 362 NEAWRKKLGSILPVDGVIVKHIKTGEDVLVSRRLVAVFLLMTMADFSDQLFNFQDLLFEN 541 +E WRKK+ +++P +GV+VKHIKTGE+++VSRR+V VFLLMTMADFSDQLF FQD LF N Sbjct: 163 DEEWRKKINALVPENGVVVKHIKTGEEIVVSRRVVGVFLLMTMADFSDQLFGFQDELFCN 222 Query: 542 SNGRLEFTGNNSQTTLWPGDGKPGLWMNSASRMGAIYTLILREEEIIIEQRRR--NGERV 715 +GRLEF GNN T LWPG+GKPGLWMNS SRMGAIY+LI+REEEI++E+RRR Sbjct: 223 HDGRLEFRGNN-VTALWPGNGKPGLWMNSNSRMGAIYSLIVREEEILMEERRRAFGSGFE 281 Query: 716 VVSGRDEEIELVIPPAF 766 V RDE+I+LV+PP F Sbjct: 282 VRKERDEDIDLVVPPVF 298 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,126,464 Number of Sequences: 27288 Number of extensions: 383158 Number of successful extensions: 1140 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1097 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1138 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1401406280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263341|gb|BM411711.1|BM411711 EST586038 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57N9 5' end, mRNA sequence (700 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66510.1 expressed protein / ; supported by cDNA: gi_15529... 306 5e-84 >At1g66510.1 expressed protein / ; supported by cDNA: gi_15529199_gb_AY052224.1_ Length = 399 Score = 306 bits (785), Expect = 5e-84 Identities = 146/233 (62%), Positives = 187/233 (79%), Gaps = 1/233 (0%) Frame = +2 Query: 5 GPNFKGVKMIPPGVHFIYYSSSNREGNEFSPIVGFFVEASPSEVIVKKWDSKDERFVKLS 184 GP FKG+KMIPPG+HF++YSSS R+G EFSP +GFFV+ +PS+VIV+KW+ +DE K+S Sbjct: 37 GPAFKGIKMIPPGIHFVFYSSSTRDGREFSPTIGFFVDVAPSQVIVRKWNQQDEWLTKVS 96 Query: 185 EEEGERYAQAVKKLEFDRQLGPYALDQYGDWKRLSNFITKSTIGRIEPVGGEITIISESE 364 EEE ERY+QAV+ LEFD+ LGPY L QYG+W+ LSN+ITK + + EPVGGEIT+ ES Sbjct: 97 EEEEERYSQAVRSLEFDKNLGPYNLKQYGEWRHLSNYITKDVVEKFEPVGGEITVTYESA 156 Query: 365 MVGNVHKTAMEKVLAEQLKSSKFSKPDKKSP-SNSCYYTSIPRVIKLKGVSGQDLTNMNL 541 ++ KTAME L Q+K SKF+ + P N YYTSIPR+IK KG+SGQ+LT+MNL Sbjct: 157 ILKGGPKTAMEIALDTQMKKSKFTTSSTEQPKGNRFYYTSIPRIIKHKGMSGQELTSMNL 216 Query: 542 DKTRILETILTKQYGGSEDSLLGELQFAFVAFLMGQSLEAFLTWKLLVSLLLG 700 DKT++LE++L+K+Y SED LLGELQF+FVAFLMGQSLE+F+ WK +VSLLLG Sbjct: 217 DKTQLLESVLSKEYKDSEDLLLGELQFSFVAFLMGQSLESFMQWKSIVSLLLG 269 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,246,115 Number of Sequences: 27288 Number of extensions: 328750 Number of successful extensions: 1082 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1037 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1080 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1209984928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263328|gb|BM411698.1|BM411698 EST586025 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57J19 5' end, mRNA sequence (816 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g30920.1 dihydroxypolyprenylbenzoate methyltransferase / i... 358 1e-99 >At2g30920.1 dihydroxypolyprenylbenzoate methyltransferase / identical to GB:Y15055;supported by full-length cDNA: Ceres:108529. Length = 322 Score = 358 bits (920), Expect = 1e-99 Identities = 175/245 (71%), Positives = 206/245 (83%) Frame = +1 Query: 82 IFSTSQNQVTWRSYSEASQPTPINPPPPPPPSPNTSTTTSSSLNEFELAKFSAIAETWWD 261 +FSTS + S+S S I + + ST++++SLNE ELAKFSAIA+TWW Sbjct: 36 LFSTSDTDASAASFS--SSHPKIQTLEGKASNKSRSTSSTTSLNEDELAKFSAIADTWWH 93 Query: 262 AEGPFKPLHLMNPTRLAFIRSTLCRHFRKDPNCTRPFEGLKFVDVGCGGGILSEPLARMG 441 +EGPFKPLH MNPTRLAFIRSTLCRHF KDP+ +PFEGLKF+D+GCGGG+LSEPLARMG Sbjct: 94 SEGPFKPLHQMNPTRLAFIRSTLCRHFSKDPSSAKPFEGLKFIDIGCGGGLLSEPLARMG 153 Query: 442 ATVTGVDAVDKNIKIARLHADLDPQTSSIEYRCTTAESLVEEQRQFDAVIALEVIEHVAD 621 ATVTGVDAVDKN+KIARLHAD+DP TS+IEY CTTAE L +E R+FDAV++LEVIEHVA+ Sbjct: 154 ATVTGVDAVDKNVKIARLHADMDPVTSTIEYLCTTAEKLADEGRKFDAVLSLEVIEHVAN 213 Query: 622 PAGFCKSLSALTIPGGATVISTINRSMRAYATAIVAAEYLLHWLPKGTHQWSSFLTPEEL 801 PA FCKSLSALTIP GATV+STINR+MRAYA+ IV AEY+L WLPKGTHQWSSF+TPEE+ Sbjct: 214 PAEFCKSLSALTIPNGATVLSTINRTMRAYASTIVGAEYILRWLPKGTHQWSSFVTPEEM 273 Query: 802 VLILQ 816 +ILQ Sbjct: 274 SMILQ 278 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,969,369 Number of Sequences: 27288 Number of extensions: 472218 Number of successful extensions: 8576 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2932 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6431 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1529730356 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263282|gb|BM411652.1|BM411652 EST585979 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57O24 5' end, mRNA sequence (676 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80940.1 expressed protein / ;supported by full-length cDN... 238 2e-63 >At1g80940.1 expressed protein / ;supported by full-length cDNA: Ceres:37300. Length = 213 Score = 238 bits (607), Expect = 2e-63 Identities = 123/192 (64%), Positives = 157/192 (81%), Gaps = 3/192 (1%) Frame = +1 Query: 22 EGFLEGFSPVSSTPVLWKSRKRSAGVKNLETPQKQEESPADETPQKQDESPAD-EKMQES 198 +GF+ GF PVS+T + WKSRKRSA + NL+ K E+ + TP+K + + D EK+ E Sbjct: 16 DGFVGGFFPVSTTKIAWKSRKRSA-LLNLD---KAPEAVTEVTPEKNEITAMDTEKVGEP 71 Query: 199 QPSTEL-SERRKALFEPLEPVTNANGRRPSA-ETLLPPPDFDAACYPKGWLAGKRRKLVN 372 +T L SE+RKALFEPLEP+TN NG+RP+A ++LLPPPDF+ A YPKGWL GK+RKLVN Sbjct: 72 MTTTPLLSEKRKALFEPLEPITNLNGKRPTAADSLLPPPDFETANYPKGWLIGKKRKLVN 131 Query: 373 VDVVESMRRIALQEMNRKDREIDGLNEQLEADAQCLEHLQIQLLEERSKRADVERQNAML 552 VDVVESMRRIA+QEMNRKDREIDGLNEQLE D++CLEHLQ+QLL+ERSKR ++ER+N ML Sbjct: 132 VDVVESMRRIAVQEMNRKDREIDGLNEQLEEDSRCLEHLQLQLLQERSKRTEIERENTML 191 Query: 553 QSQINVLMNMYQ 588 + Q+++L+NM Q Sbjct: 192 KEQVDMLVNMIQ 203 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,315,166 Number of Sequences: 27288 Number of extensions: 347916 Number of successful extensions: 1800 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1758 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1138809344 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263202|gb|BM411572.1|BM411572 EST585899 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57A2 5' end, mRNA sequence (721 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g32970.1 expressed protein / ; supported by cDNA: gi_1529... 263 6e-74 >At2g32970.1 expressed protein / ; supported by cDNA: gi_15293114_gb_AY050991.1_ Length = 577 Score = 263 bits (672), Expect(2) = 6e-74 Identities = 122/196 (62%), Positives = 150/196 (76%) Frame = +2 Query: 23 VVEASQYKDILLLFRFNHRDFPFKLRDIILSDLRLLRLLEAGLPSWVIFLQSYPVFCHIY 202 ++EA+QYKD+L+L R RD PFKLR++I++D+RLL LLEAGLPSWV+FLQSYP FCH+Y Sbjct: 214 IIEATQYKDVLVLVRCGDRDLPFKLREVIMADIRLLTLLEAGLPSWVLFLQSYPGFCHLY 273 Query: 203 RPWMCPLARFLYVIISVVTVLIGFYDLYKNVPVLKATASSLFGPLFDWIETWEMVSRIQY 382 RPWMC AR LYV+ISV+TV+IGFYDLYKNVPVLKATAS L GPLFDW+ETW+MVSRI+Y Sbjct: 274 RPWMCHFARALYVMISVITVVIGFYDLYKNVPVLKATASRLCGPLFDWVETWDMVSRIKY 333 Query: 383 LGTMLFLHNFQKAFRWFLMTMRTTRSFFSVLTQPMAGPLVEFVGFFLPYSTMCAQIMEDF 562 LGTMLFLHNFQKA +W L R +SF S P+ PL++ + LP A+ + Sbjct: 334 LGTMLFLHNFQKAVKWALTMARAMQSFVSFCIMPLVNPLLDILELLLPLWNSLAETVASL 393 Query: 563 FSVIWFTVWSSYTLVG 610 SV+W + S LVG Sbjct: 394 VSVVWIVMESGCNLVG 409 Score = 32.3 bits (72), Expect(2) = 6e-74 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +1 Query: 601 LGGKTIEILLLPLWYTTSFILNLGDYLLYPILWDLWESTY 720 L G +E++LLP+ S + N+ + +L P+ W +WE Y Sbjct: 407 LVGDVVELVLLPI----SLVWNVTNTVLLPLFWIIWEVVY 442 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,359,812 Number of Sequences: 27288 Number of extensions: 408862 Number of successful extensions: 1024 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 990 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1024 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1272263564 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263201|gb|BM411571.1|BM411571 EST585898 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57O23 5' end, mRNA sequence (761 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g37460.1 putative protein / SPINDLY protein, Petunia x hyb... 323 3e-95 >At4g37460.1 putative protein / SPINDLY protein, Petunia x hybrida, Y17720 Length = 1013 Score = 323 bits (828), Expect(2) = 3e-95 Identities = 147/219 (67%), Positives = 182/219 (82%), Gaps = 2/219 (0%) Frame = +2 Query: 2 STGRSMMSWNHLYSLAVKWRQISEPCDPVVWINKLSEEFNTGFGSHTPLVLGQAKVVRYH 181 S+GRS++SW +YS AV+WRQISEPCDPVVW+NKLSEEFN+GFGSHTP+VLGQAKVVRY Sbjct: 725 SSGRSILSWQDVYSPAVRWRQISEPCDPVVWVNKLSEEFNSGFGSHTPMVLGQAKVVRYF 784 Query: 182 PNFQRTLTVAKAVIKENKSVCNKEDKIIDLSEQQKLQ--EIMAAESSSDLYRVVGQDFWL 355 PN++RTLT+AK++IK+ SV +K+DK+IDLS+ +K++ +IM AE+ +L+ +VG+DFW+ Sbjct: 785 PNYERTLTLAKSIIKDKLSVRSKKDKVIDLSKDEKIEKMQIMRAETCDELHNIVGEDFWV 844 Query: 356 ATWCNSTALEGKRLEGTRITVVKMGEIGYDFAIRTPCTPARWDDFDVEMTSAWEALCAAY 535 ATWC+ST EG G +GYDF+IRTPCTPARW DFD EMTSAWEALC AY Sbjct: 845 ATWCDSTGSEG-------------GRLGYDFSIRTPCTPARWSDFDEEMTSAWEALCTAY 891 Query: 536 CGDNYGSTDFDVLENVRDAILRMTYYWYNFMPLSRGTGL 652 CG+NYGST+ D LE VRDAILRMTYYWYNFMPL+RGT + Sbjct: 892 CGENYGSTELDALETVRDAILRMTYYWYNFMPLARGTAV 930 Score = 43.5 bits (101), Expect(2) = 3e-95 Identities = 20/23 (86%), Positives = 22/23 (94%) Frame = +3 Query: 657 GFIVLLGLLLAANMEFTGSIPKG 725 GF+VLLGLLLAANMEFT +IPKG Sbjct: 932 GFVVLLGLLLAANMEFTETIPKG 954 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,545,635 Number of Sequences: 27288 Number of extensions: 427684 Number of successful extensions: 1373 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1287 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1369 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1383666960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263180|gb|BM411550.1|BM411550 EST585877 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57K9 5' end, mRNA sequence (802 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g65230.1 unknown protein / ; supported by cDNA: gi_20466567 311 3e-85 >At1g65230.1 unknown protein / ; supported by cDNA: gi_20466567 Length = 286 Score = 311 bits (796), Expect = 3e-85 Identities = 163/262 (62%), Positives = 194/262 (73%), Gaps = 3/262 (1%) Frame = +1 Query: 25 MTISSLLLPPPPPFINYNNNNNNIYG-KSISIHQPHRFSFRVINDSNRTELATE--DADK 195 MT SS LLP PP + + S IH HR +V+NDS RTE++ + + DK Sbjct: 1 MTTSSFLLPASPPSAAFLRRRFFRHSWLSSKIH--HRLP-QVMNDSTRTEVSIDKSEVDK 57 Query: 196 LVDGMDFGELCDEFECISSPSVEATARQLVRDILELREGNRALGTFAVSVKYKDPVRSFT 375 LVD +DFGELC++FEC SSP VE+TARQLVRDILE+REGNRA +AVSVKYKDPVRSFT Sbjct: 58 LVDKIDFGELCNDFECTSSPQVESTARQLVRDILEIREGNRAFACYAVSVKYKDPVRSFT 117 Query: 376 GRDKYKRPLWITDALQNPKPSVQEMVMLSTSVLNIKWTIKGKAKSLIGSIGGDLMIKVNS 555 GR+KYKRP+WIT L+NP +VQEMVMLSTSVL IKWT+KGK KS++ ++ GDL++KV S Sbjct: 118 GREKYKRPMWITSGLENPTVTVQEMVMLSTSVLRIKWTVKGKPKSILAAVSGDLIVKVKS 177 Query: 556 RFTLNQISGQVVEHEEEWDLSGSSIIAQAYFWASRRLFATVEAGKDVVDIVNDLSSKSAK 735 FTLNQISGQV EHEE WDLS SS IAQAYFW SRRLFA E+ KDV D+ DL++ Sbjct: 178 EFTLNQISGQVFEHEESWDLSSSSPIAQAYFWTSRRLFAASESAKDVADVTKDLTANLTT 237 Query: 736 ENKNMDGYPDPYGDPAKFFQRD 801 ++ D Y DP DP KFFQRD Sbjct: 238 RKEDTDIYRDP-TDPNKFFQRD 258 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.315 0.133 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,061,239 Number of Sequences: 27288 Number of extensions: 413457 Number of successful extensions: 1831 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1754 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1485518496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263137|gb|BM411507.1|BM411507 EST585834 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG57A19 5' end, mRNA sequence (821 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05320.1 unknown protein / 321 3e-88 >At3g05320.1 unknown protein / Length = 445 Score = 321 bits (823), Expect = 3e-88 Identities = 166/262 (63%), Positives = 197/262 (74%), Gaps = 4/262 (1%) Frame = +2 Query: 11 LAAKCLLLVVIALFLGTVLLPTFSGFGRVIRQNNFVFVHNR---SFPLNQPVKQKFLEVP 181 +A KCL+LV IALF +LL S R N+ +F S KFLEVP Sbjct: 17 VACKCLVLVGIALFYRALLL---SYSPRNALSNSLLFRDRHMSDSSSTGGIRTDKFLEVP 73 Query: 182 QIVWGLNNQKIAFARACLTARMLNRTLLMPKLSASLFYKEVELLKPISFDKIFQFERFNS 361 QIVWGLNNQKIAFARACLTARM+NRTLLMP LSASLFYKEV+ L+PI FDK+FQFERFNS Sbjct: 74 QIVWGLNNQKIAFARACLTARMMNRTLLMPSLSASLFYKEVDKLRPIPFDKVFQFERFNS 133 Query: 362 ICKGFVQLSRYSDVSNQSDIIELQKGSGRRWTLEKDLEQLNQISKH-PYDAREIIRIVGK 538 +C GFV+LSR+SDV N++ + +L+KGSGRRWT+E+DLE L Q +++ D E+IR++GK Sbjct: 134 LCSGFVRLSRFSDVKNRAQVFDLEKGSGRRWTVERDLEHLKQSARNESIDEFEVIRLIGK 193 Query: 539 NPFLWHDHWPTRDYAKVFECLALVEEISMEADKVVSQIREIRMEVRSKNAMPSSSSQPVP 718 NPFLWHDHWP DYAKVFEC+ +V+EIS EADKVV +IRE R+K A + PVP Sbjct: 194 NPFLWHDHWPVEDYAKVFECMVVVDEISREADKVVMKIREAGEAERAKLASKTEILGPVP 253 Query: 719 FVAVHMRIEKDWMIHCKKLEQR 784 FVAVHMRIE DWMIHCKKLEQR Sbjct: 254 FVAVHMRIEIDWMIHCKKLEQR 275 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,614,808 Number of Sequences: 27288 Number of extensions: 378847 Number of successful extensions: 1219 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1212 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1547415100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263091|gb|BM411461.1|BM411461 EST585788 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG56H18 5' end, mRNA sequence (791 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59780.1 putative protein / 222 2e-58 >At3g59780.1 putative protein / Length = 663 Score = 222 bits (566), Expect = 2e-58 Identities = 146/332 (43%), Positives = 176/332 (52%), Gaps = 86/332 (25%) Frame = +1 Query: 1 PDLRRAARFRFANVTLPEI----------------------------------DGSTRKL 78 PDLRR+ARFR+++VTLPE+ DG ++L Sbjct: 341 PDLRRSARFRYSSVTLPEVGFSILIVVDHSEYRNSTHVIYEHNEVSAISATEVDGDVKRL 400 Query: 79 FKSGRELDDYLLAAVIRNLKIVQDRSQVIVMDADGNRSKGVARSLRRLGIKRPYLVQGGF 258 K G E+DD L A +I+NLKIVQDRS+V+VMDADG RSKG G+ Sbjct: 401 LKGGSEVDDILTAVIIKNLKIVQDRSKVVVMDADGTRSKG------------------GY 442 Query: 259 RSWVEEGLRIKELKPETTLTILNEEAEAIFEEINPTPLQVVGYGVGLVAA---------- 408 RSWV+EGLR+KE KPETTLTILNEEAEAIFE+INP+PLQ+ G + + Sbjct: 443 RSWVQEGLRVKEPKPETTLTILNEEAEAIFEDINPSPLQLFGVEYLIFSTTHKLLTSTFC 502 Query: 409 ----AYALVEWEKTLQYVGVFGLC--QTL------------------------------- 477 A +L EWEKTLQ + V GL QTL Sbjct: 503 TNMIALSLAEWEKTLQLIAVIGLSLFQTLCRLYTYDFLHMMTPKTSNKTSGIKAPSLDPF 562 Query: 478 -----YRRISSYEDSEDLKQDVRQLLAPVILGGQAMTWAAGKLETNRNGLPTSPSSTDVQ 642 R + S R LLAPV LG QA +WAAGKLETN GLPTSPSS+DV+ Sbjct: 563 SIAKTQRNLCSVLTKIVSSSSSRLLLAPVKLGAQAFSWAAGKLETNGVGLPTSPSSSDVR 622 Query: 643 SRVLQAAAKHESQPDSEETQDPSPETMSSVSE 738 SRVLQAAAKHES+P S+ET + + SS E Sbjct: 623 SRVLQAAAKHESKP-SDETSESLQDASSSPEE 653 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,711,357 Number of Sequences: 27288 Number of extensions: 407229 Number of successful extensions: 1355 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1350 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1472363560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263039|gb|BM411409.1|BM411409 EST585736 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG56N13 5' end, mRNA sequence (804 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g31970.1 putative RAD50 DNA repair protein / ; supported ... 463 e-131 >At2g31970.1 putative RAD50 DNA repair protein / ; supported by cDNA: gi_7110147_gb_AF168748.1_AF168748 Length = 1316 Score = 463 bits (1192), Expect = e-131 Identities = 228/268 (85%), Positives = 252/268 (93%) Frame = +1 Query: 1 RKIKSEVDELTHEIELLEDKVLTLGGFSSVEAELKKLSHERERLLSELNKCHGTLSVYQS 180 R K++V+ELT EIE LE+++L +GG ++VEAE+ K+ ERERLLSELN+C GT+SVY+S Sbjct: 1039 RTTKAKVEELTREIESLEEQILNIGGIAAVEAEIVKILRERERLLSELNRCRGTVSVYES 1098 Query: 181 NISKNKVDLKQAQYKDIDKRYFDQLIQLKTTEMANKDLDRYYNALDKALMRFHSMKMEEI 360 +ISKN+V+LKQAQYKDIDKR+FDQLIQLKTTEMANKDLDRYYNALDKALMRFH+MKMEEI Sbjct: 1099 SISKNRVELKQAQYKDIDKRHFDQLIQLKTTEMANKDLDRYYNALDKALMRFHTMKMEEI 1158 Query: 361 NKIIRELWQQTYRGQDIDYISIHSDSEGSGTRSYSYKVVMLTGDTELEMRGRCSAGQKVL 540 NKIIRELWQQTYRGQD+DYI IHSDSEG+GTRSYSYKV+M TGDTELEMRGRCSAGQKVL Sbjct: 1159 NKIIRELWQQTYRGQDMDYIRIHSDSEGAGTRSYSYKVLMQTGDTELEMRGRCSAGQKVL 1218 Query: 541 ASLIIRLALAETFCLNCGILALDEPTTNLDGPNSESLAAALLRIMEDRKGQENFQLIVIT 720 ASLIIRLALAETFCLNCGILALDEPTTNLDGPNSESLA ALLRIMEDRKGQENFQLIVIT Sbjct: 1219 ASLIIRLALAETFCLNCGILALDEPTTNLDGPNSESLAGALLRIMEDRKGQENFQLIVIT 1278 Query: 721 HDERFAPYIGQRQHAEKYYRISKDDHQH 804 HDERFA IGQRQHAEKYYR++KDD QH Sbjct: 1279 HDERFAQMIGQRQHAEKYYRVAKDDMQH 1306 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,980,541 Number of Sequences: 27288 Number of extensions: 366341 Number of successful extensions: 1182 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1170 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1494360868 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18263010|gb|BM411380.1|BM411380 EST585707 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG56H9 5' end, mRNA sequence (777 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54770.1 thiazole biosynthetic enzyme precursor (ARA6) (sp Q3... 414 e-127 >At5g54770.1 thiazole biosynthetic enzyme precursor (ARA6) (sp Q38814) / ; supported by cDNA: gi_1113782_gb_U17589.1_ATU17589 Length = 349 Score = 414 bits (1065), Expect(2) = e-127 Identities = 204/232 (87%), Positives = 221/232 (94%) Frame = +1 Query: 1 LGSFSFNPIKESIVAREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKNPNVQVAI 180 L +F+F+PIKESIV+REMTRRYMTDMITYA+TDVV+VGAGSAGLS AYE+SKNPNVQVAI Sbjct: 53 LNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQVAI 112 Query: 181 LEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIDYDEQDNYVVIKHAALFTSTIMSK 360 +EQSVSPGGGAWLGGQLFSAM+VRKPAHLFL+E+G+ YDEQD YVV+KHAALFTSTIMSK Sbjct: 113 IEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDTYVVVKHAALFTSTIMSK 172 Query: 361 LLARPNVKLFNAVATEDLIVKNGRVGGVVTNWSLVSQNHDTQSCMDPNVMEAKIVVSSCG 540 LLARPNVKLFNAVA EDLIVK RVGGVVTNW+LV+QNH TQSCMDPNVMEAKIVVSSCG Sbjct: 173 LLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHHTQSCMDPNVMEAKIVVSSCG 232 Query: 541 HDGPMGATGVKRLRSIGMINSVPGMKALDMNAAEDAIVRLTREVVPGMIVTG 696 HDGP GATGVKRL+SIGMI+ VPGMKALDMN AEDAIVRLTREVVPGMIVTG Sbjct: 233 HDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTG 284 Score = 57.8 bits (138), Expect(2) = e-127 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 695 GMEVAEIDGAPRMGPTFGAMMISGQKA 775 GMEVAEIDGAPRMGPTFGAMMISGQKA Sbjct: 284 GMEVAEIDGAPRMGPTFGAMMISGQKA 310 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,838,541 Number of Sequences: 27288 Number of extensions: 410017 Number of successful extensions: 1417 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1341 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1411 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1428015260 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262920|gb|BM411290.1|BM411290 EST585617 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG56E10 5' end, mRNA sequence (744 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g18850.1 unknown protein / 246 9e-66 At1g14030.1 putative ribulose-1,5 bisphosphate carboxylase oxyge... 59 3e-09 At3g07670.1 putative ribulose-1,5-bisphosphate carboxylase oxyge... 52 4e-07 >At2g18850.1 unknown protein / Length = 441 Score = 246 bits (628), Expect = 9e-66 Identities = 131/243 (53%), Positives = 171/243 (69%) Frame = +2 Query: 2 ELELYFGGEDVKDMVGFNSPRNEMEALNSILTAIAKLDGEHCSTTTLEELRVAAVNLISE 181 ++E+YFG ED G S RNE+ AL+ IL+ I T E LR A I+E Sbjct: 65 KVEVYFG-EDACTPAGIYSVRNEISALSWILSLIPVSCKMQTQVDTFEALRAALKGRINE 123 Query: 182 LGKKCKEESKVVTRSSCEAEKCLQQWGEDQGVKSQLEISYFEGAGRGAIARQDLRIGDIA 361 + KE+++VV CE E L +WG+D GVK++L+I+ +G GRGAIA +DL+ GD+A Sbjct: 124 VVGAEKEKARVVDSYRCEKESKLVEWGQDNGVKTKLQIAQIDGYGRGAIASEDLKFGDVA 183 Query: 362 LEIPLSIVISDDLVHEYYMYSILEKIEGMSAETMLLLWSMKEKHNPDSKFKLYFDTLPEV 541 LEIP+S +IS++ V+ MY ILE +G+++ETMLLLW+M+EKHN DSKFK YFD+L E Sbjct: 184 LEIPVSSIISEEYVYNSDMYPILETFDGITSETMLLLWTMREKHNLDSKFKPYFDSLQEN 243 Query: 542 FNTGLSFGMEAIMALDGTLLLEEIVQAKEHLRAQYDELFPSLCNDHPDVFPPEQYGWEQF 721 F TGLSFG++AIM LDGTLLL+EI+QAKE LR +YDEL P L N H +VFPPE Y WE + Sbjct: 244 FCTGLSFGVDAIMELDGTLLLDEIMQAKELLRERYDELIPLLSN-HREVFPPELYTWEHY 302 Query: 722 LWA 730 LWA Sbjct: 303 LWA 305 >At1g14030.1 putative ribulose-1,5 bisphosphate carboxylase oxygenase large subunit N-methyltransferase / highly similar to ribulose-1,5 bisphosphate carboxylase oxygenase large subunit N-methyltransferase, gi|1731475. Rare GC intron splice site at 49572 is inferred from protein alignment and is not confirmed experimentally Length = 482 Score = 58.9 bits (141), Expect = 3e-09 Identities = 40/161 (24%), Positives = 81/161 (49%), Gaps = 2/161 (1%) Frame = +2 Query: 254 QWGEDQGVKSQLEISY--FEGAGRGAIARQDLRIGDIALEIPLSIVISDDLVHEYYMYSI 427 +W DQGV S ++ G G +AR+D+ ++ LEIP + I+ + V + + Sbjct: 54 KWLRDQGVVSGKSVAEPAVVPEGLGLVARRDIGRNEVVLEIPKRLWINPETVTASKIGPL 113 Query: 428 LEKIEGMSAETMLLLWSMKEKHNPDSKFKLYFDTLPEVFNTGLSFGMEAIMALDGTLLLE 607 G+ + L+ ++EK+ +S +++Y D LP+ ++ + + E + L GT LL Sbjct: 114 CG---GLKPWVSVALFLIREKYEEESSWRVYLDMLPQSTDSTVFWSEEELAELKGTQLLS 170 Query: 608 EIVQAKEHLRAQYDELFPSLCNDHPDVFPPEQYGWEQFLWA 730 + KE++ ++ +L + + D+F + + F+WA Sbjct: 171 TTLGVKEYVENEFLKLEQEILLPNKDLF-SSRITLDDFIWA 210 >At3g07670.1 putative ribulose-1,5-bisphosphate carboxylase oxygenase small subunit N-methyltransferase I / similar to ribulose-1,5-bisphosphate carboxylase oxygenase small subunit N-methyltransferase I GB:AAC29137 (Chloroplast Spinacia oleracea); nearly identical to putative methyltransferase GB:AAC14296 (Arabidopsis thaliana); supported by cDNA: 12942. Length = 504 Score = 51.6 bits (122), Expect = 4e-07 Identities = 50/208 (24%), Positives = 90/208 (43%), Gaps = 3/208 (1%) Frame = +2 Query: 116 GEHCSTTTLEELRVAAVNLISELGKKCKEESKVVTRSSCEAEKCLQQWGEDQGVKSQ-LE 292 G HCS + E + ++ ++ C+ +S E LQ W D G+ Q + Sbjct: 41 GIHCSVSA-GETTIQSMEEAPKISWGCEIDS-------LENATSLQNWLSDSGLPPQKMA 92 Query: 293 ISYFEGAGRGAIARQDLRIGDIALEIPLSIVISDDLVHEYYMYSILEKIEGMSAETMLLL 472 I + RG +A Q+LR G+ L +P S+VIS D + K + +L Sbjct: 93 IDRVDIGERGLVASQNLRKGEKLLFVPPSLVISADSEWTNAEAGEVMKRYDVPDWPLLAT 152 Query: 473 WSMKEKH-NPDSKFKLYFDTLP-EVFNTGLSFGMEAIMALDGTLLLEEIVQAKEHLRAQY 646 + + E S++ Y LP + ++ E M L+ + + E ++ ++ Y Sbjct: 153 YLISEASLQKSSRWFNYISALPRQPYSLLYWTRTELDMYLEASQIRERAIERITNVVGTY 212 Query: 647 DELFPSLCNDHPDVFPPEQYGWEQFLWA 730 ++L + + HP +FP E + E F W+ Sbjct: 213 EDLRSRIFSKHPQLFPKEVFNDETFKWS 240 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,939,301 Number of Sequences: 27288 Number of extensions: 412941 Number of successful extensions: 1232 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 1183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1228 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1330449000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262881|gb|BM411251.1|BM411251 EST585578 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG56K21 5' end, mRNA sequence (800 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g07210.1 expressed protein / predicted using genefinder;su... 187 6e-48 >At3g07210.1 expressed protein / predicted using genefinder;supported by full-length cDNA: Ceres:23826. Length = 547 Score = 187 bits (475), Expect = 6e-48 Identities = 121/259 (46%), Positives = 160/259 (61%), Gaps = 13/259 (5%) Frame = +3 Query: 9 EGEALITDPHAVSSV---HGIPTPEIYESPNLTSVPVKMKEGTHIQLLDINFPPRVAKFS 179 E E T+P + GIPTPEIYESP LTS P++ E + LLDINFPPR+ K Sbjct: 308 EEETSKTNPQVCGTTTHAQGIPTPEIYESPKLTSGPLR-NETAQVHLLDINFPPRIPKAI 366 Query: 180 GSPQPARRIRSSFGENFVNKPPLEHPVRKGTIWQSNPVADAEIASTGSVNGIQSEVQSSC 359 ++S+ H V + I +DA+IASTGSVNG SEV SS Sbjct: 367 TFHPELNSLQSN------------HIVEEAEIVSEG--SDAQIASTGSVNGALSEVISSS 412 Query: 360 --SSIRILEMENGYSSDGEITMYSAETAESRNFPSPKEGRRF--QQVGRSQSCVNHNRWG 527 ++ + +GYSS+ E TMYSAETAESRN+P+P F ++VGRSQSCV+ +RWG Sbjct: 413 PPAAAHYVYNNHGYSSEEE-TMYSAETAESRNYPTPPRKSEFHHERVGRSQSCVSSSRWG 471 Query: 528 TAKQNAGARGAMLQQQQRSSMQGRKVYSQGANSQRSSDYFNPTVSSIMKKRNN------L 689 T +++ R ML++Q RS + G+K++SQGA SQRS+DY++PTVSSIMKKR N + Sbjct: 472 TPQKSLNGRREMLEKQ-RSFVHGKKMHSQGAMSQRSNDYYSPTVSSIMKKRINSSEQQII 530 Query: 690 EPQTRPRQSAANSSPKWNF 746 +P RPR A +SSP+W F Sbjct: 531 KPVPRPR--AVSSSPRWAF 547 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,175,451 Number of Sequences: 27288 Number of extensions: 457387 Number of successful extensions: 1307 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1301 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1485518496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262880|gb|BM411250.1|BM411250 EST585577 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG56K19 5' end, mRNA sequence (829 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22990.1 expressed protein / ;supported by full-length cD... 336 1e-92 >At3g22990.1 expressed protein / ;supported by full-length cDNA: Ceres:120050. Length = 460 Score = 336 bits (861), Expect = 1e-92 Identities = 175/258 (67%), Positives = 207/258 (79%), Gaps = 6/258 (2%) Frame = +1 Query: 34 MQKREQSKLSGSSGGSVGPPAKRGRPFGSGNSN-AASAAAAAAADSAAPSTLLGPSLQVH 210 MQKRE K G+SGGS GPPAKRGRPFGS ++N AA+AAAAAAAD+ +PS LLGPSL VH Sbjct: 1 MQKRELGKSGGNSGGSSGPPAKRGRPFGSTSANSAAAAAAAAAADAMSPSALLGPSLLVH 60 Query: 211 SAFAEQNNKRIVLALQSGLKRELTWALNTLTLLSFKEKDEVRRDATPLAKIPGLLDALLQ 390 ++F EQNN+RIVLALQSGLK E+TWALNTLTLLSFKEK+++RRD PLAKI GLLDALL Sbjct: 61 NSFVEQNNRRIVLALQSGLKSEVTWALNTLTLLSFKEKEDIRRDVMPLAKIAGLLDALLL 120 Query: 391 IIDDWRDIALPRVLVKAPRVRLLGANSVVTGFGLEYEALNSNESV-----LNPRESSVQK 555 IIDDWRDIALP+ L + RVR LG N+ VTGFG EY+AL S + + E+ +K Sbjct: 121 IIDDWRDIALPKDLTRGTRVRTLGTNASVTGFGNEYDALASIQPPGSGIGSSAAEALGKK 180 Query: 556 SSTKSRPTGLCFEEDGLFNLDEEGRIEKQQFAVAASNVVRNFSFMPDNEVIMGQHRHCLE 735 S+ K + + EEDGLFNLD+EGR EKQ A+AASNV+RNFSFMPDNEV+M QHRHCLE Sbjct: 181 STGKHQSSQWWMEEDGLFNLDDEGRSEKQMCAIAASNVIRNFSFMPDNEVVMAQHRHCLE 240 Query: 736 TLFPCLADYVTEDEELVT 789 T+F C+ D++TEDEELVT Sbjct: 241 TVFQCIHDHMTEDEELVT 258 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,915,053 Number of Sequences: 27288 Number of extensions: 429154 Number of successful extensions: 1759 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1721 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1565099844 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262860|gb|BM411230.1|BM411230 EST585557 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG56G15 5' end, mRNA sequence (752 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g16570.1 unknown protein / contains similarity to beta-1,4... 184 4e-47 >At1g16570.1 unknown protein / contains similarity to beta-1,4 mannosyltransferase GI:6970470 from [Homo sapiens] Length = 465 Score = 184 bits (467), Expect = 4e-47 Identities = 89/116 (76%), Positives = 98/116 (83%) Frame = -2 Query: 742 EDYPCFLGSADLGVCLHTSSSGLDLPMKVVDMFGCGLPVCAVSYSCINELVEVDKNGLLF 563 EDYP LGSADLGVCLHTSSSGLDLPMKVVDMFGCGLPVC+VSYSCI ELV+ KNGLLF Sbjct: 344 EDYPLLLGSADLGVCLHTSSSGLDLPMKVVDMFGCGLPVCSVSYSCIQELVKDGKNGLLF 403 Query: 562 SSSSELADQFVTLFKGFPGECDELKSLRQGVLASRSSVNWATEWEANAKPLISKVI 395 SSSSELADQ + LFKGFPG CD L SL+ G + + SS WATEWE AKPLI++V+ Sbjct: 404 SSSSELADQLLILFKGFPGNCDALMSLKAGAMETGSSGRWATEWEDCAKPLITQVV 459 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,449,259 Number of Sequences: 27288 Number of extensions: 391049 Number of successful extensions: 1150 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1149 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1357057980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262854|gb|BM411224.1|BM411224 EST585551 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG56E19 5' end, mRNA sequence (725 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g18270.1 putative protein / phospho-N-acetylmuramoyl-penta... 183 7e-47 >At4g18270.1 putative protein / phospho-N-acetylmuramoyl-pentapeptide-transferase, Haemophilus influenzae,Pir2:A64185 Length = 313 Score = 183 bits (465), Expect = 7e-47 Identities = 89/128 (69%), Positives = 106/128 (82%) Frame = -1 Query: 674 LSIFGASMAGACAGFLLHNRYKASIFMGDTGALALGGALASMAACTGMFFPLFISSGVFV 495 LS+FGASMAGAC GFLLHNRY+AS+ MGDTG+LALGGALA+MAAC+GMFFPLFISSGV V Sbjct: 185 LSVFGASMAGACFGFLLHNRYRASVSMGDTGSLALGGALAAMAACSGMFFPLFISSGVAV 244 Query: 494 LEALSVILQVSFFKTTKHFLGTGHRLFRMAPLHHHLELCGVKEPVIVAGAYVFSCILALT 315 LEA SVI+QV ++ TTK G G R+F+ P HHHL L G+KEP+IV AYV S +L+L+ Sbjct: 245 LEASSVIIQVVYYSTTKRLKGKGRRIFKTIPFHHHLRLNGLKEPMIVTMAYVISSLLSLS 304 Query: 314 AGYVGLAS 291 A Y+GL S Sbjct: 305 AAYIGLIS 312 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,806,935 Number of Sequences: 27288 Number of extensions: 384299 Number of successful extensions: 920 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 867 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 918 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1277231040 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262795|gb|BM411165.1|BM411165 EST585492 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55J6 5' end, mRNA sequence (695 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g04305.1 hypothetical protein / predicted by genefinder; s... 236 7e-63 >At2g04305.1 hypothetical protein / predicted by genefinder; supported by cDNA: gi_19310533 Length = 434 Score = 236 bits (603), Expect = 7e-63 Identities = 115/156 (73%), Positives = 136/156 (86%) Frame = +2 Query: 2 FASDDINSLEELIGRLRRLKENVGFIANRVTAIQAGLDSWQSEQINKKLYYLSFLSIVFL 181 F ++DI+SLEELIGRLRRLKENVGFIANRVTAIQAGLDSWQ+EQIN+KLYYLSFLSI+FL Sbjct: 282 FLAEDIHSLEELIGRLRRLKENVGFIANRVTAIQAGLDSWQAEQINRKLYYLSFLSIIFL 341 Query: 182 PLSVVTGVFGMNVGGVPWTNQREPELKEGFRNVMMLCVVLLLLVLLCFLFPALYSHLMAW 361 PLS++TGVFGMNVGGVPWT Q +PEL++GFRNVM +C+++L+LVL CF FPALYS + +W Sbjct: 342 PLSIITGVFGMNVGGVPWTGQDKPELRDGFRNVMYICLIMLVLVLCCFGFPALYSRIASW 401 Query: 362 KRRRDMKRNWSLNRRSFLRRSTGVRERNERGGYLRL 469 RDMKR+WSLNRRSF + V+ER GYLRL Sbjct: 402 WGTRDMKRSWSLNRRSFKKIPNIVQERK---GYLRL 434 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,554,087 Number of Sequences: 27288 Number of extensions: 353402 Number of successful extensions: 1195 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1191 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1201087980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262789|gb|BM411159.1|BM411159 EST585486 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55H14 5' end, mRNA sequence (753 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11680.1 putative protein / predicted proteins, Arabidopsi... 320 7e-88 >At5g11680.1 putative protein / predicted proteins, Arabidopsis thaliana;supported by full-length cDNA: Ceres:403. Length = 207 Score = 320 bits (819), Expect = 7e-88 Identities = 157/202 (77%), Positives = 174/202 (85%), Gaps = 9/202 (4%) Frame = +2 Query: 14 MAVNPQLFRNGMPVPFVNELFVLARDGVEFEVDKIPGV--GAVKAKGTVYLSNIRMVFVS 187 MA+NPQL NGMPVPFVNE+FVL RDGVEFEVDKIPG G VKAKG +YLSNIRMVFVS Sbjct: 1 MALNPQLLPNGMPVPFVNEMFVLVRDGVEFEVDKIPGGHGGHVKAKGVIYLSNIRMVFVS 60 Query: 188 IKPVENFIAFDMPLLYVHGEKFNQPIFFCNNICGHVDPVIPVNENRALFSTHSFKILFKE 367 KPV+NF+AFDMPLLY+H EKFNQPIF CNNI G V+PV+P NE+RAL+STHSFKILFKE Sbjct: 61 SKPVDNFVAFDMPLLYIHAEKFNQPIFHCNNIAGQVEPVVPENEHRALYSTHSFKILFKE 120 Query: 368 GGCGTFIPLFFNLIASVRQYHQQSREEA-------RVDPLQAAQTPVDEMMRHAYVDPND 526 GGCGTF+PLF NLI+SVRQY++Q ++ A VDPLQAAQTPVDEMMRHAYVDPND Sbjct: 121 GGCGTFVPLFLNLISSVRQYNRQMQQAAEAAAAAPHVDPLQAAQTPVDEMMRHAYVDPND 180 Query: 527 PTRIFLQQPSTESQLRRRTYQS 592 PTRI+LQQPS ESQLRRR Y S Sbjct: 181 PTRIYLQQPSGESQLRRRAYHS 202 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,674,767 Number of Sequences: 27288 Number of extensions: 392411 Number of successful extensions: 1023 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 986 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1020 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1357057980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262769|gb|BM411139.1|BM411139 EST585466 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55D4 5' end, mRNA sequence (750 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g10690.1 putative DNA gyrase subunit A / similar to DNA gy... 366 e-102 >At3g10690.1 putative DNA gyrase subunit A / similar to DNA gyrase A subunit GB:BAA10380 (Synechocystis sp) Length = 917 Score = 366 bits (940), Expect = e-102 Identities = 185/249 (74%), Positives = 219/249 (87%) Frame = +2 Query: 2 NLDEVINTIRKASSHALATANLRKEFELTEKQAEAILDISLRRLTALERNKFVDEGKSLR 181 N+DEVI I KASSH+ ATA L+ E+ L+EKQAEAIL+I+LRRLTALER KF DE SL Sbjct: 484 NVDEVIELITKASSHSSATAALQSEYGLSEKQAEAILEITLRRLTALERKKFTDESSSLT 543 Query: 182 TQISKLEELLSSEKQILQLIEEEALEIKDKYFTPRRSQLEDTDSGDLEDIDVIPNEEMLL 361 QI+KLE+LLS+ IL+LIE+EA+E+KD++ +PRRS LED+DSGDLEDIDVIPNEEML+ Sbjct: 544 EQITKLEQLLSTRTNILKLIEQEAIELKDRFSSPRRSMLEDSDSGDLEDIDVIPNEEMLM 603 Query: 362 AISEKGYVKRMKPDTFNLQNRGTIGKSVGKLRVNDAMSDFLVCRAHDKVLYFSDKGTVYS 541 A+SEKGYVKRMK DTFNLQ+RGTIGKSVGKLRV+DAMSDFLVC AHD VL+FSD+G VYS Sbjct: 604 AVSEKGYVKRMKADTFNLQHRGTIGKSVGKLRVDDAMSDFLVCHAHDHVLFFSDRGIVYS 663 Query: 542 SPAYKIPECSRTAAGTPLIQILSLSDGERITSIIPVSDFAGDQYLVMLTVNGYIKKVSLD 721 + AYKIPECSR AAGTPL+QILS+S+GER+TSI+PVS+FA D+YL+MLTVNG IKKVSL Sbjct: 664 TRAYKIPECSRNAAGTPLVQILSMSEGERVTSIVPVSEFAEDRYLLMLTVNGCIKKVSLK 723 Query: 722 YFALYRSTG 748 F+ RSTG Sbjct: 724 LFSGIRSTG 732 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,112,384 Number of Sequences: 27288 Number of extensions: 316255 Number of successful extensions: 1027 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 982 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1025 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262662|gb|BM411032.1|BM411032 EST585359 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55M18 5' end, mRNA sequence (835 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g48850.1 chorismate synthase, putative / similar to choris... 354 e-115 >At1g48850.1 chorismate synthase, putative / similar to chorismate synthase GI:452796 from [Synechocystis sp.]; supported by cDNA: gi_15982823_gb_AY057519.1_ Length = 436 Score = 354 bits (908), Expect(3) = e-115 Identities = 167/204 (81%), Positives = 192/204 (93%) Frame = +3 Query: 81 FGNYFRVTTFGESHGGGVGCIIDGCPPRLPLSESDMQVELDRRRPGQSRITTPRKETDTC 260 +G +FRV+TFGESHGGGVGCIIDGCPPR+PL+ESD+Q +LDRRRPGQSRITTPRKETDTC Sbjct: 55 YGTHFRVSTFGESHGGGVGCIIDGCPPRIPLTESDLQFDLDRRRPGQSRITTPRKETDTC 114 Query: 261 KISSGTADGLTTGSPIKVEVPNTDQRGNDYSEMSLAYRPSHADATYDFKYGVRSVQGGGR 440 +ISSG ++G+TTG+PI V VPNTDQRG DYSEMS+AYRPSHADATYD KYGVRSVQGGGR Sbjct: 115 RISSGVSEGMTTGTPIHVFVPNTDQRGLDYSEMSVAYRPSHADATYDMKYGVRSVQGGGR 174 Query: 441 SSARETIGRVAAGAVAKKILKLYSGAEVLAYVSQVHQVVLPEDLIDHQNVTLEQIESNIV 620 SSARETIGRVA GA+AKKILK ++G E+LAYVSQVH VVLPE+L+DH+N+TLEQIE+NIV Sbjct: 175 SSARETIGRVAPGALAKKILKQFAGTEILAYVSQVHHVVLPEELVDHENLTLEQIENNIV 234 Query: 621 RCPDPEYAEKMIAAIDAVRVRGDS 692 RCP+PEYAEKMIAAIDAVR +G+S Sbjct: 235 RCPNPEYAEKMIAAIDAVRTKGNS 258 Score = 78.2 bits (191), Expect(3) = e-115 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = +1 Query: 694 VGGVVTCIGRNLPRGLGTPVFDKL*AELAKACMSLPATKGF 816 VGGVVTCI RN PRGLGTPVFDKL AELAKACMSLPATKGF Sbjct: 259 VGGVVTCIVRNAPRGLGTPVFDKLEAELAKACMSLPATKGF 299 Score = 22.7 bits (47), Expect(3) = e-115 Identities = 8/9 (88%), Positives = 9/9 (99%) Frame = +2 Query: 809 RGFEFGSGF 835 +GFEFGSGF Sbjct: 297 KGFEFGSGF 305 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,778,253 Number of Sequences: 27288 Number of extensions: 460440 Number of successful extensions: 1522 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1422 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1518 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1582784588 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262654|gb|BM411024.1|BM411024 EST585351 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55K24 5' end, mRNA sequence (648 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g43400.1 putative electron transfer flavoprotein ubiquinone o... 259 6e-70 >At2g43400.1 putative electron transfer flavoprotein ubiquinone oxidoreductase / Length = 633 Score = 259 bits (663), Expect = 6e-70 Identities = 116/150 (77%), Positives = 130/150 (86%) Frame = +3 Query: 3 GLALSAVEHYILKGRSPVTLNHGKPDHEATREAQLFSPIEYPKPDGVVSFDVPTSLYRSN 182 GLA+SA+EHY+LKG+ P TL HGK DHEAT A+ ++PI YPKPDGV+SFDVPTSLYRSN Sbjct: 484 GLAISAMEHYVLKGKVPFTLKHGKADHEATDLARKWTPIVYPKPDGVLSFDVPTSLYRSN 543 Query: 183 TNHDHDQPSHLHLKDPTVPENVNLPKYAGPEARYCPARVYEYIPDETGDLKLQINAQNCL 362 TNHDHDQPSHL L+DP +PE VN P+YA PE+RYCPARVYEYI DE G KLQINAQNCL Sbjct: 544 TNHDHDQPSHLRLRDPKIPEKVNFPEYAAPESRYCPARVYEYIEDEEGKPKLQINAQNCL 603 Query: 363 HCKACSIKDPKQNFEWTVPEGGGGPGYTIM 452 HCKAC IKDPKQN EWTVPEGGGGP Y++M Sbjct: 604 HCKACDIKDPKQNIEWTVPEGGGGPAYSLM 633 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,717,712 Number of Sequences: 27288 Number of extensions: 344420 Number of successful extensions: 979 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 979 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1070908320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262643|gb|BM411013.1|BM411013 EST585340 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55I22 5' end, mRNA sequence (672 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g45790.1 putative phosphomannomutase / ;supported by full... 282 3e-79 >At2g45790.1 putative phosphomannomutase / ;supported by full-length cDNA: Ceres:998. Length = 246 Score = 282 bits (721), Expect(2) = 3e-79 Identities = 129/165 (78%), Positives = 152/165 (91%) Frame = -3 Query: 637 QAYGKQSLKSYLGDEKLKEFINFTLHYIADLDIPIKRGTFIEFRSGMLNVSPIGRNCSQE 458 ++ G QSLK +LGD+KLKE INFTLHYIADLDIPIKRGTFIEFR+GMLNVSPIGRNCSQE Sbjct: 81 KSIGIQSLKLHLGDDKLKELINFTLHYIADLDIPIKRGTFIEFRNGMLNVSPIGRNCSQE 140 Query: 457 EKDEFEKYDKVQKIRETMVSVLREKFAHFNLTFSIGGQISFDVFPQGWDKTYCLRYLEEF 278 E+DEFE+YDKVQ IR MV+ LRE+FAH NLTFSIGGQISFDVFP+GWDKTYCL+YLE+F Sbjct: 141 ERDEFERYDKVQNIRPKMVAELRERFAHLNLTFSIGGQISFDVFPKGWDKTYCLQYLEDF 200 Query: 277 NEIHFFGDKTYKGGNDHEIYESERTVGHTVTSPEETLKQCSVLFL 143 +EIHFFGDKTY+GGND+EIYES +T+GH+VTSP++T+ +C LF+ Sbjct: 201 SEIHFFGDKTYEGGNDYEIYESPKTIGHSVTSPDDTVAKCKALFM 245 Score = 30.8 bits (68), Expect(2) = 3e-79 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 Query: 672 FFENGLVAHKDGKLMG 625 F ENGLVAHKDGK +G Sbjct: 69 FSENGLVAHKDGKSIG 84 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,581,464 Number of Sequences: 27288 Number of extensions: 320720 Number of successful extensions: 954 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 921 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 954 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1129912396 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262618|gb|BM410988.1|BM410988 EST585315 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55E12 5' end, mRNA sequence (748 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27110.1 expressed protein / contains Pfam profile:PF01435... 376 e-105 >At3g27110.1 expressed protein / contains Pfam profile:PF01435 Peptidase family M48;supported by full-length cDNA: Ceres:156849. Length = 344 Score = 376 bits (965), Expect = e-105 Identities = 185/218 (84%), Positives = 204/218 (92%) Frame = +1 Query: 1 LPELHYLMVEASRILNIEAPDLYIRQSPVPNAYTLAVSGKKPFVVVHTSLVELLSRNELQ 180 L +LH L+VEA+ ILNIEAPDLY+RQSPVPNAYTLA+SGKKPF+VVHTSL+ELL+ ELQ Sbjct: 127 LSDLHGLLVEAAEILNIEAPDLYVRQSPVPNAYTLAISGKKPFIVVHTSLIELLTSAELQ 186 Query: 181 AVLAHELGHLKCDHGVWLTFANVLTLGAYTVPGVGSLIAQRLEEQLLRWLRAAELTCDRA 360 AVLAHELGHLKCDHGVWLTFAN+LTLGAYTVP G +IA+ LEEQLLRWLR+AELTCDRA Sbjct: 187 AVLAHELGHLKCDHGVWLTFANILTLGAYTVPAFGQMIARTLEEQLLRWLRSAELTCDRA 246 Query: 361 ALLVAQDPKVVVSVLMKLAGGCPSLSDQLNVDAFLEQARSYDKASSSPVGWYIRNAQTRQ 540 ALLVAQDPKVVVSVLMKLAGGCPS++DQLNVDAFLEQARSYDKASSSP+GWYIRNAQT Q Sbjct: 247 ALLVAQDPKVVVSVLMKLAGGCPSIADQLNVDAFLEQARSYDKASSSPLGWYIRNAQTSQ 306 Query: 541 LSHPLPVLRAREIDEWSRSQEYRSLLQRAIQVNPVQKV 654 LSHPLPVLRAREIDEWSRS EY+SLL+RA + + VQKV Sbjct: 307 LSHPLPVLRAREIDEWSRSLEYKSLLKRANRKSTVQKV 344 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,702,160 Number of Sequences: 27288 Number of extensions: 333557 Number of successful extensions: 839 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 839 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262577|gb|BM410947.1|BM410947 EST585274 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55M9 5' end, mRNA sequence (764 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g31040.1 expressed protein / ;supported by full-length cD... 301 3e-82 >At4g31040.1 expressed protein / ;supported by full-length cDNA: Ceres:31287. Length = 438 Score = 301 bits (770), Expect = 3e-82 Identities = 148/200 (74%), Positives = 170/200 (85%) Frame = +2 Query: 2 FLDRYVKTVPLAAQMLDVRRNQKLEMVKELKAEQARYRLEVEIGKSPPLSEKELHLELRH 181 FLDRYVKTVPLAAQ LDVRRNQKLEMVKEL E+ARYRLEVEIGKSPPLS+ +L E+R Sbjct: 239 FLDRYVKTVPLAAQTLDVRRNQKLEMVKELNREKARYRLEVEIGKSPPLSDDDLWWEMRG 298 Query: 182 KALELRDEWRLENRKAFAYIFSDFVSGVSLFILLCFNESKVKLLKFTGYKILNNISDAGK 361 KALELRDEWRLENRKAFA I+SD V G+SLF+LL N+ +V LLKFTGYKI+NNISD GK Sbjct: 299 KALELRDEWRLENRKAFANIWSDMVFGISLFVLLYANQGRVALLKFTGYKIINNISDTGK 358 Query: 362 AFLIILISDTLLGYHSEYGWNTALEMLVEHYGIEVDRSAITIFVCIVPVITDTFVKLWIF 541 AFLIILI+D LGYHSE GW T LE+++EHYG+EV++S ITIF+C+VPVI D VKLW+F Sbjct: 359 AFLIILITDIFLGYHSESGWETLLEIIMEHYGLEVEQSTITIFICLVPVIMDACVKLWLF 418 Query: 542 KYLPRLSSEVPKYIQKMKRH 601 K+LPRLS V Q+MKRH Sbjct: 419 KFLPRLSPRVSNIFQEMKRH 438 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,071,379 Number of Sequences: 27288 Number of extensions: 339516 Number of successful extensions: 1014 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 976 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1014 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1392536620 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262556|gb|BM410926.1|BM410926 EST585253 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55G13 5' end, mRNA sequence (786 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g52050.1 putative protein / weak similarity DNA polymerase... 94 6e-20 >At3g52050.1 putative protein / weak similarity DNA polymerase I -Bacillus stearothermophilus,PIR2:S70368 Length = 384 Score = 94.4 bits (233), Expect = 6e-20 Identities = 46/68 (67%), Positives = 54/68 (78%) Frame = +3 Query: 372 SNGKLMLIDGTSIIYRAYYRLLAKLHHGHLSHADGNGDWVLTIFTALSLIIDVLEFLPSH 551 SNG++MLIDGTSIIYRAYY+LLA+L+HGHL+HADGN DWVLTIF++LSL Sbjct: 115 SNGRVMLIDGTSIIYRAYYKLLARLNHGHLAHADGNADWVLTIFSSLSL----------- 163 Query: 552 IAVVFDHD 575 VVFDHD Sbjct: 164 --VVFDHD 169 Score = 63.2 bits (152), Expect = 2e-10 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = +2 Query: 575 RMVSFGMEEFAEKYGGLKPSQFVDLTSLMGDKSDNIPG 688 RM SFGME+FA+K+G L+P+QFVD+ +L GDKSDNIPG Sbjct: 273 RMASFGMEDFAKKFGNLEPAQFVDIIALAGDKSDNIPG 310 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,377,166 Number of Sequences: 27288 Number of extensions: 386277 Number of successful extensions: 944 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 911 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 944 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262551|gb|BM410921.1|BM410921 EST585248 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG55E23 5' end, mRNA sequence (705 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27530.1 expressed protein / similar to hypothetical prote... 267 5e-72 >At3g27530.1 expressed protein / similar to hypothetical protein GB:CAA07228 from [Cicer arietinum]; supported by cDNA: gi_15810206_gb_AY056118.1_ Length = 914 Score = 267 bits (682), Expect = 5e-72 Identities = 139/236 (58%), Positives = 175/236 (73%), Gaps = 3/236 (1%) Frame = +3 Query: 6 LGRAEPLLHRMVKYLALASSMKSKDGKSSTSENVFVQPIILKLLTIWLSDCPNAVQCFLD 185 +G EPL R+V+YLA+ASSMKSK+ KSST ++Q IILKLL W DCP AVQCFLD Sbjct: 488 MGTPEPLFQRIVRYLAVASSMKSKE-KSSTLGKSYIQQIILKLLVTWTVDCPTAVQCFLD 546 Query: 186 SRPHLTYLLELVSNPTTTVCVRGLAAVLLGECVIYNNSNASGKDAYSIVDAISQKVGLTS 365 SR HLT+LLELV++P TVC+RGLA++LLGECVIYN S +GKDA+S+VDA+ QK+GLTS Sbjct: 547 SRHHLTFLLELVTDPAATVCIRGLASILLGECVIYNKSIENGKDAFSVVDAVGQKMGLTS 606 Query: 366 YFLKFDEMQKSSLFT-SAKPFLPRKSLTRSSAVSMSEIE--DGATESSDQKNEHPMLASV 536 YF KF+EMQ S +F+ S KP K LTR+ S +EI D E +HPML S+ Sbjct: 607 YFSKFEEMQNSFIFSPSKKPPQGYKPLTRTPTPSEAEINEVDEVDEMVKGNEDHPMLLSL 666 Query: 537 FDSPFVYFLKRLEADIREKMVEAYSSPNSQVTVVPAELEQRSGENDVDYIKRLKTF 704 FD+ F+ +K LE +IRE++V+ YS P S+V VVPA+LEQ+SGEN+ DYI RLK F Sbjct: 667 FDASFIGLVKSLEGNIRERIVDVYSRPKSEVAVVPADLEQKSGENEKDYINRLKAF 722 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,357,186 Number of Sequences: 27288 Number of extensions: 323187 Number of successful extensions: 813 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 811 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1227778824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262476|gb|BM410846.1|BM410846 EST585173 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG54F18 5' end, mRNA sequence (787 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g17230.1 phytoene synthase [geranylgeranyl-diphosphate gerany... 427 e-120 >At5g17230.1 phytoene synthase [geranylgeranyl-diphosphate geranylgeranyl transferase](PSY) / identical to GB:L25812; synonymous with geranylgeranyl-diphosphate geranylgeranyl transferase; supported by full-length cDNA: Ceres:15761. Length = 422 Score = 427 bits (1097), Expect = e-120 Identities = 210/261 (80%), Positives = 240/261 (91%), Gaps = 3/261 (1%) Frame = +1 Query: 13 VRSAILATPSGERTMTSEQMVYDVVLRQAALVKRQLRSTN-ELEVKP--DIPIPGNLGLL 183 V S+++A+PSGE ++SE+ VY+VVL+QAALV +QLRS++ +L+VK D+ +PG+L LL Sbjct: 69 VSSSLVASPSGEIALSSEEKVYNVVLKQAALVNKQLRSSSYDLDVKKPQDVVLPGSLSLL 128 Query: 184 SEAYDRCGEVCAEYAKTFNLGTMLMTPERRRAIWAIYVWCRRTDELVDGPNASYITPAAL 363 EAYDRCGEVCAEYAKTF LGT+LMTPERR+AIWAIYVWCRRTDELVDGPNAS+ITP AL Sbjct: 129 GEAYDRCGEVCAEYAKTFYLGTLLMTPERRKAIWAIYVWCRRTDELVDGPNASHITPMAL 188 Query: 364 DRWENRLEDVFNGRPFDMLDGALSDTVSNFPVDIQPFRDMIEGMRMDLRKSRYKNFDELY 543 DRWE RLED+F GRPFDMLD AL+DTV+ +PVDIQPFRDMIEGMRMDL+KSRY+NFD+LY Sbjct: 189 DRWEARLEDLFRGRPFDMLDAALADTVARYPVDIQPFRDMIEGMRMDLKKSRYQNFDDLY 248 Query: 544 LYCYYVAGTVGLMSVPIMGIAPESKATTESVYNAALALGIANQLTNILRDVGEDARRRRV 723 LYCYYVAGTVGLMSVP+MGI P+SKATTESVYNAALALGIANQLTNILRDVGEDARR RV Sbjct: 249 LYCYYVAGTVGLMSVPVMGIDPKSKATTESVYNAALALGIANQLTNILRDVGEDARRGRV 308 Query: 724 YLPSDELAQAGLSDEDIFAGR 786 YLP DELAQAGLSDEDIFAG+ Sbjct: 309 YLPQDELAQAGLSDEDIFAGK 329 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,330,003 Number of Sequences: 27288 Number of extensions: 430371 Number of successful extensions: 1113 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1109 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262431|gb|BM410801.1|BM410801 EST585128 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG54N5 5' end, mRNA sequence (775 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15530.1 pyruvate,orthophosphate dikinase / 404 e-113 >At4g15530.1 pyruvate,orthophosphate dikinase / Length = 960 Score = 404 bits (1038), Expect = e-113 Identities = 208/274 (75%), Positives = 233/274 (84%), Gaps = 16/274 (5%) Frame = +1 Query: 1 PPAMTGDLEIFMALADKIRRIKVMANADTPEDALAARNNGAEGIGLCRTEHM-------- 156 PPA++ DLE FM+ AD IRR+KVMANADTPEDA+AAR NGA+GIGLCRTEHM Sbjct: 585 PPALSPDLETFMSWADAIRRLKVMANADTPEDAIAARKNGAQGIGLCRTEHMIVCIQMFN 644 Query: 157 --------FFASDERIKAVRRMIMAVTLEQRKEALDSLLPYQRSDFEGIFRAMDGLPVTI 312 FF +D RIKAVR+MIMAVT EQRK +LD LLPYQRSDFEGIFRAMDGLPVTI Sbjct: 645 VVFGLVFKFFGAD-RIKAVRKMIMAVTTEQRKASLDILLPYQRSDFEGIFRAMDGLPVTI 703 Query: 313 RLLDPPLHEFLPEGNLEEIVSELTTHTGMREEDVYSRIEKLSEVNPMLGFRGCRLGISYP 492 RLLDPPLHEFLPEG+L+ IV EL TG++E++V SRIEKLSEVNPMLGFRGCRLGISYP Sbjct: 704 RLLDPPLHEFLPEGDLDNIVHELAEETGVKEDEVLSRIEKLSEVNPMLGFRGCRLGISYP 763 Query: 493 ELTEMQARAIFQAAITMNNQGISVFPEIMVPLVGTPQELGHQVDLIRDVAKKVFAEMGTS 672 ELTEMQARAIF+AA +M +QG++V PEIMVPLVGTPQELGHQVD+IR VAKKVFAE G + Sbjct: 764 ELTEMQARAIFEAAASMQDQGVTVIPEIMVPLVGTPQELGHQVDVIRKVAKKVFAEKGHT 823 Query: 673 LNYKVGTMIEIPRAAFDADEIAKETEFFSFGTHD 774 ++YKVGTMIEIPRAA ADEIAKE EFFSFGT+D Sbjct: 824 VSYKVGTMIEIPRAALIADEIAKEAEFFSFGTND 857 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,078,110 Number of Sequences: 27288 Number of extensions: 424819 Number of successful extensions: 1205 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1204 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262407|gb|BM410777.1|BM410777 EST585104 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG54F21 5' end, mRNA sequence (817 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34350.1 putative protein / hypothetical protein, Synechoc... 440 e-128 >At4g34350.1 putative protein / hypothetical protein, Synechocystis sp., PIR2:S76307; supported by cDNA: gi_14596178_gb_AY042877.1_ Length = 466 Score = 440 bits (1132), Expect(2) = e-128 Identities = 210/254 (82%), Positives = 231/254 (90%) Frame = +1 Query: 1 VKLAESYGFCWGVERAVQIAYEARKQFPTERIWITNEIIHNPTVNKRLEDMDVKNIPLEE 180 VKLA++YGFCWGVERAVQIAYEARKQFP ER+WITNEIIHNPTVNKRLEDMDVK IP+E+ Sbjct: 113 VKLAKAYGFCWGVERAVQIAYEARKQFPEERLWITNEIIHNPTVNKRLEDMDVKIIPVED 172 Query: 181 GKKNFDVVDKDDVVVLPAFGAAVDEMLVLSDKNVQIVDTTCPWVTKVWNTVEKHKKGEYT 360 KK FDVV+KDDVV+LPAFGA VDEM VL+DK VQIVDTTCPWVTKVWNTVEKHKKGEYT Sbjct: 173 SKKQFDVVEKDDVVILPAFGAGVDEMYVLNDKKVQIVDTTCPWVTKVWNTVEKHKKGEYT 232 Query: 361 SIIHGKYAHEETVATASFAGKYIIVKNMAEATYVCDYILGGKLDGSSSTKEAFMQKFKYA 540 S+IHGKY HEET+ATASFAGKYIIVKNM EA YVCDYILGG+ DGSSSTKE FM+KFKYA Sbjct: 233 SVIHGKYNHEETIATASFAGKYIIVKNMKEANYVCDYILGGQYDGSSSTKEEFMEKFKYA 292 Query: 541 VSEGFDPDVDLVKAGIANQTTMLKGETEDIGEVGREDHDAKYGVENVNNHFVSFNTICDA 720 +S+GFDPD DLVK GIANQTTMLKGETE+IG + KYGVENV+ HF+SFNTICDA Sbjct: 293 ISKGFDPDNDLVKVGIANQTTMLKGETEEIGRLLETTMMRKYGVENVSGHFISFNTICDA 352 Query: 721 TQERQDAMYKLVEQ 762 TQERQDA+Y+LVE+ Sbjct: 353 TQERQDAIYELVEE 366 Score = 35.8 bits (81), Expect(2) = e-128 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +3 Query: 762 KLDLMLVIGGWELSNTSH 815 K+DLMLV+GGW SNTSH Sbjct: 367 KIDLMLVVGGWNSSNTSH 384 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,441,368 Number of Sequences: 27288 Number of extensions: 461889 Number of successful extensions: 1560 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1549 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1529730356 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262298|gb|BM410668.1|BM410668 EST584995 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG54O9 5' end, mRNA sequence (779 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g41950.1 hypothetical protein / predicted by genfinder; su... 196 2e-50 >At2g41950.1 hypothetical protein / predicted by genfinder; supported by cDNA: gi_18491232 Length = 266 Score = 196 bits (497), Expect = 2e-50 Identities = 96/158 (60%), Positives = 124/158 (77%), Gaps = 1/158 (0%) Frame = +3 Query: 309 SNLKSCCSAIASSNDGTVSMINFEDVMEKDWSFLEHPD-SSAEHKQKIDEIISAGEITET 485 S ++ C + +S +GTVS+++F EKDWSFLE + S EH QKI+ II AGE++E+ Sbjct: 54 SRYRAFCVSSSSPPEGTVSVVDFH---EKDWSFLESMEIDSTEHTQKIERIIKAGELSES 110 Query: 486 SKVMIAISSDEFVDRVVESSICKQLLVVHDSLFMLACIKEKYDKVMCWQGEVIYIPEKWT 665 S+V+++ISS+ FVDR+VESS + LL+VHDSLF LACIKEKYDKV CWQGE+IY+PEKW+ Sbjct: 111 SRVLVSISSETFVDRLVESSPSQLLLIVHDSLFTLACIKEKYDKVKCWQGEMIYVPEKWS 170 Query: 666 PFDVVFLYFLPALPFELDQILDALRKWWSPGARVVISH 779 P D VFLYFLPALPF+LD++ L + S GARVVISH Sbjct: 171 PLDAVFLYFLPALPFDLDELFKTLSQRCSSGARVVISH 208 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,591,382 Number of Sequences: 27288 Number of extensions: 352666 Number of successful extensions: 1076 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1040 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1075 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1436884920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262290|gb|BM410660.1|BM410660 EST584987 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG54M13 5' end, mRNA sequence (769 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g70590.1 expressed protein / ; supported by cDNA: gi_14335... 270 5e-73 At1g18260.1 expressed protein / ; supported by cDNA: gi_14532... 60 2e-09 At1g73570.1 hypothetical protein / predicted by genemark.hmm 49 2e-06 >At1g70590.1 expressed protein / ; supported by cDNA: gi_14335049_gb_AY037204.1_ Length = 351 Score = 270 bits (691), Expect = 5e-73 Identities = 137/247 (55%), Positives = 179/247 (72%), Gaps = 2/247 (0%) Frame = +1 Query: 34 MNQKTWPATKSSSDGLRRFTAFPFIRKQTHLQNRPSENPFSDHSKKINTTTPPSSSNSCC 213 M Q+TWP S RF++ F++ P + IN T S+++S Sbjct: 1 MKQRTWPCRSEGS----RFSSLSFLK--------PHDKDKRSRISSINKATAKSTTSSRS 48 Query: 214 SSSSSSNQYCYNQ--DFSQLPYDIILKIAARFSLSNVRASSLVCRSWCEALRPLRESMVF 387 SSSSSS++ N+ DFS LPYDI++KIAA FS N++A+SLVC+SW +AL+PLRESM+ Sbjct: 49 SSSSSSSRPPSNEFGDFSMLPYDILMKIAAPFSHPNLQAASLVCKSWRDALKPLRESMLL 108 Query: 388 LRWGKRFKHGRGGVKRNLSKALDSFLKGAARGSTLAMVDAGLLYWELGKREEGISLYRKA 567 +RWGK++KHGRGGV+ NL KALDSFLKGA RGSTLAMVDAGL+YWE G++E+ ++LYR+A Sbjct: 109 IRWGKKYKHGRGGVRANLDKALDSFLKGAMRGSTLAMVDAGLVYWERGEKEKAVNLYRRA 168 Query: 568 AELGDPAGQCNLGISLLQVNPMDPKEAVKWLYKASVSGHVRAQYQLALTLHKGHGPKRNL 747 +ELGD GQCNLGI+ LQV P +PKEA+KWL +++ +G+VRAQYQLAL LH G + NL Sbjct: 169 SELGDAVGQCNLGIAYLQVQPSNPKEAMKWLKQSAENGYVRAQYQLALCLHHGRVVQTNL 228 Query: 748 QETAKWY 768 E KWY Sbjct: 229 LEATKWY 235 >At1g18260.1 expressed protein / ; supported by cDNA: gi_14532715_gb_AY039982.1_ Length = 678 Score = 59.7 bits (143), Expect = 2e-09 Identities = 44/128 (34%), Positives = 67/128 (51%), Gaps = 9/128 (7%) Frame = +1 Query: 412 HGRG-GVKRNLSKALDSFLKGAARGSTLAMVDAGLLY---WELGKRE--EGISLYRKAAE 573 + RG GV+RN +KAL+ A G A G LY + + K+ + + KA + Sbjct: 289 YARGAGVERNYTKALEWLTLAAKEGLYSAFNGIGYLYVKGYGVDKKNYTKAREYFEKAVD 348 Query: 574 LGDPAGQCNLGISLLQ---VNPMDPKEAVKWLYKASVSGHVRAQYQLALTLHKGHGPKRN 744 DP+G NLG+ L+ VN D ++A K+ + A+ +G +A YQLA H G G K+N Sbjct: 349 NEDPSGHYNLGVLYLKGIGVN-RDVRQATKYFFVAANAGQPKAFYQLAKMFHTGVGLKKN 407 Query: 745 LQETAKWY 768 L+ +Y Sbjct: 408 LEMATSFY 415 >At1g73570.1 hypothetical protein / predicted by genemark.hmm Length = 604 Score = 49.3 bits (116), Expect = 2e-06 Identities = 41/138 (29%), Positives = 65/138 (46%), Gaps = 7/138 (5%) Frame = +1 Query: 376 SMVFLRWGKRFKHGRGGVKRNLSKALDSFLKGAARGSTLAMVDAGLLY---WELGKRE-- 540 S+ + G + G G++R+ +KAL F K G G LY + + KR Sbjct: 243 SVAMHKIGLFYYFGLRGLRRDHAKALYWFSKAEFNG-------LGYLYVKGYGVDKRNYT 295 Query: 541 EGISLYRKAAELGDPAGQCNLGISLLQVNPM--DPKEAVKWLYKASVSGHVRAQYQLALT 714 + + AA DP+G NLG+ L+ + D + A K+ + A+ +G +A YQLA Sbjct: 296 KAREYFEMAANNEDPSGHYNLGVLYLKGTGVKKDVRHATKYFFVAANAGQPKAFYQLAKM 355 Query: 715 LHKGHGPKRNLQETAKWY 768 H G G +NL+ +Y Sbjct: 356 FHTGVGLTKNLEMATTFY 373 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.131 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,250,656 Number of Sequences: 27288 Number of extensions: 433481 Number of successful extensions: 1967 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 1726 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1891 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1401406280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262278|gb|BM410648.1|BM410648 EST584975 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG54K11 5' end, mRNA sequence (754 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39880.1 putative protein / ;supported by full-length cDN... 222 2e-58 >At4g39880.1 putative protein / ;supported by full-length cDNA: Ceres:20457. Length = 178 Score = 222 bits (565), Expect = 2e-58 Identities = 120/183 (65%), Positives = 143/183 (77%) Frame = +1 Query: 52 MGSRLGRRVVNFANLPIKLLMPSSFSNITEISLKTIPSASKIEIKRVLESLYGFEVEKVQ 231 MGSRLG RVV+FANLPIKLLMP+ +NI E +LKTIPSASKIEIKRVLESLYGF+VEKV Sbjct: 1 MGSRLGGRVVHFANLPIKLLMPAKLTNIHEFALKTIPSASKIEIKRVLESLYGFDVEKVN 60 Query: 232 TLNMDGKKKKRGGLLIAKPDYKKAYVTLRNPLSISPDLFPIGVIQEEKKNMSKKSKSSIV 411 TLNMDGKKKKRGGLLIAK DYKKAYVTLR+PLSIS DLFP+ I+E++K SK SS V Sbjct: 61 TLNMDGKKKKRGGLLIAKADYKKAYVTLRSPLSISRDLFPVKYIEEDRK--SKVKGSSFV 118 Query: 412 EDDEPKKTHWLDEKKDGRNRSEMRFGRGRDHRSGQRSDVGRDRGGESRDVGAAPAKFPWS 591 E+++ KK+HWLD K+ R +G+G+ R G+R++ RGG + A AKFPWS Sbjct: 119 EEEDDKKSHWLDRKE---KREIGGYGKGKGRRGGERAN-SPTRGGAA---AAGTAKFPWS 171 Query: 592 SMR 600 +MR Sbjct: 172 NMR 174 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,086,173 Number of Sequences: 27288 Number of extensions: 398526 Number of successful extensions: 1548 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1537 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1357057980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262263|gb|BM410633.1|BM410633 EST584960 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG54I1 5' end, mRNA sequence (774 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27990.1 putative protein / predicted proteins, Saccharomy... 134 7e-32 At3g22510.1 hypothetical protein / predicted by genscan+ 53 2e-07 >At5g27990.1 putative protein / predicted proteins, Saccharomyces cerevisiae and Schizosaccharomyces pombe;supported by full-length cDNA: Ceres:5109. Length = 184 Score = 134 bits (336), Expect = 7e-32 Identities = 76/196 (38%), Positives = 122/196 (61%), Gaps = 2/196 (1%) Frame = +3 Query: 84 LTAEAAAQLQEGIGLVLTRWTALQMAIENEWGGRDTREKSNQLNVDIFSAFTQSKEKVY- 260 LT EA L+EGIGL+L RWTA++ A+EN WGGRD++ K+N+ +F F QSK+ V Sbjct: 7 LTVEARDILKEGIGLILWRWTAMRAAVENGWGGRDSQAKANETVATVFDFFIQSKDPVKD 66 Query: 261 MDDIEEILDEFMISLNTEVNDGSLEEVAEKLMYMHEECLEGDFNSIKVLRETNVGRRPAT 440 ++ + ++LD+ + LNT DGS++EVA L+ ++E+C G++ ++ LR T + A+ Sbjct: 67 IEKLGDLLDKGLDELNTTAEDGSVDEVANLLVDLYEDCCNGNYEMLEELRAT-YSQTSAS 125 Query: 441 YVRQDASDDDDSSNDGDDRNENFGNNSSDMAID-SMESQPSLGQDMIVEPVRKQPAEVDP 617 V+ DD++S ++ DD+ ++DM +D S + Q ++ D EPV Sbjct: 126 VVKVSNGDDEESDDEDDDQ-------TTDMMVDASNQKQEAMPVD---EPVA-------D 168 Query: 618 DGWTTVSTKRNKGRRN 665 DGWT VS+++NKG+RN Sbjct: 169 DGWTVVSSRKNKGKRN 184 >At3g22510.1 hypothetical protein / predicted by genscan+ Length = 85 Score = 52.8 bits (125), Expect = 2e-07 Identities = 22/51 (43%), Positives = 35/51 (68%) Frame = +3 Query: 108 LQEGIGLVLTRWTALQMAIENEWGGRDTREKSNQLNVDIFSAFTQSKEKVY 260 LQ IG +L+RW LQMA++N+WGG D+ +KS +L ++F +QS ++ Sbjct: 31 LQRDIGELLSRWGGLQMAVKNQWGGHDSLKKSQELAHNLFHLISQSNGSIF 81 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,367,544 Number of Sequences: 27288 Number of extensions: 422863 Number of successful extensions: 2273 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2026 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262212|gb|BM410582.1|BM410582 EST584909 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG53J16 5' end, mRNA sequence (579 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48240.1 unknown protein / 180 4e-46 >At5g48240.1 unknown protein / Length = 339 Score = 180 bits (457), Expect = 4e-46 Identities = 94/169 (55%), Positives = 112/169 (65%), Gaps = 24/169 (14%) Frame = +3 Query: 3 KVKGEAKKEKHLIREKGHEKPANFLDTYEKSLIAVATKGVVKLFNAVNKAQHAQKGLNPS 182 K KG+A+K KHLI EKGH KP ++LD++EK LI VATKGVVKLFNAVNKAQHAQKGLNPS Sbjct: 171 KAKGQARKAKHLIAEKGHVKPGSYLDSHEKILIGVATKGVVKLFNAVNKAQHAQKGLNPS 230 Query: 183 RAKDEKVIKKRRREVFFSELGKAPSQT------------------------TVSKAGASN 290 R+KD KV+KKRR+E F SELGK + T + S A A++ Sbjct: 231 RSKDAKVLKKRRKEAFLSELGKTKTDTKPSTLDEHRSKLVFCLELASIEKGSPSVARAAH 290 Query: 291 SLEDEGPAWAPLRDTYMLTNPKLKDWDKNPDTTVDDDVRMPADSDSSDD 437 EDE P WAPLRD YML NPKLKDWDK +T+ DD + +S +D Sbjct: 291 KSEDEAPVWAPLRDNYMLANPKLKDWDKKQETSEGDDFAGLSGDESYED 339 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,365,390 Number of Sequences: 27288 Number of extensions: 266397 Number of successful extensions: 886 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 880 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 877249352 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262204|gb|BM410574.1|BM410574 EST584901 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG53H10 5' end, mRNA sequence (589 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77230.1 unknown protein / 107 3e-24 >At1g77230.1 unknown protein / Length = 237 Score = 107 bits (268), Expect = 3e-24 Identities = 66/138 (47%), Positives = 82/138 (58%), Gaps = 21/138 (15%) Frame = +2 Query: 26 MKMTWKNQSKKNPNKRPISQLQNLPFDPTEDST---------FPEEKLAKTE-----EIS 163 MK+TW KNP KR L N P P E F E+ + + + + S Sbjct: 1 MKLTWN----KNPKKRSRLVLSNFPDLPFEKDDSLESQSHLHFREDDIDRRQTTDQLDSS 56 Query: 164 HVNG-------DEDTIKLVESFQQQGNKLAEEGKYREALGKWESALLLMPDRAILHEQKA 322 V G D + KL ES + QG+K AEEGKY+EALGKWE+AL L+P+ AILHEQKA Sbjct: 57 EVGGNHPRENFDVEAKKLAESIRAQGDKFAEEGKYQEALGKWEAALNLVPEDAILHEQKA 116 Query: 323 QILLELGETWKALQAATR 376 Q+LLELG+ WKAL+AATR Sbjct: 117 QVLLELGDAWKALKAATR 134 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,797,020 Number of Sequences: 27288 Number of extensions: 282949 Number of successful extensions: 2199 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2016 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 904103924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18262032|gb|BM410402.1|BM410402 EST584729 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG52L24 5' end, mRNA sequence (647 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g57630.1 putative protein / DOC4, Mus musculus, AF059485 338 1e-93 >At3g57630.1 putative protein / DOC4, Mus musculus, AF059485 Length = 736 Score = 338 bits (867), Expect = 1e-93 Identities = 153/214 (71%), Positives = 177/214 (82%) Frame = +1 Query: 4 LSMQEHIHGGLRSSLTLDFYKKAYDHIITKYPYWSRSAGKDHIWFFSWDEGACYAPKEIW 183 ++MQ H GLRSSLTL+FYK+AY+HI+ KYPYW+RSAG+DHIW IW Sbjct: 426 INMQNHT--GLRSSLTLEFYKRAYEHIVEKYPYWNRSAGRDHIW--------------IW 469 Query: 184 NSIMLVHWGNTNSKHNHSTTAYWGDNWDPISSDRRGNHTCFDPDKDLVLPAWKRPDESSL 363 NS+MLVHWGNTNSKHNHSTTAY+GDNWD IS +RRG+H CFDP KDLV+PAWK PD S+ Sbjct: 470 NSMMLVHWGNTNSKHNHSTTAYFGDNWDDISDERRGDHPCFDPRKDLVIPAWKVPDPYSM 529 Query: 364 SAKHWSRPREERKTFFYFNGNLGPAYENGRPEDTYSMGIRQKVAEEFGSTLNKEGKLGKQ 543 +W RPRE+RKT FYFNGNLGPAYE GRPED+YSMGIRQK+AEEFGS+ NKEGKLGKQ Sbjct: 530 RKNYWERPREKRKTLFYFNGNLGPAYEKGRPEDSYSMGIRQKLAEEFGSSPNKEGKLGKQ 589 Query: 544 HAEDVIVTPLRAGNYHDELASSVFCGVMPGDGWS 645 HAEDVIVTPLR+ NYH ++A+S+FCG PGDGWS Sbjct: 590 HAEDVIVTPLRSDNYHKDIANSIFCGAFPGDGWS 623 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.135 0.452 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,970,726 Number of Sequences: 27288 Number of extensions: 377866 Number of successful extensions: 1104 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1071 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1103 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1070908320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18261766|gb|BM410136.1|BM410136 EST584463 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG51H23 5' end, mRNA sequence (546 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g56730.1 zinc protease PQQL-like protein / 244 2e-65 >At5g56730.1 zinc protease PQQL-like protein / Length = 956 Score = 244 bits (623), Expect = 2e-65 Identities = 120/181 (66%), Positives = 143/181 (78%), Gaps = 1/181 (0%) Frame = +2 Query: 2 FLGGNKPSRVGNIRGDISINFSCDPDISSTLVDLALEEILHLQEEGPSIEDAMAVLEIEQ 181 FLGGNKPSR ++RGDIS+NFSCDP+ISS LVDLALEEI+ LQ+EGPS ED A+LEIEQ Sbjct: 775 FLGGNKPSRTADLRGDISVNFSCDPEISSKLVDLALEEIVRLQKEGPSQEDISAILEIEQ 834 Query: 182 RAHENGLQENYYWLDRILRSYQSRIYSGDIGNSFKIQEAARSKVRSILTPLTAQLALQKL 361 RAHENG+QENYYWLDRI+R YQSR+Y+GD+G S KI E R ++R L P TAQ ALQ++ Sbjct: 835 RAHENGMQENYYWLDRIIRGYQSRVYAGDLGASCKILEEGRLRMRESLAPQTAQAALQRI 894 Query: 362 LPFPCKKQYTVVILMPQASRIKRLKSLMQSVPKS-YSRDAKILAGIAGVTILSLSLWKYS 538 LP PCKKQYT VILMPQ SR L S+ S + Y RD KILAGIAG+ ++ +W+YS Sbjct: 895 LPHPCKKQYTAVILMPQRSRFGFLSSIFSSRSEGPYIRDTKILAGIAGLGVVVFGIWRYS 954 Query: 539 R 541 R Sbjct: 955 R 955 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,989,650 Number of Sequences: 27288 Number of extensions: 241123 Number of successful extensions: 703 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 702 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 790135456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18261565|gb|BM409935.1|BM409935 EST584262 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG50F6 5' end, mRNA sequence (651 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g02715.1 unknown protein / predicted by genemarkHMM 132 2e-31 >At4g02715.1 unknown protein / predicted by genemarkHMM Length = 205 Score = 132 bits (332), Expect = 2e-31 Identities = 85/199 (42%), Positives = 109/199 (54%), Gaps = 4/199 (2%) Frame = +1 Query: 1 GQAPIRFGSFGSPPSVGFKEINCRNFESSAGILPTPLKAYSTPVTKKGYSSSFRSKTPSP 180 G+ + F S PS F++INCR F+S G+LP P + STP+TK S + ++P Sbjct: 16 GKKSLGHDRFRSAPSKTFRQINCRTFQSGVGLLPRPKRTSSTPLTKGALS---QVQSPRS 72 Query: 181 PSSIQGKSHSEGQKKSKKSVHSSAVSIPIDIKGGGDSRKEGS----LNDEFAYSELWAGP 348 P S+ H + S IPI G R+ S +YSELWAGP Sbjct: 73 PKSVLPVFHHPSVDSGRTS------PIPIANCRGSQIRRCSSEFVDKRRSLSYSELWAGP 126 Query: 349 AYSNSPPPSSLPIPKFSVKPKRTVSLDLPTTSPFGIDLPSFAKSAPASPTRERSPSPGVL 528 YSNSPPP+S+PIPKFS++ KRTVSL P +D+ AKSAP SPT +P Sbjct: 127 TYSNSPPPASVPIPKFSLQQKRTVSLTFPAPDS-AVDIREVAKSAPVSPT-SSGDNP--- 181 Query: 529 SDSTDSATQTLRRILNLEI 585 ST SAT TLRR+LNLE+ Sbjct: 182 FRSTVSATMTLRRMLNLEL 200 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.315 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,591,359 Number of Sequences: 27288 Number of extensions: 383859 Number of successful extensions: 1524 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1405 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1079832556 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18261531|gb|BM409901.1|BM409901 EST584228 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG50J13 5' end, mRNA sequence (607 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g25770.1 putative protein / predicted protein, Oryza sativa 292 8e-80 >At5g25770.1 putative protein / predicted protein, Oryza sativa Length = 318 Score = 292 bits (748), Expect = 8e-80 Identities = 139/215 (64%), Positives = 168/215 (77%), Gaps = 23/215 (10%) Frame = +1 Query: 31 RGYIAVAIDSRYHGERATSITTYRESLVSSWKNGDTMPFIFDSVWDLIKLVDYLTEREDV 210 RGY+A+ +DSRYHGERA T YR++L+SSW+NG+TMPFIFD+VWDLIKL +YLT+R+D+ Sbjct: 60 RGYVAIGLDSRYHGERADCKTAYRDALISSWRNGNTMPFIFDTVWDLIKLAEYLTQRDDI 119 Query: 211 DPSKIGITGESLGGMHAWFAAFVDTRYSVVVPIIGVQ----------------------- 321 DP KIGITG SLGGMHAWFAA DTRYSVVVP+IGVQ Sbjct: 120 DPKKIGITGISLGGMHAWFAAAADTRYSVVVPLIGVQVLNKIAATMRPILPCMSEYEDGF 179 Query: 322 GFGWAIEHDKWQARVNSIKAIFEEASADLDKSAIDKEVVQKVWDRIAPGLASQFDAPYTV 501 GF WAIE+D+W+ARVNSIK +FEEA DL K+ IDKE+V+KVW+RIAPGLAS+FD+PY++ Sbjct: 180 GFRWAIENDEWEARVNSIKPLFEEARIDLGKNIIDKELVEKVWNRIAPGLASKFDSPYSL 239 Query: 502 PTIAPRPLLIFNGADDPRCPLGGLEIPESRTLEAY 606 P IAPRPL I NGA+DPRCPLGGLE+ R +AY Sbjct: 240 PVIAPRPLYILNGANDPRCPLGGLELALKRAEKAY 274 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,028,470 Number of Sequences: 27288 Number of extensions: 318341 Number of successful extensions: 930 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 927 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 957813068 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18261410|gb|BM409780.1|BM409780 EST584107 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG50G11 5' end, mRNA sequence (572 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g22530.1 unknown protein / 166 8e-42 >At2g22530.1 unknown protein / Length = 897 Score = 166 bits (420), Expect = 8e-42 Identities = 89/159 (55%), Positives = 114/159 (70%), Gaps = 2/159 (1%) Frame = +3 Query: 9 DSAYVIGLSYVYYWSLLQLLLQQPVNSMPVLFLFLQVLASIWFSSGSNQHRRQWVEVAAL 188 D Y+IG +Y+ W LLQ LLQQP+NS P+L L LQ+LA + SS Q +WVE+ AL Sbjct: 717 DCLYLIGSAYILCWCLLQQLLQQPINSGPILLLLLQILAILCLSSSDFQVN-EWVEITAL 775 Query: 189 YYMGMAGHFGLGNTNTLATIDVAGAFIGVLNHSTVLSGVLMFIITYASPMLYLLSMVMY- 365 YYMGMAGHF LGN+NTLATIDVAGAFIG+ +HST+LSG+LMF+ITYASPML+LLS+VMY Sbjct: 776 YYMGMAGHFALGNSNTLATIDVAGAFIGISSHSTILSGILMFMITYASPMLFLLSLVMYI 835 Query: 366 -NSVKDTSSSIISEKGNIGSLLKRTLGFPCLVPLGLNSI 479 ++++ S+S IS K + PC LN++ Sbjct: 836 GANLRNHSNSTISTH---RETTKARVPLPCSALHQLNTL 871 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,342,715 Number of Sequences: 27288 Number of extensions: 303593 Number of successful extensions: 756 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 859346304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260912|gb|BM409282.1|BM409282 EST583609 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG47L20 5' end, mRNA sequence (712 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67325.1 similar to RRM-containing RNA-binding protein, putat... 239 2e-98 >At1g67325.1 similar to RRM-containing RNA-binding protein, putative / temporary automated functional assignment Length = 288 Score = 239 bits (611), Expect(2) = 2e-98 Identities = 109/150 (72%), Positives = 122/150 (80%), Gaps = 2/150 (1%) Frame = +2 Query: 17 MSQVDNRNSSAAKRARTDGGRREDDWTCPSCGNVNFSFRTTCNMRNCTQSRPADHNSKSA 196 MSQVDNRNSSAAKRARTDGGRREDDW CPSCGNVNFSFRTTCNMRNCTQ RPADHN KSA Sbjct: 1 MSQVDNRNSSAAKRARTDGGRREDDWICPSCGNVNFSFRTTCNMRNCTQPRPADHNGKSA 60 Query: 197 VRPMHAPQSYSPSAAYVGSGAPSSMYMGVAPYGGSLFNGPSMPAYDVPFAGGSAYHYNFG 376 +PM Q +S AY+GSG P +YMG +PYG LFNG SMP YDVPF+GGS YH+N+ Sbjct: 61 PKPMQHQQGFSSPGAYLGSGGPPPVYMGGSPYGSPLFNGSSMPPYDVPFSGGSPYHFNYN 120 Query: 377 SRLSGGSPYRPVHLSAPPPYTGG--MGNGG 460 SR+ G+ YRP+H+S PPPY GG MG+GG Sbjct: 121 SRMPAGAHYRPLHMSGPPPYHGGSMMGSGG 150 Score = 137 bits (345), Expect(2) = 2e-98 Identities = 60/78 (76%), Positives = 66/78 (83%), Gaps = 3/78 (3%) Frame = +3 Query: 459 GMYGVPPLMDRYGVALPMAP---AAMAPRPGFYPDDNSQKKDGTRDNDWTCPKCGNVNFS 629 GMYG+PP +DRYG+ + M P AAM PRP FYPD+ SQK+D TRDNDWTCP CGNVNFS Sbjct: 150 GMYGMPPPIDRYGLGMAMGPGSAAAMMPRPRFYPDEKSQKRDSTRDNDWTCPNCGNVNFS 209 Query: 630 FRTVCNMRKCNTPKPGSQ 683 FRTVCNMRKCNTPKPGSQ Sbjct: 210 FRTVCNMRKCNTPKPGSQ 227 Score = 67.4 bits (163), Expect = 7e-12 Identities = 27/47 (57%), Positives = 32/47 (67%), Gaps = 4/47 (8%) Frame = +3 Query: 576 GTRDNDWTCPKCGNVNFSFRTVCNMRKCNTPKP----GSQVPKPREN 704 G R++DW CP CGNVNFSFRT CNMR C P+P G PKP ++ Sbjct: 20 GRREDDWICPSCGNVNFSFRTTCNMRNCTQPRPADHNGKSAPKPMQH 66 Score = 62.4 bits (150), Expect = 2e-10 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 2/49 (4%) Frame = +2 Query: 80 REDDWTCPSCGNVNFSFRTTCNMRNCTQSRPADH--NSKSAVRPMHAPQ 220 R++DWTCP+CGNVNFSFRT CNMR C +P S + +AP+ Sbjct: 194 RDNDWTCPNCGNVNFSFRTVCNMRKCNTPKPGSQQGGSSDKISKQNAPE 242 Score = 49.7 bits (117), Expect = 2e-06 Identities = 19/46 (41%), Positives = 28/46 (60%) Frame = +2 Query: 83 EDDWTCPSCGNVNFSFRTTCNMRNCTQSRPADHNSKSAVRPMHAPQ 220 E W C +CGN+N+ FR+ CN +NC +P D ++ S P AP+ Sbjct: 242 EGSWKCDNCGNINYPFRSKCNRQNCGADKPGDRSNGS---PSRAPE 284 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,949,451 Number of Sequences: 27288 Number of extensions: 526047 Number of successful extensions: 1906 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1893 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1245572720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260838|gb|BM409208.1|BM409208 EST583535 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG47J21 5' end, mRNA sequence (747 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03800.1 unknown protein / 317 4e-87 >At2g03800.1 unknown protein / Length = 361 Score = 317 bits (812), Expect = 4e-87 Identities = 145/210 (69%), Positives = 165/210 (78%) Frame = +1 Query: 1 PQGGKPGWAAPPNPRMGPWMILLNKIAESHNLIPEFEITFEATHHGPVTTKPTMFIEIGS 180 PQGGKPGWAA P+ R+GPW LL K+AE+H L+PEFEIT EATHHGP+T KPTMF+EIGS Sbjct: 151 PQGGKPGWAALPSTRIGPWFRLLKKMAEAHGLVPEFEITLEATHHGPITNKPTMFLEIGS 210 Query: 181 TEEYWKRPDAAQVVALLVWEGLGLGGGPPVGNWSSTSANNKVLLGIGGGHYVPRHTDVIK 360 TEEYWKR DAAQV+ALL+WEGLGLGG VG W S + KVLLGIGGGHY PRH D+ Sbjct: 211 TEEYWKRQDAAQVMALLMWEGLGLGGSEEVGKWKSETGKRKVLLGIGGGHYAPRHMDIAL 270 Query: 361 KDGCWVGQLLSGYSLPMEDPGPSKGKVNAHDIAGTWKHSIRAAYDATKAGFPGGEILAHL 540 KD WVG LLSGYSLPMEDP +K + I G W+ SI+AA++ATKA FPGGEILAHL Sbjct: 271 KDDIWVGHLLSGYSLPMEDPTQTKTTPGENYIGGNWRQSIKAAFEATKASFPGGEILAHL 330 Query: 541 DQKSFKSWQKNAIIEFLGAQNIKIGKPGDF 630 D KSFK WQK AI EFL ++I +GKP DF Sbjct: 331 DHKSFKGWQKKAITEFLAEESINVGKPNDF 360 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,336,316 Number of Sequences: 27288 Number of extensions: 463224 Number of successful extensions: 1466 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1452 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260582|gb|BM408952.1|BM408952 EST583279 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG46J15 5' end, mRNA sequence (773 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g14835.1 Expressed protein / ; supported by full-length cD... 276 1e-74 >At2g14835.1 Expressed protein / ; supported by full-length cDNA: Ceres: 40603. Length = 343 Score = 276 bits (705), Expect = 1e-74 Identities = 143/235 (60%), Positives = 162/235 (68%), Gaps = 7/235 (2%) Frame = +3 Query: 84 MVVCKCKKATKLYCFVHKIAVCGECICFPEHQICVIRAYSEWVIDGEYDWPPKCCYCKSE 263 MVVCKCKKAT+LYCFVHK VCGECICFPEHQ CV+R YSEWVIDGEYD PKCC C++ Sbjct: 1 MVVCKCKKATRLYCFVHKAPVCGECICFPEHQTCVVRTYSEWVIDGEYD-QPKCCQCQAT 59 Query: 264 LEEGTDAGITRLGCLHTIHTSCLVSHLKSFPPHTAPAGYVCPIPECSTSIWPPKSVKESG 443 +EG +TRLGCLH IHTSCLVS +KSFPPHTAPAGYVC P CST IWPP VK++G Sbjct: 60 FDEGAGHQVTRLGCLHAIHTSCLVSLIKSFPPHTAPAGYVC--PACSTPIWPPMMVKDAG 117 Query: 444 SRFHTKLKEAIMQTGLEKKLFGNHPVTLPGTEPRGPPPAFASDPLKHIST------GGKD 605 SR H L+E I QTGLEK L GNHPV+ TE R PPPAFASD L +IS+ G Sbjct: 118 SRLHALLREVITQTGLEKNLLGNHPVS-RSTESRSPPPAFASDALINISSSSHTQEGNNL 176 Query: 606 SEGLAAIATGS-SKPASLDIVEIDGSTSAPSSMSNHETNFMKSTSPSGPGAPPRR 767 +G + G SK A +IVEID SA S +MKS+SP A R+ Sbjct: 177 PDGYSVAGNGEYSKSAVSEIVEIDVPASAGS--------YMKSSSPGLAAAAARK 223 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,407,497 Number of Sequences: 27288 Number of extensions: 467593 Number of successful extensions: 1530 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1520 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260529|gb|BM408899.1|BM408899 EST583226 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG46M5 5' end, mRNA sequence (238 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39450.1 hypothetical protein / 102 4e-23 >At4g39450.1 hypothetical protein / Length = 1553 Score = 102 bits (254), Expect = 4e-23 Identities = 49/78 (62%), Positives = 64/78 (81%) Frame = +2 Query: 5 DAFAMVYSRFDMKNETASLLESRAHQSCKEWSLHSDKDQTDELLASMGYFIEAAEVYSSI 184 DAFAMVY FDMK+ETA+LLE+RA Q+ ++W L DKDQ ++LL SM Y+IEAAEV++SI Sbjct: 1300 DAFAMVYKHFDMKHETATLLEARADQAAQQWFLRYDKDQNEDLLDSMRYYIEAAEVHTSI 1359 Query: 185 DAGSKTRQSCAQALLLYL 238 DAG+K R++C QA L+ L Sbjct: 1360 DAGNKARKACGQASLVSL 1377 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,600,758 Number of Sequences: 27288 Number of extensions: 102558 Number of successful extensions: 342 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 335 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 342 length of database: 11,516,596 effective HSP length: 54 effective length of database: 10,043,044 effective search space used: 241033056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260285|gb|BM408655.1|BM408655 EST582982 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG45G18 5' end, mRNA sequence (714 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g10380.1 expressed protein / ; supported by cDNA: gi_16604... 308 1e-85 >At3g10380.1 expressed protein / ; supported by cDNA: gi_16604636_gb_AY059763.1_ Length = 1053 Score = 308 bits (790), Expect(2) = 1e-85 Identities = 156/221 (70%), Positives = 180/221 (80%), Gaps = 1/221 (0%) Frame = +3 Query: 18 QAAQAAITGLHYLKGQLESFQSSKQKHQNGIYLA-VLLAVSPVSPVMAPTGTAQAAAKEL 194 Q ++ GLH +KGQ E+++ SK+K QNGI + LAVSPVSP+MAP G AQAAAKEL Sbjct: 390 QGDRSVAAGLHLIKGQSEAYRLSKEKPQNGISNSGTHLAVSPVSPLMAPGGKAQAAAKEL 449 Query: 195 LDSTLDAVVHIFENHVIVGELLESKCSQQIDLNTPKSMPTDISWNPDSDASHATGGYNIG 374 LDS LD +V IFENHV++GELLE K SQ D+NTP+S+PTD++WN +S+AS ATGGY I Sbjct: 450 LDSILDTIVKIFENHVVIGELLEMKASQH-DINTPRSLPTDVNWNTESEASQATGGYTIS 508 Query: 375 FSLTVLQSECQQLICEILRATPEAASADAAVQTARLASKAPSKEKRDGSEDGLTFAFRFT 554 F LTVLQSECQQLICEILRATPEAASADAA QTA+LA KAP K+KRD EDGLTF FRFT Sbjct: 509 FPLTVLQSECQQLICEILRATPEAASADAAAQTAKLAKKAPKKDKRDAPEDGLTFTFRFT 568 Query: 555 DATVSISNQGVDLIRQGWGKRGSNVLQEGYGTSTILPEQGI 677 DATVSISNQG DLIRQGWGKR N EGYG++ +LPEQGI Sbjct: 569 DATVSISNQGADLIRQGWGKRAPNASLEGYGSAAVLPEQGI 609 Score = 25.8 bits (55), Expect(2) = 1e-85 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 671 GNYLAASIYRPGLQ 712 G YLAASIYRP LQ Sbjct: 608 GIYLAASIYRPVLQ 621 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,586,991 Number of Sequences: 27288 Number of extensions: 335805 Number of successful extensions: 925 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 895 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 923 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1254469668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260284|gb|BM408654.1|BM408654 EST582981 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG45G12 3' end, mRNA sequence (755 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g44575.1 photosystem II 22kDa protein, putative / similar ... 347 4e-96 >At1g44575.1 photosystem II 22kDa protein, putative / similar to photosystem II 22kDa protein GI:21306 from [Spinacia oleracea]; supported by cDNA: gi_15294225_gb_AF410304.1_AF410304 Length = 265 Score = 347 bits (890), Expect = 4e-96 Identities = 179/208 (86%), Positives = 189/208 (90%), Gaps = 3/208 (1%) Frame = -3 Query: 693 KGAPPK---EKQKVEDGIFGTSGGIGFTKQNELFVGRVAMIGFAASLLGEAITGKGILAQ 523 K AP K K KVEDGIFGTSGGIGFTK NELFVGRVAMIGFAASLLGEA+TGKGILAQ Sbjct: 59 KAAPKKVEKPKSKVEDGIFGTSGGIGFTKANELFVGRVAMIGFAASLLGEALTGKGILAQ 118 Query: 522 LNLETGIPIYEAEPLLLFFILFNLLGAIGALGDRGKFVDDPTPPTGLEKAVIPPGKSFKS 343 LNLETGIPIYEAEPLLLFFILF LLGAIGALGDRGKFVDDP PTGLEKAVIPPGK+ +S Sbjct: 119 LNLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGKFVDDP--PTGLEKAVIPPGKNVRS 176 Query: 342 ALGLSEGGPLFGFTKANELFVGRLAQLGIAFSIIGEIITGKGALAQLNFETGVPINEIEP 163 ALGL E GPLFGFTKANELFVGRLAQLGIAFS+IGEIITGKGALAQLN ETG+PI +IEP Sbjct: 177 ALGLKEQGPLFGFTKANELFVGRLAQLGIAFSLIGEIITGKGALAQLNIETGIPIQDIEP 236 Query: 162 LLLFNIAFFFFAAINPGTGKFITDEEED 79 L+L N+AFFFFAAINPG GKFITD+ E+ Sbjct: 237 LVLLNVAFFFFAAINPGNGKFITDDGEE 264 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,031,830 Number of Sequences: 27288 Number of extensions: 440207 Number of successful extensions: 1479 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1470 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260239|gb|BM408609.1|BM408609 EST582936 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG45O9 5' end, mRNA sequence (711 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41190.1 unknown protein / 273 7e-74 >At5g41190.1 unknown protein / Length = 602 Score = 273 bits (698), Expect = 7e-74 Identities = 143/239 (59%), Positives = 180/239 (74%), Gaps = 2/239 (0%) Frame = +1 Query: 1 VDANAIIQGGDKLNHSADRFVTVPEVLAEIRDRNSRHSLNLLPFTIDTTEPSPDSLKKVI 180 VDANAII+G L + AD+FVTVPEVL+EIRD SR L +PFTIDT EPSP+SL KVI Sbjct: 49 VDANAIIEGRQSLTNFADKFVTVPEVLSEIRDPASRRRLAFIPFTIDTMEPSPESLSKVI 108 Query: 181 SFARSTGDLHTLSDVDLKLIALTYTLHAQFHGTQQLRDCPPAIHMINVKRLPEKDLPGWG 360 FAR+TGDL +LSDVDLKLIAL+YTL AQ +GT+ LRD PP I + VKRLPEKDLPGWG Sbjct: 109 KFARATGDLQSLSDVDLKLIALSYTLEAQVYGTKNLRDVPPPIQTVRVKRLPEKDLPGWG 168 Query: 361 ANISNPEEWEAIEHALDEGADTTSRILPLKDLSLNVIPLDQQSGRDGSVVNGGDSHSENQ 540 +N++N EEWEA+E+ +E ++ S+ILPLKDL++N+I D S GSVV+ ++H E Sbjct: 169 SNVANLEEWEALENETEEKSNANSKILPLKDLNMNIIASDNVS-EVGSVVSHTENHEE-- 225 Query: 541 MDFDDGFSKPQKYLPQKKEVKIDGKEMVADGIDASQGQYDDHGD--DGATAVSRSTHRR 711 D +G K ++Y P+K E+K++GK MV +G+DASQGQYDD D D AVSRSTH + Sbjct: 226 -DVQEGGKKHRRYPPKKTEIKLEGK-MVVEGVDASQGQYDDDDDASDWRPAVSRSTHSK 282 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.314 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,736,194 Number of Sequences: 27288 Number of extensions: 358065 Number of successful extensions: 1121 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 982 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1088 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1245572720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260201|gb|BM408571.1|BM408571 EST582898 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG45G13 5' end, mRNA sequence (722 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g34380.1 DNA polymerase type I, putative / similar to GI:4... 204 4e-53 >At1g34380.1 DNA polymerase type I, putative / similar to GI:4090935 from [Rhodothermus sp. 'ITI 518'] Length = 343 Score = 204 bits (519), Expect = 4e-53 Identities = 94/128 (73%), Positives = 114/128 (88%) Frame = +2 Query: 2 WSFYTLKHYVAQYNCDPRSDLSLRCILGDEVDGVPGIQHVVPGFGRKTALKLLKKHGTLE 181 WSFYTLKHY AQYNCDP+SDLS RCI+GDEVDGVPGIQH+VP FGRKTA+KL++KHG+LE Sbjct: 214 WSFYTLKHYHAQYNCDPQSDLSFRCIMGDEVDGVPGIQHMVPAFGRKTAMKLVRKHGSLE 273 Query: 182 NLLNAASVRSVGRQYAQDALIKYADYLRRNYEVLSLKRDVSIHIEEQWLNERDARNDSLV 361 +LL+AA+VR+VGR YAQ+AL KYADYLRRNY+VL+L RDV + I+ +WL ERD NDS V Sbjct: 274 SLLSAAAVRTVGRPYAQEALTKYADYLRRNYQVLALNRDVRVQIQNEWLMERDTSNDSEV 333 Query: 362 LSNFVTSL 385 LS+F ++L Sbjct: 334 LSSFFSTL 341 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,883,079 Number of Sequences: 27288 Number of extensions: 311897 Number of successful extensions: 976 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 976 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1268361380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260183|gb|BM408553.1|BM408553 EST582880 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG45C21 5' end, mRNA sequence (823 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g10860.1 putative protein / 110K5.11, unknown protein, Sor... 301 3e-82 At5g63490.1 putative protein / strong similarity to unknown p... 60 1e-09 At2g36500.1 hypothetical protein / predicted by genscan 57 9e-09 At3g52950.1 putative protein / predicted protein, Arabidopsis... 57 1e-08 At5g50640.1 putative protein / strong similarity to unknown p... 56 3e-08 At5g50530.1 putative protein / strong similarity to unknown p... 56 3e-08 >At5g10860.1 putative protein / 110K5.11, unknown protein, Sorghum bicolor, EMBL:AF124045; supported by cDNA: gi_13605727_gb_AF361845.1_AF361845 Length = 206 Score = 301 bits (771), Expect = 3e-82 Identities = 155/204 (75%), Positives = 176/204 (85%), Gaps = 2/204 (0%) Frame = +1 Query: 1 GGLKQMLSHGSVLKSAVLRHVRLGSGWRQ--LMFVRQETTLTARIEEHGFESTKISDILK 174 G ++ +S G+V+K +VL+H+R+ + Q + R E+T AR+EE GFEST ISD++K Sbjct: 3 GVIRSFVSGGNVVKGSVLQHLRVINPAIQPSVFCSRSESTQPARMEESGFESTTISDVMK 62 Query: 175 GKGKGADGSWLWCTTDDTVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIV 354 KGK ADGSWLWCTTDDTVYDAVKSMT HNVGALVVVK GE +++AGIITERDYLRKIIV Sbjct: 63 SKGKSADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQQALAGIITERDYLRKIIV 122 Query: 355 QGRSSKSTKVGDIMTEENKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTGMIGMVSIGD 534 QGRSSKSTKVGDIMTEENKLITVTPETKVL+AMQLMTDNRIRHIPVI GMIGMVSIGD Sbjct: 123 QGRSSKSTKVGDIMTEENKLITVTPETKVLRAMQLMTDNRIRHIPVIKDKGMIGMVSIGD 182 Query: 535 VVRAVVGEHREELKRLNAFIQGGY 606 VVRAVV EHREEL+RLNA+IQGGY Sbjct: 183 VVRAVVHEHREELQRLNAYIQGGY 206 >At5g63490.1 putative protein / strong similarity to unknown protein (emb|CAB86899.1) Length = 543 Score = 60.1 bits (144), Expect = 1e-09 Identities = 36/128 (28%), Positives = 67/128 (52%), Gaps = 3/128 (2%) Frame = +1 Query: 226 TVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDIMTEE 405 T+Y+A K M V AL++ S N+ + GI+T++D ++I Q + + T V +MT+ Sbjct: 71 TIYEACKRMASRRVDALLLTDS--NEMLCGILTDKDIATRVISQELNVEETPVSKVMTKN 128 Query: 406 NKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTGMIGMVSIGDVVRAVVGEHR---EELK 576 V ET ++A+Q M + RH+PV++ +I ++ I + + E+ K Sbjct: 129 PMF--VLSETLAVEALQKMVQGKFRHLPVVENGEVIALLDIAKCLYDAIARMERAAEKGK 186 Query: 577 RLNAFIQG 600 + A ++G Sbjct: 187 AIAAAVEG 194 >At2g36500.1 hypothetical protein / predicted by genscan Length = 536 Score = 57.4 bits (137), Expect = 9e-09 Identities = 30/101 (29%), Positives = 58/101 (56%) Frame = +1 Query: 226 TVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDIMTEE 405 TV+DA + M V A+++ S + ++GI+T++D ++I +G + T V +MT Sbjct: 78 TVFDACRRMAARRVDAVLLTDS--SALLSGIVTDKDIATRVIAEGLRPEHTLVSKVMTRN 135 Query: 406 NKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTGMIGMVSI 528 I VT ++ ++A+Q M + RH+PV++ +I ++ I Sbjct: 136 P--IFVTSDSLAIEALQKMVQGKFRHLPVVENGEVIALLDI 174 Score = 52.8 bits (125), Expect = 2e-07 Identities = 29/98 (29%), Positives = 52/98 (52%) Frame = +1 Query: 214 TTDDTVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDI 393 + D V+ A K M V ++++ + I GI+T +D L +++ Q S + T V + Sbjct: 238 SASDPVFVASKKMRDLRVNSVIIAVGNK---IHGILTSKDILMRVVAQNLSPELTLVEKV 294 Query: 394 MTEENKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTG 507 MT + ++ ET +L A+ +M D + H+PV D+ G Sbjct: 295 MTPNPECASI--ETTILDALHIMHDGKFLHLPVFDKDG 330 >At3g52950.1 putative protein / predicted protein, Arabidopsis thaliana Length = 556 Score = 57.0 bits (136), Expect = 1e-08 Identities = 31/101 (30%), Positives = 56/101 (54%) Frame = +1 Query: 226 TVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDIMTEE 405 TV+DA + M V A ++ S + ++GI+T++D ++I +G T V +MT Sbjct: 80 TVFDACRRMAARRVDACLLTDS--SALLSGIVTDKDVATRVIAEGLRPDQTLVSKVMTRN 137 Query: 406 NKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTGMIGMVSI 528 I VT ++ L+A+Q M + RH+PV++ +I ++ I Sbjct: 138 P--IFVTSDSLALEALQKMVQGKFRHLPVVENGEVIALLDI 176 Score = 51.6 bits (122), Expect = 5e-07 Identities = 32/95 (33%), Positives = 53/95 (55%) Frame = +1 Query: 223 DTVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDIMTE 402 D V A K M V ++++ S NK I+GI+T +D L +++ Q S + T V +MT Sbjct: 248 DPVSVAAKRMRDLRVNSVII--STGNK-ISGILTSKDILMRVVAQNLSPELTLVEKVMTP 304 Query: 403 ENKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTG 507 + ++ ET +L A+ M D + H+P+ID+ G Sbjct: 305 NPECASL--ETTILDALHTMHDGKFLHLPIIDKDG 337 >At5g50640.1 putative protein / strong similarity to unknown protein (emb CAB86899.1) Length = 548 Score = 55.8 bits (133), Expect = 3e-08 Identities = 34/128 (26%), Positives = 67/128 (51%), Gaps = 3/128 (2%) Frame = +1 Query: 226 TVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDIMTEE 405 T+++A + M V AL++ S N + GI+T+RD K+I + + + T V +MT+ Sbjct: 79 TLFEACRRMAARRVDALLLTDS--NALLCGILTDRDIATKVIAKQLNLEETPVSKVMTKN 136 Query: 406 NKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTGMIGMVSIGDVVRAVVGEHR---EELK 576 + V +T ++A+Q M + RH+PV++ +I ++ I + + E+ K Sbjct: 137 P--VFVLSDTIAVEALQKMVQGKFRHLPVVENGEVIALLDIAKCLYDAIARMERSVEKGK 194 Query: 577 RLNAFIQG 600 + A ++G Sbjct: 195 AIAAAVEG 202 Score = 52.0 bits (123), Expect = 4e-07 Identities = 31/112 (27%), Positives = 61/112 (53%), Gaps = 1/112 (0%) Frame = +1 Query: 220 DDTVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDIMT 399 D+TV M + A +V+ ENK + GI+T +D L ++I Q ++T V +MT Sbjct: 246 DETVLGVTMKMVEYQSSAAMVMV--ENK-LVGILTSKDILMRVISQNLPQETTTVEKVMT 302 Query: 400 EENKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTG-MIGMVSIGDVVRAVV 552 + TV + +++A+ +M + + H+PV+D+ G ++ ++ + + A V Sbjct: 303 PNPESATV--DMAIVEALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITHAAV 352 >At5g50530.1 putative protein / strong similarity to unknown protein (emb|CAB86899.1) Length = 548 Score = 55.8 bits (133), Expect = 3e-08 Identities = 34/128 (26%), Positives = 67/128 (51%), Gaps = 3/128 (2%) Frame = +1 Query: 226 TVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDIMTEE 405 T+++A + M V AL++ S N + GI+T+RD K+I + + + T V +MT+ Sbjct: 79 TLFEACRRMAARRVDALLLTDS--NALLCGILTDRDIATKVIAKQLNLEETPVSKVMTKN 136 Query: 406 NKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTGMIGMVSIGDVVRAVVGEHR---EELK 576 + V +T ++A+Q M + RH+PV++ +I ++ I + + E+ K Sbjct: 137 P--VFVLSDTIAVEALQKMVQGKFRHLPVVENGEVIALLDIAKCLYDAIARMERSVEKGK 194 Query: 577 RLNAFIQG 600 + A ++G Sbjct: 195 AIAAAVEG 202 Score = 52.0 bits (123), Expect = 4e-07 Identities = 31/112 (27%), Positives = 61/112 (53%), Gaps = 1/112 (0%) Frame = +1 Query: 220 DDTVYDAVKSMTHHNVGALVVVKSGENKSIAGIITERDYLRKIIVQGRSSKSTKVGDIMT 399 D+TV M + A +V+ ENK + GI+T +D L ++I Q ++T V +MT Sbjct: 246 DETVLGVTMKMVEYQSSAAMVMV--ENK-LVGILTSKDILMRVISQNLPQETTTVEKVMT 302 Query: 400 EENKLITVTPETKVLKAMQLMTDNRIRHIPVIDQTG-MIGMVSIGDVVRAVV 552 + TV + +++A+ +M + + H+PV+D+ G ++ ++ + + A V Sbjct: 303 PNPESATV--DMAIVEALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITHAAV 352 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,530,309 Number of Sequences: 27288 Number of extensions: 461409 Number of successful extensions: 1891 Number of sequences better than 1.0e-05: 12 Number of HSP's better than 0.0 without gapping: 1461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1732 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1547415100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18260163|gb|BM408533.1|BM408533 EST582860 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG45A1 5' end, mRNA sequence (778 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g02500.1 putative sugar nucleotide phosphorylase / ; supp... 281 3e-76 >At2g02500.1 putative sugar nucleotide phosphorylase / ; supported by cDNA: gi_12697582_dbj_AB037876.1_AB037876 Length = 302 Score = 281 bits (718), Expect(2) = 3e-76 Identities = 143/186 (76%), Positives = 161/186 (85%) Frame = +3 Query: 186 LFKISCSSTSENLNKESDVVVVEEKSVSVILLAGGKGKRMGASMPKQYLPLLGQPIALYS 365 L I CSS++ N VVV+EKSVSVILLAGG+GKRM SMPKQY+PLLGQPIALYS Sbjct: 56 LLSIKCSSSTGFDNSN---VVVKEKSVSVILLAGGQGKRMKMSMPKQYIPLLGQPIALYS 112 Query: 366 FYTFSKMPQVKEIIVVCDPSYQDIFEDAKEYIQVDLKFALPGKERQDSVYSGLQEVDSNS 545 F+TFS+MP+VKEI+VVCDP ++DIFE+ +E I VDL+FA+PGKERQDSVYSGLQE+D NS Sbjct: 113 FFTFSRMPEVKEIVVVCDPFFRDIFEEYEESIDVDLRFAIPGKERQDSVYSGLQEIDVNS 172 Query: 546 KLACIHDSARPLVQIEDVEKVLKDGWLVGAAVLGVPAKATIKEANSESFVVKTLDRKTLW 725 +L CIHDSARPLV EDVEKVLKDG VGAAVLGVPAKATIKE NS+S VVKTLDRKTLW Sbjct: 173 ELVCIHDSARPLVNTEDVEKVLKDGSAVGAAVLGVPAKATIKEVNSDSLVVKTLDRKTLW 232 Query: 726 EMQTPQ 743 EMQTPQ Sbjct: 233 EMQTPQ 238 Score = 22.7 bits (47), Expect(2) = 3e-76 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +1 Query: 745 EGLESTDDVSI 777 EGLE TDDVSI Sbjct: 255 EGLEVTDDVSI 265 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,121,528 Number of Sequences: 27288 Number of extensions: 457746 Number of successful extensions: 1579 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1579 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1428015260 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250493|gb|BI936021.1|BI936021 EST555910 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD24P23 5' end, mRNA sequence (455 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g06950.1 chloroplast inner envelope protein, putative / si... 200 3e-52 >At1g06950.1 chloroplast inner envelope protein, putative / similar to chloroplast inner envelope protein GB:CAA92823 GI:1495768 from [Pisum sativum]; supported by cDNA: gi_20453113 Length = 1016 Score = 200 bits (508), Expect = 3e-52 Identities = 96/151 (63%), Positives = 129/151 (84%) Frame = +2 Query: 2 LREAQLAYRLSDELAHEMLKEHARKLVEEIISTAVGILKSRTRATREPTRVIEELDKVLS 181 LR++QL+++LSDELA ++ +EH RK+V E IS+A+ ILKSRTRA + V+EEL+KVL Sbjct: 324 LRKSQLSFKLSDELAEDLFREHTRKVVVENISSALSILKSRTRAAKSLASVVEELEKVLE 383 Query: 182 YNNLLISLKNHADASRFAPGIGPVSLVGGEYDGDRKMDDLKLLYRAYVTDSLSSGRMEED 361 +NNLL+SLK+H++A +FA G+GP+SL+G E D +R+MDDLKLLYRAYVTD+LS GR+EE+ Sbjct: 384 FNNLLVSLKSHSEADQFARGVGPISLIGDESDFERRMDDLKLLYRAYVTDALSGGRLEEN 443 Query: 362 KLAALNQLRNIFGLGKREADTITLDVTSKVY 454 KL A++QLRNI GLGKREA+ I++DVTSK Y Sbjct: 444 KLVAMSQLRNILGLGKREAEAISVDVTSKSY 474 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,207,015 Number of Sequences: 27288 Number of extensions: 214471 Number of successful extensions: 734 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 718 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 734 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 552701236 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250467|gb|BI935995.1|BI935995 EST555884 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD24L13 5' end, mRNA sequence (576 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g06760.1 late embryogenesis abundant protein LEA like / ;... 115 1e-26 At3g16460.1 putative lectin / contains Pfam profile: PF01419 ... 62 2e-10 At1g45258.1 similar to putative lectin / temporary automated ... 62 2e-10 >At5g06760.1 late embryogenesis abundant protein LEA like / ; supported by cDNA: gi_15293004_gb_AY050936.1_ Length = 158 Score = 115 bits (289), Expect = 1e-26 Identities = 74/156 (47%), Positives = 94/156 (59%), Gaps = 11/156 (7%) Frame = +1 Query: 49 MEAAKQTAANVAASAKSGMEKTKAVVTEKTEKLTTSDPVQRQMATEKKEQRIHQAEMDKL 228 M++ K+TA+N+AASAKSGM+KTKA + EK EK+ T DPVQ+QMAT+ KE +I+QAEM K Sbjct: 1 MQSMKETASNIAASAKSGMDKTKATLEEKAEKMKTRDPVQKQMATQVKEDKINQAEMQKR 60 Query: 229 AAKEQNAASRQAAATG-----GTTAYTATG--GGITGTH--GTATGHTGLGHTTTGTHGT 381 ++ NAA ++AA G GT ++ TG G TGTH GH G G T Sbjct: 61 ETRQHNAAMKEAAGAGTGLGLGTATHSTTGQVGHGTGTHQMSALPGH-GTGQLTDRVVEG 119 Query: 382 TASHTGLGHTTGTHVPTA--GHAGLGHTTGTHGTAG 483 TA +G TGT TA H G G TG +GT G Sbjct: 120 TAVTDPIGRNTGTGRTTAHNTHVGGGGATG-YGTGG 154 >At3g16460.1 putative lectin / contains Pfam profile: PF01419 jacalin-like lectin domain; similar to jasmonate inducible protein GB:Y11483 (Brassica napus), myrosinase binding protein GB:BAA84545 (Arabidopsis thaliana); supported by cDNA: gi_14334869_gb_AY035108.1_ Length = 705 Score = 62.4 bits (150), Expect = 2e-10 Identities = 50/101 (49%), Positives = 51/101 (49%), Gaps = 3/101 (2%) Frame = +1 Query: 277 GTTAYTATGGGITGTHGTATGH-TGLGHTTTGTHGTTASHTGLGHTTGTHVPTAGHAGLG 453 GT T TG G TGT GT TG TG G T TGT GT + TG G TGT T G G Sbjct: 153 GTGTGTGTGTG-TGTGGTGTGTGTGTGGTGTGT-GTGGTGTGTGTGTGTGTGT----GTG 206 Query: 454 HTTGTHGTAGHTDLG--HTTDHTGLGHTTGTRGTTPGHATG 570 TGT GT T G T TG G TGT GT G TG Sbjct: 207 TGTGTGGTGTGTGTGGTGTGTGTGTGTGTGTGGTGTGTGTG 247 Score = 58.5 bits (140), Expect = 2e-09 Identities = 50/101 (49%), Positives = 51/101 (49%), Gaps = 1/101 (0%) Frame = +1 Query: 271 TGGTTAYTATGGGITGTHGTATGHTGLGHTTTGTHGTTASHTGLGHTTGTHVPTAGHAGL 450 TGGT T TG G TGT GT TG TG G T TGT GT + TG G TG G G Sbjct: 135 TGGTGTGTGTGTG-TGT-GTGTG-TGTG-TGTGT-GTGGTGTGTGTGTGGTGTGTGTGGT 189 Query: 451 GHTTGT-HGTAGHTDLGHTTDHTGLGHTTGTRGTTPGHATG 570 G TGT GT T G T G G TGT GT G TG Sbjct: 190 GTGTGTGTGTGTGTGTGTGTGTGGTGTGTGTGGTGTGTGTG 230 Score = 51.6 bits (122), Expect = 3e-07 Identities = 44/111 (39%), Positives = 48/111 (42%), Gaps = 15/111 (13%) Frame = +1 Query: 283 TAYTATGGGITGTHGTA---------------TGHTGLGHTTTGTHGTTASHTGLGHTTG 417 +A ATG I+G GT+ TG TG G T TGT T + TG G TG Sbjct: 98 SAPEATGKQISGFLGTSGNVLNTIDVHYSPIPTGGTGTGGTGTGTGTGTGTGTGTGTGTG 157 Query: 418 THVPTAGHAGLGHTTGTHGTAGHTDLGHTTDHTGLGHTTGTRGTTPGHATG 570 T G G TGT GT T G T TG G TG GT G TG Sbjct: 158 T--------GTGTGTGTGGTG--TGTGTGTGGTGTGTGTGGTGTGTGTGTG 198 Score = 51.6 bits (122), Expect = 3e-07 Identities = 49/101 (48%), Positives = 50/101 (48%), Gaps = 5/101 (4%) Frame = +1 Query: 283 TAYTATGGGITGTHGTATGHTGLGHTTTGTHGTTASHTGLGHT-TGTHVPTAGHAGLGHT 459 T T TGG TGT GT TG TG G T TGT T + TG G T TGT T G G G Sbjct: 130 TGGTGTGGTGTGT-GTGTG-TGTG-TGTGTGTGTGTGTGTGGTGTGTGTGTGG-TGTGTG 185 Query: 460 TGTHGTAGHTDLGHTTDH-TGLGHTTGTRGT---TPGHATG 570 TG GT T G T TG G TG GT T G TG Sbjct: 186 TGGTGTGTGTGTGTGTGTGTGTGTGTGGTGTGTGTGGTGTG 226 >At1g45258.1 similar to putative lectin / temporary automated functional assignment Length = 705 Score = 62.4 bits (150), Expect = 2e-10 Identities = 50/101 (49%), Positives = 51/101 (49%), Gaps = 3/101 (2%) Frame = +1 Query: 277 GTTAYTATGGGITGTHGTATGH-TGLGHTTTGTHGTTASHTGLGHTTGTHVPTAGHAGLG 453 GT T TG G TGT GT TG TG G T TGT GT + TG G TGT T G G Sbjct: 153 GTGTGTGTGTG-TGTGGTGTGTGTGTGGTGTGT-GTGGTGTGTGTGTGTGTGT----GTG 206 Query: 454 HTTGTHGTAGHTDLG--HTTDHTGLGHTTGTRGTTPGHATG 570 TGT GT T G T TG G TGT GT G TG Sbjct: 207 TGTGTGGTGTGTGTGGTGTGTGTGTGTGTGTGGTGTGTGTG 247 Score = 58.5 bits (140), Expect = 2e-09 Identities = 50/101 (49%), Positives = 51/101 (49%), Gaps = 1/101 (0%) Frame = +1 Query: 271 TGGTTAYTATGGGITGTHGTATGHTGLGHTTTGTHGTTASHTGLGHTTGTHVPTAGHAGL 450 TGGT T TG G TGT GT TG TG G T TGT GT + TG G TG G G Sbjct: 135 TGGTGTGTGTGTG-TGT-GTGTG-TGTG-TGTGT-GTGGTGTGTGTGTGGTGTGTGTGGT 189 Query: 451 GHTTGT-HGTAGHTDLGHTTDHTGLGHTTGTRGTTPGHATG 570 G TGT GT T G T G G TGT GT G TG Sbjct: 190 GTGTGTGTGTGTGTGTGTGTGTGGTGTGTGTGGTGTGTGTG 230 Score = 51.6 bits (122), Expect = 3e-07 Identities = 44/111 (39%), Positives = 48/111 (42%), Gaps = 15/111 (13%) Frame = +1 Query: 283 TAYTATGGGITGTHGTA---------------TGHTGLGHTTTGTHGTTASHTGLGHTTG 417 +A ATG I+G GT+ TG TG G T TGT T + TG G TG Sbjct: 98 SAPEATGKQISGFLGTSGNVLNTIDVHYSPIPTGGTGTGGTGTGTGTGTGTGTGTGTGTG 157 Query: 418 THVPTAGHAGLGHTTGTHGTAGHTDLGHTTDHTGLGHTTGTRGTTPGHATG 570 T G G TGT GT T G T TG G TG GT G TG Sbjct: 158 T--------GTGTGTGTGGTG--TGTGTGTGGTGTGTGTGGTGTGTGTGTG 198 Score = 51.6 bits (122), Expect = 3e-07 Identities = 49/101 (48%), Positives = 50/101 (48%), Gaps = 5/101 (4%) Frame = +1 Query: 283 TAYTATGGGITGTHGTATGHTGLGHTTTGTHGTTASHTGLGHT-TGTHVPTAGHAGLGHT 459 T T TGG TGT GT TG TG G T TGT T + TG G T TGT T G G G Sbjct: 130 TGGTGTGGTGTGT-GTGTG-TGTG-TGTGTGTGTGTGTGTGGTGTGTGTGTGG-TGTGTG 185 Query: 460 TGTHGTAGHTDLGHTTDH-TGLGHTTGTRGT---TPGHATG 570 TG GT T G T TG G TG GT T G TG Sbjct: 186 TGGTGTGTGTGTGTGTGTGTGTGTGTGGTGTGTGTGGTGTG 226 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.312 0.125 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,221,000 Number of Sequences: 27288 Number of extensions: 373533 Number of successful extensions: 2053 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 1507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1863 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 868297828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250392|gb|BI935920.1|BI935920 EST555809 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD24M12 5' end, mRNA sequence (699 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g37360.1 putative protein / ; supported by cDNA: gi_16604... 197 6e-51 >At5g37360.1 putative protein / ; supported by cDNA: gi_16604481 Length = 309 Score = 197 bits (500), Expect = 6e-51 Identities = 116/205 (56%), Positives = 138/205 (66%), Gaps = 16/205 (7%) Frame = +3 Query: 3 FDLSNGPVKVECGEEVGETLLNISRAWEMADTSTSTALVDKLPLLVGSLTGSQKSVSIWK 182 FDLSNGPV ECG+E+GETLLN+SRAWE ADTSTS +LV+KLP L LT +S + K Sbjct: 106 FDLSNGPVIDECGQELGETLLNLSRAWEQADTSTSRSLVEKLPELEILLTDGARS-AFGK 164 Query: 183 ALVISWKKVPVHG---------------TIWRR*SAEVSGVDVE-EFKQQTRMFKFGDLQ 314 L+ + K+ G T SA+ S V V E K TRMFKFG+LQ Sbjct: 165 RLISAGKRFQGMGQYAKGELQKIAKAMITTGGVLSAKTSSVSVSNESKSGTRMFKFGELQ 224 Query: 315 VELTSGKAYTGAAIAFIFSFLSWELGQGIQSIPESSLQYANDNALLLAKSLRASLLVMSY 494 V +T KAYTGAAIAFI+ LSW++ QGIQSIPE+SLQYANDNALL+ KSLR SLL + Y Sbjct: 225 VAVTPEKAYTGAAIAFIYGILSWQISQGIQSIPENSLQYANDNALLIGKSLRGSLLALFY 284 Query: 495 SSTVLAAFAMVGLILLGGQLKSENK 569 +STVL+ F GLILL QL SE + Sbjct: 285 ASTVLSGFTTAGLILLAKQLSSEKE 309 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,014,249 Number of Sequences: 27288 Number of extensions: 389050 Number of successful extensions: 1247 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1244 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1209984928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250384|gb|BI935912.1|BI935912 EST555801 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD24K20 5' end, mRNA sequence (754 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g75340.1 expressed protein / ; supported by cDNA: gi_14335... 142 1e-34 At1g62763.1 hypothetical protein / 48 5e-06 >At1g75340.1 expressed protein / ; supported by cDNA: gi_14335031_gb_AY037195.1_ Length = 321 Score = 142 bits (359), Expect = 1e-34 Identities = 91/193 (47%), Positives = 116/193 (59%), Gaps = 1/193 (0%) Frame = +1 Query: 139 EDFNNEKPLWLLTCYGHRKNGPCDITGDVSYEELRAVAYDDAKRGQSLMSIVERERSQVN 318 +DF NE+P+W LTCYGH K PCD+TGD+SYEELRAVAY++AKRG L SIVERER+ N Sbjct: 3 DDFKNERPMWKLTCYGHWKYFPCDVTGDISYEELRAVAYEEAKRGIPLQSIVERERNLQN 62 Query: 319 SKVAEFENLLQNPYASSSTSALNAQSPFPGATPSASLSAQSPFPGATPSASSPFPGAAPN 498 SK+AEFEN L+NPY S T+ QSPF TPS FP ++ +SP P Sbjct: 63 SKIAEFENFLRNPYKGSVTA---NQSPFAATTPSI-------FPQSS-QINSPSPAF--- 108 Query: 499 ASLSAQSPFPGAAPNALSSAQSSFPPSA-SSFSQLGTILNTGTSTPPTSTFGQPSLPGNS 675 + + Q+ F LS SS PP+A +SF+Q T NT S+ G P+ P S Sbjct: 109 SGFNQQTAFSNTNAGGLS---SSGPPNAFASFNQQTTFPNTNAG--GVSSSGPPN-PFAS 162 Query: 676 FKTSNSSGVNAFS 714 F +++ AFS Sbjct: 163 FTQQSNNQQTAFS 175 >At1g62763.1 hypothetical protein / Length = 312 Score = 48.1 bits (113), Expect = 5e-06 Identities = 35/93 (37%), Positives = 49/93 (52%) Frame = +1 Query: 412 TPSASLSAQSPFPGATPSASSPFPGAAPNASLSAQSPFPGAAPNALSSAQSSFPPSASSF 591 T S+SLS S P +PS S P +AP +SLS SP P LS + SS PP S Sbjct: 22 TSSSSLSPSSSSPSLSPSPPSSSPSSAPPSSLSPSSPPP------LSLSPSSPPPPPPSS 75 Query: 592 SQLGTILNTGTSTPPTSTFGQPSLPGNSFKTSN 690 S L ++ + + +PP+S+ S P +S S+ Sbjct: 76 SPLSSLSPSLSPSPPSSS--PSSAPPSSLSPSS 106 Score = 48.1 bits (113), Expect = 5e-06 Identities = 40/120 (33%), Positives = 62/120 (51%), Gaps = 2/120 (1%) Frame = +1 Query: 352 NPYASSSTSALNAQSPFPGATPSASLSAQSPFPGATPSASSPFPGAAPNASLSAQSPFPG 531 +P +SS + + + S P + P +SLS SP P + S SSP P ++ LS+ SP Sbjct: 28 SPSSSSPSLSPSPPSSSPSSAPPSSLSPSSP-PPLSLSPSSPPPPPPSSSPLSSLSP--S 84 Query: 532 AAPNALSSAQSSFPPSASSFSQLGTILNTGTSTPPTSTFGQP--SLPGNSFKTSNSSGVN 705 +P+ SS+ SS PPS+ S S + + +S PP P SL +S ++ S+ N Sbjct: 85 LSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSSSSSTYSNQTN 144 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.311 0.125 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,072,538 Number of Sequences: 27288 Number of extensions: 390826 Number of successful extensions: 1921 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1338 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1668 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1357057980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250370|gb|BI935898.1|BI935898 EST555787 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD24I10 5' end, mRNA sequence (739 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05010.1 coatomer delta subunit (delta-coat protein) (delta-C... 330 4e-91 At5g40855.1 hypothetical protein / 50 2e-06 >At5g05010.1 coatomer delta subunit (delta-coat protein) (delta-COP) / ; supported by cDNA: gi_15450768_gb_AY054464.1_ Length = 527 Score = 330 bits (847), Expect = 4e-91 Identities = 175/240 (72%), Positives = 202/240 (83%), Gaps = 3/240 (1%) Frame = +3 Query: 24 MVVLAASIISKSGKALVSRQFVDMSRIRIEGYLAAFPKLVGIGKQHTYIETENVRYVYQP 203 MVVLAA+I+ KSGK +VSR +VDMSRIRIEG LAAFPKLVG+GKQHTYIETENVRYVYQP Sbjct: 1 MVVLAAAIVVKSGKVIVSRHYVDMSRIRIEGLLAAFPKLVGMGKQHTYIETENVRYVYQP 60 Query: 204 IESLYLLLVTNKQSNILEDLETLRLLSKLVPEYSYSLDEEGIGRTAFELIFAFDEVISLG 383 IE+L+LLLVT KQSNILEDL TL LLSKLVPEYS SLDEEGI R +FELIFAFDEVISLG Sbjct: 61 IEALFLLLVTTKQSNILEDLATLTLLSKLVPEYSMSLDEEGISRASFELIFAFDEVISLG 120 Query: 384 HKENVTVTQVKQYCEMESHEERLHKLVLQNKINETKDVMKRKASEIDKSKIERNRGDKGG 563 HKE+VTV QVKQYCEMESHEE+LHKLV+Q+KIN+TKDVMKRKA+EIDKSKIE+N+ GG Sbjct: 121 HKESVTVAQVKQYCEMESHEEKLHKLVMQSKINDTKDVMKRKANEIDKSKIEKNK--PGG 178 Query: 564 FMSLQSMSSGKIDTGFGSDSGISHIGRHGSG---GFALPPDVDTFSTKSRGSSAASATAP 734 F S+ SM SG++++GF ++ IS G G G GF + DVD +TK + S +S TAP Sbjct: 179 FSSMGSMGSGRLESGF-NELSISSGGGGGYGSGSGFGMISDVDPINTKPKDRSRSSVTAP 237 >At5g40855.1 hypothetical protein / Length = 78 Score = 49.7 bits (117), Expect = 2e-06 Identities = 23/39 (58%), Positives = 28/39 (70%) Frame = -3 Query: 446 LLVTLHFTVLLDLCNCNIFLVPKRDHFIKCKNKLKSRPA 330 L+ LHFT+LL L C+ FLVPKR +KCK +LKS PA Sbjct: 26 LMQLLHFTILLHLDTCHTFLVPKRYDLVKCKYQLKSSPA 64 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,806,583 Number of Sequences: 27288 Number of extensions: 383055 Number of successful extensions: 1388 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1314 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1382 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1312709680 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250358|gb|BI935886.1|BI935886 EST555775 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD24G8 5' end, mRNA sequence (789 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g33760.1 putative aspartate--tRNA ligase / aspartate--tRNA... 204 8e-62 >At4g33760.1 putative aspartate--tRNA ligase / aspartate--tRNA ligase, Synechocystis sp., PIR2:S75048 Length = 636 Score = 204 bits (520), Expect(3) = 8e-62 Identities = 108/192 (56%), Positives = 129/192 (66%) Frame = +2 Query: 86 MSLFFRSLPTIAIRSKPSPLTSLPFFFINFHNPITHNPTSLINRTLSSTSVSASPTTPET 265 MSL R+LP R + S+ F P NP RT SS+ V+A+ Sbjct: 1 MSLLLRTLPLRPTRFLSATAISISNATNFFVVPKRTNPLPGTRRTFSSSPVAAASGDVVV 60 Query: 266 VVVPNPKVSPSPNALQWVSRNQYCGELSEEDVGKRVRLCGWVALHRIHGGLTFVNLRDQT 445 VP+P P+ L+WVSR + CGELS DVGKRV LCGWVALHR+HGGLTF+NLRD T Sbjct: 61 KPVPSP-----PSVLRWVSRTELCGELSVNDVGKRVHLCGWVALHRVHGGLTFLNLRDHT 115 Query: 446 GIVQITTLPDDFPDAHSTVRDLRLEYVVAIEGVVRPRPAESVNKKMKTGTIEVAAEDVQV 625 GIVQ+ TLPD+FP+AH + D+RLEYVV +EG VR RP ESVNKKMKTG +EV AE V++ Sbjct: 116 GIVQVRTLPDEFPEAHGLINDMRLEYVVLVEGTVRSRPNESVNKKMKTGFVEVVAEHVEI 175 Query: 626 LNAVRLKLPFLV 661 LN VR KLPFLV Sbjct: 176 LNPVRTKLPFLV 187 Score = 46.2 bits (108), Expect(3) = 8e-62 Identities = 22/38 (57%), Positives = 28/38 (72%) Frame = +1 Query: 637 KIEVALLGKTADDAKDSSKEEIRLRYRCLDLRRPQMSS 750 + ++ L TAD+ KD KEEIRLR+RCLDLRR QM + Sbjct: 180 RTKLPFLVTTADENKDLIKEEIRLRFRCLDLRRQQMKN 217 Score = 25.4 bits (54), Expect(3) = 8e-62 Identities = 10/13 (76%), Positives = 12/13 (91%) Frame = +3 Query: 750 NIILRHRVVKLLR 788 NI+LRH VVKL+R Sbjct: 218 NIVLRHNVVKLIR 230 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,607,904 Number of Sequences: 27288 Number of extensions: 463319 Number of successful extensions: 2093 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1885 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2078 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1463493900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250193|gb|BI935721.1|BI935721 EST555610 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD23F20 5' end, mRNA sequence (588 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49880.1 mitotic checkpoint protein-like / 199 1e-51 >At5g49880.1 mitotic checkpoint protein-like / Length = 726 Score = 199 bits (505), Expect = 1e-51 Identities = 112/192 (58%), Positives = 143/192 (74%), Gaps = 8/192 (4%) Frame = +1 Query: 37 MILRTPPFKR---KAQSNQPEDGSPSSGNQQLVIFEDTPLP-----ESSHHHPESSEQML 192 MILRTP KR A + G+ SGNQ L+I+ED+PLP ++SH H S++Q L Sbjct: 1 MILRTPQPKRLRSDAGESPFPTGATGSGNQ-LIIYEDSPLPAPAPLQTSHDH--SADQHL 57 Query: 193 CTYQCRQMVKSEFFDALSSAEKQARDNQSKLEALNNDYLKADAERKKFRDQFLNAEQELA 372 CTYQCRQMVK++ DALS+AEKQ ++++KL+ LN ++ +ADAERK FRD+FL +EQELA Sbjct: 58 CTYQCRQMVKADVLDALSTAEKQVEESKTKLQTLNANFTEADAERKHFRDKFLYSEQELA 117 Query: 373 AAKGREEALQDQLMKEVNVSHERLRKQLQLYNELEVKFQNEMNLRKKVETSAAAAEEKAS 552 AAK RE+ LQ+QL+ E+N S ER K+LQ +ELEVK QNEMNLRKK E+SAA AEEKA Sbjct: 118 AAKAREKMLQEQLLMEINNSQERYTKELQSCHELEVKLQNEMNLRKKAESSAATAEEKAK 177 Query: 553 LLERKLSSVSES 588 LLE KL+ +S S Sbjct: 178 LLEDKLTQLSGS 189 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.310 0.124 0.331 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,113,567 Number of Sequences: 27288 Number of extensions: 256442 Number of successful extensions: 746 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 904103924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250095|gb|BI935623.1|BI935623 EST555512 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD23B17 5' end, mRNA sequence (682 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g13540.1 putative cap-binding protein / ; supported by cD... 273 2e-80 >At2g13540.1 putative cap-binding protein / ; supported by cDNA: gi_15192737_gb_AF272891.1_AF272891 Length = 848 Score = 273 bits (697), Expect(2) = 2e-80 Identities = 128/193 (66%), Positives = 165/193 (85%), Gaps = 1/193 (0%) Frame = +3 Query: 3 ALEELLPPRGGPQFKYSAEDGTDPTE-RALSLELKDMVKGRKTAREMISWVEENVFPAHG 179 ALEELLPP+ GP F YS E+G + TE + LS EL VK ++TAR+MI W+EE ++P HG Sbjct: 471 ALEELLPPKAGPNFMYSLEEGKEKTEEQQLSAELSRKVKEKQTARDMIVWIEETIYPVHG 530 Query: 180 FDITLGVVVQTLLDIGSKSFTHLITVLERYGQVIAKMCTDDDQQVKLITEVSSYWQNSAQ 359 F++TL +VVQTLLDIGSKSFTHL+TVLERYGQV +K+C D+D+QV L+++VS+YW+N+ Q Sbjct: 531 FEVTLTIVVQTLLDIGSKSFTHLVTVLERYGQVFSKLCPDNDKQVMLLSQVSTYWKNNVQ 590 Query: 360 MTAIAIDRMMSYRLISNLAIVRWVFSPLNLDRFHVSDSSWEILRNAVSKTYNRISDLRKE 539 MTA+AIDRMM YRL+SN AIVRWVFSP N+D+FHVSD WEIL NA++KTYNRISDLRK+ Sbjct: 591 MTAVAIDRMMGYRLVSNQAIVRWVFSPENVDQFHVSDQPWEILGNALNKTYNRISDLRKD 650 Query: 540 ISSLERSVVLAEK 578 IS++ ++V++AEK Sbjct: 651 ISNITKNVLVAEK 663 Score = 43.9 bits (102), Expect(2) = 2e-80 Identities = 20/28 (71%), Positives = 26/28 (92%) Frame = +2 Query: 575 KAASRAREELESAESKLSVIDGEPVLGE 658 KA++ AR ELE+AESKLS+++GEPVLGE Sbjct: 663 KASANARVELEAAESKLSLVEGEPVLGE 690 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,197,285 Number of Sequences: 27288 Number of extensions: 326932 Number of successful extensions: 957 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 924 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 956 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1156603240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250080|gb|BI935608.1|BI935608 EST555497 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD23M22 5' end, mRNA sequence (786 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g50590.1 hypothetical protein / 320 1e-89 >At3g50590.1 hypothetical protein / Length = 690 Score = 320 bits (819), Expect(2) = 1e-89 Identities = 156/185 (84%), Positives = 171/185 (92%), Gaps = 1/185 (0%) Frame = +3 Query: 201 MEWATLQHLDLRHVGRS-SKSLQPHAAAFHPTQALLAVAVGSQIIEFDAYTGSKIASIDI 377 MEWAT+QHLDLRHVGR SK LQPH AAFHP+QA++AVAVGS I+EFDA TG KIASIDI Sbjct: 30 MEWATVQHLDLRHVGRGVSKPLQPHTAAFHPSQAVIAVAVGSHIMEFDALTGCKIASIDI 89 Query: 378 GSPVVRMAYSPTSGHCVIAILEDCTMRSCDFDAEQTCVLHSPEKRTERISSDTEVHLALT 557 GSP VRM YSPTS + V+AILEDCT+RSCDF+ EQTCVLHSPEKR+E ISSDTEVHLA+T Sbjct: 90 GSPAVRMLYSPTSSNAVVAILEDCTIRSCDFETEQTCVLHSPEKRSEHISSDTEVHLAVT 149 Query: 558 PLQPVVFFGFHRKMSVTVVGTVEGGKAPTKIKTDLKKPIVNLACHPRLPVLYVAYAEGLI 737 PLQPVVFFGF ++MSVTVVGTVEGG+APTKIKTDLKKPIVN+ACHPRLPVLYVAYAEGLI Sbjct: 150 PLQPVVFFGFPKRMSVTVVGTVEGGRAPTKIKTDLKKPIVNIACHPRLPVLYVAYAEGLI 209 Query: 738 RAYNI 752 RAYNI Sbjct: 210 RAYNI 214 Score = 28.1 bits (61), Expect(2) = 1e-89 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 752 HTYAVHYTLQL 784 HTYAVHYTLQL Sbjct: 215 HTYAVHYTLQL 225 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,412,924 Number of Sequences: 27288 Number of extensions: 393772 Number of successful extensions: 1118 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1093 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1117 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250036|gb|BI935564.1|BI935564 EST555453 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD23C24 5' end, mRNA sequence (696 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24840.1 brefeldin A-sensitive Golgi protein - like / bref... 295 2e-80 >At4g24840.1 brefeldin A-sensitive Golgi protein - like / brefeldin A-sensitive Golgi protein LDLC, Homo sapiens, PIR2:A53542; supported by cDNA: gi_13605802_gb_AF367300.1_AF367300 Length = 756 Score = 295 bits (754), Expect = 2e-80 Identities = 159/237 (67%), Positives = 182/237 (76%), Gaps = 19/237 (8%) Frame = +3 Query: 39 PSPQSTHAPPRSATDLFGDPTDPNPPQWLNPTLFQSQDFDPESYISDLRTFVPLETLRSE 218 PSP S PRSATD F DP D +P W P+LF S +FD ESYIS+LRTFVP +TLRSE Sbjct: 9 PSPSSA---PRSATDFFSDPYDSHP-LWFKPSLFLSPNFDSESYISELRTFVPFDTLRSE 64 Query: 219 LRSHFTSLQRDLVDLINRDYADFVSLSTKLTDVDAAVVRMRAPLFEIREKIDGFRNAVEG 398 LRSH SL R+LVDLINRDYADFV+LSTKL D+DAAVVRMRAPL E+REKI GFR +VE Sbjct: 65 LRSHLASLNRELVDLINRDYADFVNLSTKLVDIDAAVVRMRAPLLELREKITGFRGSVEA 124 Query: 399 SLAALQNRLKQRADAVEAREVLELLLDTFHVVSKVEKLIKELPSGQTDY----------- 545 +L AL+N L+QR+DA AREVLELLLDTFHVVSKVEKLIK LPS +D+ Sbjct: 125 ALFALRNGLQQRSDAAAAREVLELLLDTFHVVSKVEKLIKVLPSTPSDWQNEDANSMGRS 184 Query: 546 --------VESGSNLRETQSMLLERIASEMNRLKFYISHAQNMPFIENMEKEIQNAS 692 + G+ +RETQSMLLERIASEMNRLKFY++HAQN+PFIENMEK IQ+AS Sbjct: 185 SMNDENSTQQDGTTMRETQSMLLERIASEMNRLKFYMAHAQNLPFIENMEKRIQSAS 241 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,725,264 Number of Sequences: 27288 Number of extensions: 323717 Number of successful extensions: 1989 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1918 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1201087980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250030|gb|BI935558.1|BI935558 EST555447 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD23C12 5' end, mRNA sequence (756 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03380.1 DegP protease / contains similarity to degP GI:26... 348 e-106 >At3g03380.1 DegP protease / contains similarity to degP GI:2623992 from [Bradyrhizobium japonicum] Length = 627 Score = 348 bits (893), Expect(2) = e-106 Identities = 171/209 (81%), Positives = 190/209 (90%) Frame = +3 Query: 3 REEIPVYPIYRDPVHDFGFFRYDPGAIQFLSYEEIPLAPDAASVGVEIRVVGNDSGEKVS 182 REEIP+YP+YRDPVHDFGFF YDP A+QFL+Y+EIPLAP+AASVG+EIRVVGNDSGEKVS Sbjct: 94 REEIPIYPVYRDPVHDFGFFCYDPSAVQFLTYQEIPLAPEAASVGLEIRVVGNDSGEKVS 153 Query: 183 ILAGTLARLDRDAPQYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKL 362 ILAGTLARLDRDAP YKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSK Sbjct: 154 ILAGTLARLDRDAPHYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKS 213 Query: 363 SSASAFFLPLERVVRSLKFLQEGGYHSTNTWAAVTIPRGTLQVTFLHKGFDETRRLGVQR 542 SSASAFFLPL+RVVR+L FLQ+ T+ AV IPRGTLQ+TFLHKGFDE RRLG++ Sbjct: 214 SSASAFFLPLQRVVRALSFLQKSIDSRTDKPKAVHIPRGTLQMTFLHKGFDEIRRLGLRS 273 Query: 543 ETEQLVRNSTPPSETGMLVIDSVVPGGPA 629 ETEQ+VR+++P ETGMLV+DSVVP GPA Sbjct: 274 ETEQVVRHASPTGETGMLVVDSVVPSGPA 302 Score = 56.6 bits (135), Expect(2) = e-106 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +2 Query: 623 PGSYQLEPGDVLVRMNGEIVTQFLKMETLLDDSGEQKIELSIER 754 P LEPGDVLVR+NG ++TQFL +E LLDD Q +EL IER Sbjct: 301 PADKHLEPGDVLVRVNGTVLTQFLNLENLLDDGVGQILELEIER 344 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,490,135 Number of Sequences: 27288 Number of extensions: 400213 Number of successful extensions: 1013 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1010 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250029|gb|BI935557.1|BI935557 EST555446 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD23C8 5' end, mRNA sequence (774 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13630.1 cobalamin biosynthesis protein / ; supported by c... 459 e-130 >At5g13630.1 cobalamin biosynthesis protein / ; supported by cDNA: gi_17978957 Length = 1381 Score = 459 bits (1181), Expect = e-130 Identities = 228/257 (88%), Positives = 245/257 (94%) Frame = +2 Query: 2 AKIVVERLLERQKIDNGGKYPETVALVLWGTDNIKTYGESLAQVMWMIGVRPVADTLGRV 181 AKIVVERL+ERQK++N GKYPET+ALVLWGTDNIKTYGESL QV+WMIGVRP+ADT GRV Sbjct: 1005 AKIVVERLVERQKLENEGKYPETIALVLWGTDNIKTYGESLGQVLWMIGVRPIADTFGRV 1064 Query: 182 NRVEPVSLEELGRPRVDVVVNCSGVFRDLFINQMNLLDRGIKMVAELDEPEDQNFVRKHA 361 NRVEPVSLEELGRPR+DVVVNCSGVFRDLFINQMNLLDR IKMVAELDEP +QNFVRKHA Sbjct: 1065 NRVEPVSLEELGRPRIDVVVNCSGVFRDLFINQMNLLDRAIKMVAELDEPVEQNFVRKHA 1124 Query: 362 LEQAKTLGIDVREAATRVFSNASGSYSSNINLAVENSSWNDEKQLQDMYLSRKSFAFDCD 541 LEQA+ LGID+REAATRVFSNASGSYS+NI+LAVENSSWNDEKQLQDMYLSRKSFAFD D Sbjct: 1125 LEQAEALGIDIREAATRVFSNASGSYSANISLAVENSSWNDEKQLQDMYLSRKSFAFDSD 1184 Query: 542 APGAGMMEKRKVFEMALSTADATFQNLDSSEISLTDVSHYFDSDPTNLVQNLRKDGKKPS 721 APGAGM EK++VFEMALSTA+ TFQNLDSSEISLTDVSHYFDSDPTNLVQ+LRKD KKPS Sbjct: 1185 APGAGMAEKKQVFEMALSTAEVTFQNLDSSEISLTDVSHYFDSDPTNLVQSLRKDKKKPS 1244 Query: 722 AYIADTTTGYAQVRTLS 772 +YIADTTT AQVRTLS Sbjct: 1245 SYIADTTTANAQVRTLS 1261 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,038,266 Number of Sequences: 27288 Number of extensions: 372768 Number of successful extensions: 1244 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1243 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16250003|gb|BI935531.1|BI935531 EST555420 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD23M19 5' end, mRNA sequence (774 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g48470.1 hypothetical protein / predicted by genemarkHMM 123 3e-51 >At3g48470.1 hypothetical protein / predicted by genemarkHMM Length = 1035 Score = 123 bits (309), Expect(2) = 3e-51 Identities = 59/82 (71%), Positives = 68/82 (81%) Frame = +2 Query: 2 ITAALGLCLEKMSKEDLDATKDAMHCILEGVSCRLGSTDHLIRKMASSVALAFSKVIDPQ 181 ITAALGLCLE MS+E+LD TKD MH IL+GVSCRL + L+RKMASS+A FSKVIDP+ Sbjct: 438 ITAALGLCLENMSREELDRTKDVMHSILQGVSCRLENPGDLVRKMASSIAFMFSKVIDPK 497 Query: 182 NPLYLDDSCREEAIDWDFGLLT 247 NPLYLDDS + AIDW+FGL T Sbjct: 498 NPLYLDDSITDNAIDWEFGLQT 519 Score = 96.7 bits (239), Expect(2) = 3e-51 Identities = 50/99 (50%), Positives = 73/99 (73%), Gaps = 2/99 (2%) Frame = +3 Query: 321 KVNIAASRHDNKMTKKKK-LFGYEAVDPDEIIDPASLNNEVDSSKDD-DDNASETSESSN 494 +VN ++ R+ K +K K + + DP+EI+D A+LN + +S KDD DD+AS +S++S+ Sbjct: 541 EVNESSRRNKQKENRKSKNISAFVLADPNEIVDLATLNCDTESDKDDGDDDASVSSDNSS 600 Query: 495 DSSLQPYDLSDDGADLKRNFSQLVDVIGALRKSDDADGV 611 +SL+PYDL DD DL + F+ LVDV+GALRK+DDADGV Sbjct: 601 VTSLEPYDLMDDDKDLGKQFTHLVDVVGALRKTDDADGV 639 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,309,250 Number of Sequences: 27288 Number of extensions: 361011 Number of successful extensions: 1803 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1722 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249899|gb|BI935427.1|BI935427 EST555316 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD22J10 5' end, mRNA sequence (496 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g10370.1 putative glycerol-3-phosphate dehydrogenase / sim... 311 1e-85 >At3g10370.1 putative glycerol-3-phosphate dehydrogenase / similar to glycerol-3-phosphate dehydrogenase GB:BAA08926 [Mus musculus]; supported by cDNA: gi_17380777 Length = 629 Score = 311 bits (796), Expect = 1e-85 Identities = 147/164 (89%), Positives = 156/164 (94%) Frame = +3 Query: 3 PLDILVVGGGATGCGVALDAATRGLRVGLVEREDFASGTSSRSTKLIHGGVRYLEKAVFN 182 PLD+LV+GGGATG GVALDA TRGLRVGLVEREDF+SGTSSRSTKLIHGGVRYLEKAVFN Sbjct: 73 PLDVLVIGGGATGSGVALDAVTRGLRVGLVEREDFSSGTSSRSTKLIHGGVRYLEKAVFN 132 Query: 183 LDYGQLKLVFHALEERKQLIENAPHLCHALPCMTPCFDWFDAIYYWAGLKMYDLVAGRHL 362 LDYGQLKLVFHALEERKQLIENAPHLCHALPCMTPCFDWF+ IY+W GLKMYDLVAG L Sbjct: 133 LDYGQLKLVFHALEERKQLIENAPHLCHALPCMTPCFDWFEVIYFWMGLKMYDLVAGPRL 192 Query: 363 LHLSRYYSAQESVELFPTLARNGKDKTLKGTVVYYDGQMNDSRV 494 LHLSRYYSA+ES+ELFPTLAR GKDK L+GTVVYYDGQMNDSR+ Sbjct: 193 LHLSRYYSAKESIELFPTLARKGKDKNLRGTVVYYDGQMNDSRL 236 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,203,223 Number of Sequences: 27288 Number of extensions: 234170 Number of successful extensions: 1060 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 893 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1038 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 648439200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249878|gb|BI935406.1|BI935406 EST555295 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD22F10 5' end, mRNA sequence (676 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g23940.1 dihydroxyacid dehydratase, putative / similar to ... 238 e-101 >At3g23940.1 dihydroxyacid dehydratase, putative / similar to dihydroxyacid dehydratase GB:CAA60939 [Saccharomyces cerevisiae]; supported by cDNA: gi_14532593_gb_AY039921.1_ Length = 608 Score = 238 bits (608), Expect(2) = e-101 Identities = 122/138 (88%), Positives = 129/138 (93%) Frame = +3 Query: 261 LLELLKMDLKPRDIITKKSLRNAMVVVMALGGSTNAVLHLIAIARSVGLELTLDDFQKVS 440 LLELLKMDLKPRDIIT KSLRNAMV VMALGGSTNAVLHLIAIARSVGLELTLDDFQKVS Sbjct: 289 LLELLKMDLKPRDIITPKSLRNAMVSVMALGGSTNAVLHLIAIARSVGLELTLDDFQKVS 348 Query: 441 DEVPFLADLKPSGKYVMEDVHKIGGTPAVIRHLLELGYMDGDCMTVTGKTLAENAKLFPS 620 D VPFLADLKPSGKYVMED+HKIGGTPAV+R+LLELG MDGDCMTVTG+TLA+N + PS Sbjct: 349 DAVPFLADLKPSGKYVMEDIHKIGGTPAVLRYLLELGLMDGDCMTVTGQTLAQNLENVPS 408 Query: 621 LAEGQQIIRPLSNPI*ET 674 L EGQ+IIRPLSNPI ET Sbjct: 409 LTEGQEIIRPLSNPIKET 426 Score = 149 bits (375), Expect(2) = e-101 Identities = 71/85 (83%), Positives = 77/85 (90%) Frame = +1 Query: 1 HFQGHTFDIVSAFQVYGEYVSGAVSDEQRMNVVRNSCPGAGACGGMYTANTMASAIEAMG 180 HFQ T+DIVSAFQ YGE+VSG++SDEQR V+ +SCPGAGACGGMYTANTMASAIEAMG Sbjct: 203 HFQDKTYDIVSAFQSYGEFVSGSISDEQRKTVLHHSCPGAGACGGMYTANTMASAIEAMG 262 Query: 181 MSLPYSSSTPAEDSLKLDECRLAGK 255 MSLPYSSS PAED LKLDECRLAGK Sbjct: 263 MSLPYSSSIPAEDPLKLDECRLAGK 287 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,452,180 Number of Sequences: 27288 Number of extensions: 388734 Number of successful extensions: 1115 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1060 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1113 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1138809344 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249779|gb|BI935307.1|BI935307 EST555196 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD22O22 5' end, mRNA sequence (789 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59630.1 putative protein / diphthamide synthesis protein ... 310 7e-85 At5g62030.1 putative protein / predicted proteins, D.melanoga... 56 3e-08 >At3g59630.1 putative protein / diphthamide synthesis protein DPH2 - Saccharomyces cerevisiae, PIR:S34679; supported by cDNA: gi_19715608 Length = 491 Score = 310 bits (793), Expect = 7e-85 Identities = 151/264 (57%), Positives = 195/264 (73%), Gaps = 2/264 (0%) Frame = +3 Query: 3 ASHANADCVIHYGHTCFSPTSTLPAFLVLGKASLNVPLCAQTLCKYTIKAGKPILVLYGL 182 A H +++CV+HYG TC SPTS LPAF V GKAS+NV C + L Y K+ KPI++LYGL Sbjct: 77 ALHIDSECVVHYGQTCLSPTSVLPAFFVFGKASINVSSCVKHLIDYASKSDKPIMILYGL 136 Query: 183 EYTHTITEIKASVG-AQVCSELEVHYADIISPIITPPETFSSMNEQPE-LSDGQCANGCS 356 EY H I +I+ +G ++ S+L V A+++ I+P + E P S+ ++ S Sbjct: 137 EYAHVIPQIREELGLSKTDSQLSV--ANVLCSFISPSKDPRESMEHPRPYSESDSSDSLS 194 Query: 357 IEVNDAIYCVGGLTWSLPVGHRIEDYLIFYVGSDDPAFANILMTYNACEIVRYDATEDKL 536 + Y +GGLTW LP G +IEDYL+F++GSD AFAN+++T+N C+IVRYDA ED L Sbjct: 195 ---SSRSYRLGGLTWDLPEGSKIEDYLLFWIGSDSSAFANVVLTFNGCDIVRYDAEEDSL 251 Query: 537 VNEFSQQKRILKRRYFLIEKAKDASIIGILVGTLGVAGYLHMIHQMKDLITRAGKKAYTF 716 V EF QQ+RILKRRY+L+EKAKDA+IIGILVGTLGVAGYLHMIH M+ LI+ AGKK+Y Sbjct: 252 VTEFYQQRRILKRRYYLVEKAKDANIIGILVGTLGVAGYLHMIHHMQALISAAGKKSYIL 311 Query: 717 VMGRPNPAKLANFPECDIFVYVSC 788 MGRPNPAKLANFPECD+F+Y+SC Sbjct: 312 AMGRPNPAKLANFPECDVFIYISC 335 >At5g62030.1 putative protein / predicted proteins, D.melanogaster, C.elegans and yeast; supported by cDNA: gi_20259527 Length = 453 Score = 55.8 bits (133), Expect = 3e-08 Identities = 56/260 (21%), Positives = 106/260 (40%), Gaps = 3/260 (1%) Frame = +3 Query: 18 ADCVIHYGHTCFSP--TSTLPAFLVLGKASLNVPLCAQTLCKYTIKAGKPILVLYGLEYT 191 AD +IHYGH+C P ++ +P V + ++V T+ K I++ +++T Sbjct: 117 ADLLIHYGHSCLVPIDSTKIPCLYVFVEIQIDVKCLLNTIHLNLASDVKNIILAGTIQFT 176 Query: 192 HTITEIKASVGAQVCSELEVHYADIISPIITPPETFSSMNEQPELSDGQCANGCSIEVND 371 I +K ELE +++ P P LS G+ + +V Sbjct: 177 SAIRAVKP--------ELEKQGFNVLIPQSKP------------LSAGEVLGCTAPKVKT 216 Query: 372 AIYCVGGLTWSLPVGHRIEDYLIFYVGSDDPAFANILMTYNACEIVRYDATEDKLVNEFS 551 C +D ++ +V ++ + RYD KL E Sbjct: 217 VEDC--------------KDQVLVFVADGRFHLEAFMIANPKIKAFRYDPYLGKLFLEEY 262 Query: 552 QQKRILKRRYFLIEKAKDASIIGILVGTLGVAGYLHMIHQMKDLITRAGKKAYTFVMGRP 731 K + + R I +A++A GI++GTLG G ++ +++ + G + +M Sbjct: 263 DHKGMRETRMRAIARAREAKTWGIVLGTLGRQGNPKILERLEKKMMEKGIDSTVVLMSEL 322 Query: 732 NPAKLANFPE-CDIFVYVSC 788 +P ++A F + D +V ++C Sbjct: 323 SPTRVALFEDSVDAWVQIAC 342 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,626,329 Number of Sequences: 27288 Number of extensions: 398899 Number of successful extensions: 1065 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1026 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1063 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1463493900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249765|gb|BI935293.1|BI935293 EST555182 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD22M18 5' end, mRNA sequence (766 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03820.1 putative nonsense-mediated mRNA decay protein / ... 388 e-108 >At2g03820.1 putative nonsense-mediated mRNA decay protein / ; supported by cDNA: gi_15810402_gb_AY056240.1_ Length = 516 Score = 388 bits (996), Expect = e-108 Identities = 178/253 (70%), Positives = 215/253 (84%) Frame = +1 Query: 7 AMAQDTGMFTVHHTIGNVLCCKCGISMQPNAANMCANCLRSEIDITEGLQKHVIICHCPE 186 ++ ++GMF V TIG+VLCCKCG+ M PNAANMC NCLRSE+DITEGLQK + I +CPE Sbjct: 2 SVMDESGMFNVQQTIGSVLCCKCGVPMAPNAANMCVNCLRSEVDITEGLQKSIQIFYCPE 61 Query: 187 CDSYLQPPRTWIKAQLESKELLTFCVKRLKNLNKVRLVQAEFIWTEPHSKRIKVKLKVQK 366 C YLQPP+TWIK Q ESKELLTFC+KRLKNLNKV+L AEF+WTEPHSKRIKVKL VQ Sbjct: 62 CTCYLQPPKTWIKCQWESKELLTFCIKRLKNLNKVKLKNAEFVWTEPHSKRIKVKLTVQA 121 Query: 367 EVLHGAILEQAYTVEFVIQDQMCEACTRVQANPDQWIAAVQLRQHVTHRRTFFYLEQLIL 546 EVL+GA+LEQ+Y VE+ ++D +CE+C+R QANPDQW+A++QLRQHV+HRRTFFYLEQLIL Sbjct: 122 EVLNGAVLEQSYPVEYTVRDNLCESCSRFQANPDQWVASIQLRQHVSHRRTFFYLEQLIL 181 Query: 547 KHDAASRAIMIKQMDQGIDFFFSNRSHAVKFVEFIGKVVPSRSRNDKTLVSHDPQSNHYH 726 +HDAASRAI I+Q+DQGIDFFF N+SHA FVEF+ KVVP R D+ LVSHD +S+ Y+ Sbjct: 182 RHDAASRAIRIQQVDQGIDFFFGNKSHANSFVEFLRKVVPIEYRQDQQLVSHDVKSSLYN 241 Query: 727 Y*YTFSVEISPSC 765 Y YT+SV+I P C Sbjct: 242 YKYTYSVKICPVC 254 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,783,847 Number of Sequences: 27288 Number of extensions: 353111 Number of successful extensions: 907 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 883 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 907 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1392536620 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249578|gb|BI935106.1|BI935106 EST554995 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD21H18 5' end, mRNA sequence (712 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g17830.1 N-acetylornithine deacetylase-like protein, fragment... 323 1e-96 >At4g17830.1 N-acetylornithine deacetylase-like protein, fragment / N-acetylornithine deacetylase (AOdD) - Dictyostelium discoideum, PID:G763048; supported by cDNA: gi_13507560 Length = 341 Score = 323 bits (829), Expect(2) = 1e-96 Identities = 151/199 (75%), Positives = 172/199 (85%) Frame = +3 Query: 3 LVTELMKKLAETKPKLKSSVIAIFIASEENASIQGIGVDALDKDGWFDKLKEGPLFWIDT 182 LVTELMKKL + KP LKS+V+A+FIASEEN+SI G+GVD L KD DKLK GPL+WIDT Sbjct: 41 LVTELMKKLGQAKPALKSTVVAVFIASEENSSIPGVGVDMLVKDKLLDKLKSGPLYWIDT 100 Query: 183 ADKQPCIGTGGVIPWELVVTGKGFHSGLPNKAINALELGMEALKEIQTRFYRDFPPHPKE 362 ADKQPC+GTGG+IPW+L TGK FHSGL +KAINA+EL ME LKEIQ RFYRDFPPHP+E Sbjct: 101 ADKQPCVGTGGMIPWKLQFTGKLFHSGLAHKAINAMELAMEGLKEIQARFYRDFPPHPQE 160 Query: 363 VIYKFEAPSTMKPTQWFYPGGGNNQIPGECTIAGDVRLTPFYNVSDVIKKLQEYVDDLNA 542 +Y F PSTMKPTQW YP GG NQIPGECT++GDVRLTPFY+V +VI KLQEYVDD+N Sbjct: 161 EVYGFATPSTMKPTQWCYPAGGINQIPGECTVSGDVRLTPFYDVKEVITKLQEYVDDING 220 Query: 543 NIEKLDTRGPVSKYVLPDE 599 NIE+L+TRGPVSKYVLPDE Sbjct: 221 NIERLETRGPVSKYVLPDE 239 Score = 47.4 bits (111), Expect(2) = 1e-96 Identities = 21/38 (55%), Positives = 30/38 (78%) Frame = +2 Query: 599 NIRGSMSISFEEPYSGVACDLDSLGYKVLAQATERGVG 712 N+RG +++SF+E +GVAC+LDS G+ VL +ATE VG Sbjct: 240 NLRGRLTLSFDEASAGVACNLDSPGFHVLCKATEEVVG 277 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,745,014 Number of Sequences: 27288 Number of extensions: 402483 Number of successful extensions: 1267 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1216 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1264 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1245572720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249493|gb|BI935021.1|BI935021 EST554910 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD21H11 5' end, mRNA sequence (777 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g52970.1 thylakoid lumen 15.0-kDa protein / SP:Q9LVV5; sim... 311 2e-85 >At5g52970.1 thylakoid lumen 15.0-kDa protein / SP:Q9LVV5; similar to unknown protein (pir||S77462); supported by cDNA: gi_15081647_gb_AY048216.1_ Length = 223 Score = 311 bits (797), Expect = 2e-85 Identities = 164/223 (73%), Positives = 185/223 (82%), Gaps = 4/223 (1%) Frame = +2 Query: 38 MASLFHLPSSL--TFSK-ICHSAIRASHSHSRVSVKNENPLPK-LSKFSSKTLNFLLSGS 205 MA LF P S +FS + + + R S SR+S+K +S+F SK+L+ + SG+ Sbjct: 1 MAMLFRPPPSQCRSFSPFVFNYSSREVSSSSRLSLKTSGDEENWVSRFRSKSLSLVFSGA 60 Query: 206 LALALSLTGVGIAEGLVGVNKPELLPKEFTSVIDVAGFLSDGQEKRLAQEITDIEKDTGF 385 LAL LSL+GVG A+ VGVNKPELLPKEFTSVIDVA FLS+GQEKR+AQEI ++EKDTGF Sbjct: 61 LALGLSLSGVGFADAKVGVNKPELLPKEFTSVIDVADFLSNGQEKRIAQEIANLEKDTGF 120 Query: 386 KLRVLAQNYPDTPGLAIKDFWQVDDRTIVFVADPTFGNILNFNVGATVDLDIPRSFWSRL 565 KLRVLAQNYP TPGLAIKDFWQVDD TIVFVADPTFGNILNFNVGATVDLDIPRSFWSRL Sbjct: 121 KLRVLAQNYPVTPGLAIKDFWQVDDSTIVFVADPTFGNILNFNVGATVDLDIPRSFWSRL 180 Query: 566 AGTYGNMFYWKEKGEDASIEAAVMAISSCLRETVGPNNCSEVK 694 AG YGNMFYWKEKGEDASIEAAVMAISSCLRE VG NNC+E++ Sbjct: 181 AGKYGNMFYWKEKGEDASIEAAVMAISSCLREPVGRNNCAEIQ 223 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,193,338 Number of Sequences: 27288 Number of extensions: 373483 Number of successful extensions: 1254 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1249 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1428015260 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249480|gb|BI935008.1|BI935008 EST554897 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD21D19 5' end, mRNA sequence (791 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g71820.1 expressed protein / ; supported by cDNA: gi_15028... 434 e-122 >At1g71820.1 expressed protein / ; supported by cDNA: gi_15028128_gb_AY046014.1_ Length = 752 Score = 434 bits (1117), Expect = e-122 Identities = 221/269 (82%), Positives = 247/269 (91%), Gaps = 6/269 (2%) Frame = +3 Query: 3 LVRAIRVVEMQEILDQQLAEEAAEAEGGGAMASVANPRRNAKKTT----SSKNLTQQKLK 170 LVRA+RVVEMQEILDQQLAEEAAEAEG GAMASVANPRR KK+T SSK L QQKLK Sbjct: 205 LVRALRVVEMQEILDQQLAEEAAEAEGEGAMASVANPRRPGKKSTTTSASSKGLAQQKLK 264 Query: 171 AQGKGYKDKCYESIRKSVEARFDKLLDE--QDLKTAIEEARVIGEELGEIYDYVAPCFPP 344 QGKGYKDKCYE IRK+VE RF++LL +DLK A+EEAR+IGEELG+IYDYVAPCFPP Sbjct: 265 VQGKGYKDKCYEQIRKAVEDRFNRLLTLVFEDLKAALEEARMIGEELGDIYDYVAPCFPP 324 Query: 345 RYEVFQLMVNLYTERFVQWLRKMSDQASNMTNIEILKVTGWVVDYQESLIELGVDDSLAQ 524 RYE+FQLMVNLYTERF+Q LR +SD+A+++TNIEILKVTGWVV+YQE+LI LGVDDSLAQ Sbjct: 325 RYEIFQLMVNLYTERFIQMLRLLSDRANDLTNIEILKVTGWVVEYQENLIALGVDDSLAQ 384 Query: 525 VCSESGAMDPLMNAYVERMQATTKKWYLNILEADQVQPPKKTDDGKLYTPAAVDLFRILG 704 VCSESG+MDPLMNAYVERMQATTKKWY+NILEAD+VQPPKKT++GKLYTPAAVDLFRILG Sbjct: 385 VCSESGSMDPLMNAYVERMQATTKKWYMNILEADKVQPPKKTEEGKLYTPAAVDLFRILG 444 Query: 705 EQVQIVRENSTDVMVYRIALALIQVNDDF 791 EQVQIVR+NSTDVM+YRIALA+IQV DF Sbjct: 445 EQVQIVRDNSTDVMLYRIALAIIQVMIDF 473 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,998,868 Number of Sequences: 27288 Number of extensions: 365991 Number of successful extensions: 1118 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1082 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1113 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1472363560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249444|gb|BI934972.1|BI934972 EST554861 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD21M2 5' end, mRNA sequence (779 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g62250.1 unknown protein / contains similarity to peroxida... 192 8e-53 >At1g62250.1 unknown protein / contains similarity to peroxidase isozyme GI:217933 from [Armoracia rusticana]; supported by cDNA: gi_17529073 Length = 267 Score = 192 bits (489), Expect(2) = 8e-53 Identities = 92/138 (66%), Positives = 113/138 (81%), Gaps = 1/138 (0%) Frame = +1 Query: 319 LLCRSQD-ATSPENEYRSSRNIAISLFRRYKNFLERGGGDNLKEFISAGVNAYALGCTDE 495 + C S++ + S ++EYRSS NIAISL RRY+ + RG G+ LKEFISAGVNAYALGCTDE Sbjct: 70 MFCNSRNNSISSDDEYRSSPNIAISLLRRYRTVIGRGEGETLKEFISAGVNAYALGCTDE 129 Query: 496 GLRKELFSLKESGVEIEAMETYGGSTSLKSKILSVEVDECIMWLSIIFITILCTPQPTIV 675 LRKEL ++K+SG+EIE ME YGGST KSKI EVDECI+WL I+FITILCTPQPT++ Sbjct: 130 DLRKELMAMKDSGLEIERMENYGGSTQTKSKITLSEVDECILWLRIVFITILCTPQPTVI 189 Query: 676 RWSSTSPVSDEMIVQWKG 729 RWSST VSDE++ +W+G Sbjct: 190 RWSSTPSVSDEILSKWRG 207 Score = 32.3 bits (72), Expect(2) = 8e-53 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 716 SSGKGFLCIIANAYFVRRMAW 778 S +GF +IANAY++R MAW Sbjct: 203 SKWRGFCAVIANAYYIRGMAW 223 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,743,596 Number of Sequences: 27288 Number of extensions: 401139 Number of successful extensions: 1207 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1207 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1436884920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249399|gb|BI934927.1|BI934927 EST554816 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD21E2 5' end, mRNA sequence (603 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g51740.1 Expressed protein / ; supported by full-length cD... 193 7e-50 >At1g51740.1 Expressed protein / ; supported by full-length cDNA: Ceres: 258340. Length = 310 Score = 193 bits (490), Expect = 7e-50 Identities = 90/133 (67%), Positives = 111/133 (82%) Frame = +1 Query: 205 MSKVRDRTEDFKDVAHRSALSLGYDESKTAALLASFIMHKPRQKSGFTRAALKTLESIGT 384 MS+ RDRTEDFKD SA+S+GY+ESK A+ +ASFI+HKP+++S FT+AA KTL+SI Sbjct: 1 MSRFRDRTEDFKDSVRNSAVSIGYNESKVASTMASFIIHKPKERSPFTKAAFKTLDSIKE 60 Query: 385 LEQFLMKHKKDYVDLHRTTEQERDSIEHEVTIFVKSCKEQIDVLRNSINEEDANSKGWLG 564 LE F++KH+KDYVDLHRTTEQE+DSIE EV F+K+CKEQID+L NSI E+ANSKGWLG Sbjct: 61 LELFMLKHRKDYVDLHRTTEQEKDSIEQEVAAFIKACKEQIDILINSIRNEEANSKGWLG 120 Query: 565 FEGDNLNADTIAH 603 DN NAD+IAH Sbjct: 121 LPADNFNADSIAH 133 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,973,538 Number of Sequences: 27288 Number of extensions: 280360 Number of successful extensions: 826 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 825 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 948861544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249346|gb|BI934874.1|BI934874 EST554763 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD21I19 5' end, mRNA sequence (775 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27180.1 hypothetical protein / predicted by genemark.hmm 282 1e-76 >At3g27180.1 hypothetical protein / predicted by genemark.hmm Length = 499 Score = 282 bits (722), Expect = 1e-76 Identities = 132/188 (70%), Positives = 155/188 (82%), Gaps = 3/188 (1%) Frame = +3 Query: 162 VAVPSVAVAVAPLPVNPNPS---LSCALNCTHFQSCSGCTQEYNLHHPVVIDEAIGFFNK 332 V+ P+ A VA +P+ P+ S L+C+L C HFQSCSGCTQE+NLH P V+DEA FF + Sbjct: 21 VSAPASAPFVASVPLPPSTSSDSLACSLQCPHFQSCSGCTQEFNLHRPAVVDEASDFFKR 80 Query: 333 LGIKDFSFDSCRLWGWRCRAKLAVRGSSTNPLIGLYEEGTHNVVDIPDCKSHHPNINAAV 512 G+ DF+FDSCRLWGWRCRAKLAVRGSS N LIGLY+EGTH VVDIP+CKSHHPNINAA+ Sbjct: 81 YGVDDFTFDSCRLWGWRCRAKLAVRGSSDNALIGLYQEGTHTVVDIPECKSHHPNINAAI 140 Query: 513 KLLKKGIIELNVEPYDEDQGTGDLRYVQMAVTTHDTSLPIPERYKNGKVQISLVWNSRSE 692 +LL++GI +V P+DEDQGTGDLRYVQMAVTTH T+L PERYKNGKVQ+SLVWNSR+E Sbjct: 141 ELLREGIKVFDVVPFDEDQGTGDLRYVQMAVTTHSTNLRAPERYKNGKVQVSLVWNSRNE 200 Query: 693 NSANTAKL 716 S N KL Sbjct: 201 RSHNADKL 208 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,501,242 Number of Sequences: 27288 Number of extensions: 436956 Number of successful extensions: 1392 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1370 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249301|gb|BI934829.1|BI934829 EST554718 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD21A19 5' end, mRNA sequence (755 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g01860.1 hypothetical protein / ; supported by cDNA: gi_1... 254 3e-68 >At4g01860.1 hypothetical protein / ; supported by cDNA: gi_19699002 Length = 1308 Score = 254 bits (650), Expect = 3e-68 Identities = 118/223 (52%), Positives = 163/223 (72%), Gaps = 1/223 (0%) Frame = +1 Query: 1 LSTIRSVFTNADQQDDLPSGSCAIGFSSSDFIIWNLISETKVLQVTCGGWRRPHSYFLGD 180 L+ ++SV +D P+ A GF+S+DFI+WNL +ETKV Q++CGGWRRPHS++LG+ Sbjct: 654 LNLVQSVCQGVQFSEDHPNNDYAAGFASTDFILWNLTAETKVTQISCGGWRRPHSFYLGE 713 Query: 181 VPEMKNCLAYVKDGVIYVHRHWVTTNERVMYPKNFHLQFHGREIHTICFISRDSLCSLNE 360 +PE +NC AYVKD VI++HRHWV + ++P N H QFHGRE+H++CFIS D+ + Sbjct: 714 IPEWQNCFAYVKDDVIHIHRHWVGGQKTKVFPLNLHTQFHGRELHSLCFISTDTKAGFDS 773 Query: 361 KQDTFSE-MIWVATGCEDGTVRLTRYASETENWSTSKLLGEHVGGSAVRSIFFVSRLHRM 537 ++ S+ W+ATGCEDG+VRL+RYASE NWSTS+LLGEHVGGSAVRS+ VS +H M Sbjct: 774 EESKISDRSSWIATGCEDGSVRLSRYASEFGNWSTSELLGEHVGGSAVRSVCCVSNMHMM 833 Query: 538 VLDASDVHESVNSEKWFLEDPEDCSLLISVGAKRVVTAWGTKN 666 D ++ + + + + ++D E LLISVGAKRVVT+W +N Sbjct: 834 SSDVPNLPDMCDQD-YAVDDCESPRLLISVGAKRVVTSWLLRN 875 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,271,994 Number of Sequences: 27288 Number of extensions: 391877 Number of successful extensions: 1101 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1071 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1098 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249266|gb|BI934794.1|BI934794 EST554683 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD20L10 5' end, mRNA sequence (696 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g54170.1 FKBP12 interacting protein (FIP37) / ; supported... 251 3e-67 >At3g54170.1 FKBP12 interacting protein (FIP37) / ; supported by cDNA: gi_3859943_gb_AF084570.1_AF084570 Length = 330 Score = 251 bits (640), Expect = 3e-67 Identities = 130/191 (68%), Positives = 157/191 (82%), Gaps = 3/191 (1%) Frame = +1 Query: 124 DLDFGGDFAA---TGRSGTKRSFGDLDDDEDDIFGSKKGNLLKVEETAPGAATGMILSLR 294 D DFGGD +A T SG +RSFGDL+DDEDDIFGS APG TGMILSLR Sbjct: 7 DDDFGGDDSAANATRASGNRRSFGDLEDDEDDIFGSTT--------VAPGVRTGMILSLR 58 Query: 295 ESLQDCKDNLASTQTELESAKSEILKWRSAFEKEPFIPPGMTPEPKFVVSYLQNIRSSEE 474 SL++CKD+LAS Q ELESAK+EI KW+SAF+ E F+P G +PEP+F++ Y+QN++SSE+ Sbjct: 59 GSLKNCKDDLASCQNELESAKTEIQKWKSAFQNESFVPAGKSPEPRFLIDYIQNLKSSEK 118 Query: 475 SLREQLERAKKKEAAFIVTFAKREQEIAELKSAVRDLRAQLKPPSMQARKLLLDPAIHEE 654 SL+EQLE AK+KEA+ IV +AKREQE+AELKSAVRDL++QLKP SMQAR+LLLDPAIHEE Sbjct: 119 SLKEQLEIAKRKEASCIVQYAKREQEMAELKSAVRDLKSQLKPASMQARRLLLDPAIHEE 178 Query: 655 FTRLKNLVEEK 687 F+RLKNLVEEK Sbjct: 179 FSRLKNLVEEK 189 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,973,777 Number of Sequences: 27288 Number of extensions: 322053 Number of successful extensions: 1460 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1357 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1447 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1201087980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249220|gb|BI934748.1|BI934748 EST554637 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD20D6 5' end, mRNA sequence (257 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13540.1 putative protein / HERC2 - Homo sapiens, EMBL:AF0... 165 4e-42 >At5g13540.1 putative protein / HERC2 - Homo sapiens, EMBL:AF071172 Length = 788 Score = 165 bits (418), Expect = 4e-42 Identities = 74/85 (87%), Positives = 81/85 (95%) Frame = +1 Query: 1 QVGDWVRVKASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKV 180 QVGDWVRVKASV SPKYGWEDITRNS+G++HSL+EDGDVGIAFCFRSKPFSCSVTDVEKV Sbjct: 280 QVGDWVRVKASVSSPKYGWEDITRNSIGVMHSLDEDGDVGIAFCFRSKPFSCSVTDVEKV 339 Query: 181 PPFEVGQEIHVLPSVSQPRLGWSNE 255 PF VGQEIH+ PS++QPRLGWSNE Sbjct: 340 TPFHVGQEIHMTPSITQPRLGWSNE 364 Score = 83.6 bits (205), Expect = 2e-17 Identities = 32/85 (37%), Positives = 55/85 (64%) Frame = +1 Query: 1 QVGDWVRVKASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKV 180 ++GDWVRVKAS+ +P Y W ++ +S G++H + EDGD+ ++FCF + + C ++E++ Sbjct: 662 KIGDWVRVKASITTPTYQWGEVNPSSTGVVHRM-EDGDLCVSFCFLDRLWLCKAGELERI 720 Query: 181 PPFEVGQEIHVLPSVSQPRLGWSNE 255 PF +G + + + PR GW E Sbjct: 721 RPFRIGDRVKIKDGLVTPRWGWGME 745 Score = 83.2 bits (204), Expect = 2e-17 Identities = 35/83 (42%), Positives = 55/83 (66%), Gaps = 1/83 (1%) Frame = +1 Query: 1 QVGDWVRVKASVPS-PKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEK 177 +VGDWVR K S+ + P Y W ++ R S+ ++HS++E G + +A CFR +S TD+EK Sbjct: 406 EVGDWVRSKPSLGNRPSYDWSNVGRESIAVVHSIQETGYLELACCFRKGRWSTHYTDLEK 465 Query: 178 VPPFEVGQEIHVLPSVSQPRLGW 246 +P +VGQ +H +++PR GW Sbjct: 466 IPALKVGQFVHFQKGITEPRWGW 488 Score = 61.6 bits (148), Expect = 7e-11 Identities = 29/84 (34%), Positives = 45/84 (53%) Frame = +1 Query: 4 VGDWVRVKASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKVP 183 VGDWV+ K + +P +GW+ SVG + ++ E D+ IAFC S +V K+ Sbjct: 22 VGDWVKFKRGITTPLHGWQGAKPKSVGFVQTILEKEDMIIAFC--SGEARVLANEVVKLI 79 Query: 184 PFEVGQEIHVLPSVSQPRLGWSNE 255 P + GQ + + V +PR GW + Sbjct: 80 PLDRGQHVRLRADVKEPRFGWRGQ 103 Score = 57.4 bits (137), Expect = 1e-09 Identities = 26/85 (30%), Positives = 45/85 (52%) Frame = +1 Query: 1 QVGDWVRVKASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKV 180 +VGDWVR++ ++ S K+G+ + S+GI++ + D + + + P+ C +VE V Sbjct: 145 KVGDWVRIRQNLTSAKHGFGSVVPGSMGIVYCVRPDSSLLVELSYLPNPWHCEPEEVEPV 204 Query: 181 PPFEVGQEIHVLPSVSQPRLGWSNE 255 PF SV++PR W E Sbjct: 205 APFR--------RSVAEPRYAWGGE 221 Score = 57.4 bits (137), Expect = 1e-09 Identities = 29/88 (32%), Positives = 47/88 (52%), Gaps = 5/88 (5%) Frame = +1 Query: 1 QVGDWVRVKASVPSPKYGWEDITRNSVGIIHSL-----EEDGDVGIAFCFRSKPFSCSVT 165 +VG+WVR++ V W+ + SVG++H + E DG ++FC + ++ + Sbjct: 533 EVGEWVRLREGVSC----WKSVGPGSVGVVHGVGYEGDEWDGTTSVSFCGEQERWAGPTS 588 Query: 166 DVEKVPPFEVGQEIHVLPSVSQPRLGWS 249 +EK VGQ+ V +V QPR GWS Sbjct: 589 HLEKAKKLVVGQKTRVKLAVKQPRFGWS 616 Score = 53.1 bits (126), Expect = 3e-08 Identities = 23/82 (28%), Positives = 48/82 (58%) Frame = +1 Query: 7 GDWVRVKASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKVPP 186 G VR++A V P++GW +R+SVG + ++EDG + + F S+ + ++E+V Sbjct: 84 GQHVRLRADVKEPRFGWRGQSRDSVGTVLCVDEDGILRVGFPGASRGWKADPAEMERVEE 143 Query: 187 FEVGQEIHVLPSVSQPRLGWSN 252 F+VG + + +++ + G+ + Sbjct: 144 FKVGDWVRIRQNLTSAKHGFGS 165 Score = 48.1 bits (113), Expect = 8e-07 Identities = 29/93 (31%), Positives = 42/93 (44%), Gaps = 17/93 (18%) Frame = +1 Query: 25 KASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKVPPF----- 189 + SV P+Y W T +SVG I +E DG + I R P+ +D+EK+ F Sbjct: 208 RRSVAEPRYAWGGETHHSVGKISEIENDGLLIIEIPNRPIPWQADPSDMEKIDDFKHVKS 267 Query: 190 ------------EVGQEIHVLPSVSQPRLGWSN 252 +VG + V SVS P+ GW + Sbjct: 268 FDSFNTEPLYHEQVGDWVRVKASVSSPKYGWED 300 Score = 47.0 bits (110), Expect = 2e-06 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 2/83 (2%) Frame = +1 Query: 4 VGDWVRVKASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKVP 183 VG RVK +V P++GW + SVG I +++ DG + I SK + ++VE + Sbjct: 598 VGQKTRVKLAVKQPRFGWSGHSHGSVGTISAIDADGKLRIYTPAGSKTWMLDPSEVETIE 657 Query: 184 PFE--VGQEIHVLPSVSQPRLGW 246 E +G + V S++ P W Sbjct: 658 EEELKIGDWVRVKASITTPTYQW 680 Score = 45.8 bits (107), Expect = 4e-06 Identities = 24/76 (31%), Positives = 40/76 (52%) Frame = +1 Query: 1 QVGDWVRVKASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKV 180 +VG +V + + P++GW +S GII ++ DG+V +AF + D+E Sbjct: 470 KVGQFVHFQKGITEPRWGWRAAKPDSRGIITTVHADGEVRVAFFGLPGLWRGDPADLEVE 529 Query: 181 PPFEVGQEIHVLPSVS 228 P FEVG+ + + VS Sbjct: 530 PMFEVGEWVRLREGVS 545 Score = 44.7 bits (104), Expect = 9e-06 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 1/84 (1%) Frame = +1 Query: 4 VGDWVRVKASVPSPKYGWEDITRNSVGIIHSLEEDGDVGIAFCFRSKPFSCSVTDVEKVP 183 VG + + S+ P+ GW + T ++G + ++ DG + R + S D E + Sbjct: 344 VGQEIHMTPSITQPRLGWSNETPATIGKVMRIDMDGTLSAQVTGRQTLWRVSPGDAELLS 403 Query: 184 PFEVGQEIHVLPSV-SQPRLGWSN 252 FEVG + PS+ ++P WSN Sbjct: 404 GFEVGDWVRSKPSLGNRPSYDWSN 427 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.137 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,590,241 Number of Sequences: 27288 Number of extensions: 134156 Number of successful extensions: 407 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 401 length of database: 11,516,596 effective HSP length: 61 effective length of database: 9,852,028 effective search space used: 236448672 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16249104|gb|BI934632.1|BI934632 EST554521 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD20M10 5' end, mRNA sequence (668 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47760.1 Not56-like protein / ; supported by cDNA: gi_162... 311 1e-85 >At2g47760.1 Not56-like protein / ; supported by cDNA: gi_16226530_gb_AF428424.1_AF428424 Length = 438 Score = 311 bits (798), Expect = 1e-85 Identities = 150/212 (70%), Positives = 180/212 (84%) Frame = +3 Query: 18 SSPAPAAMAAKAAAIRKSNRSENFIQKLVKNPKIPFAIAILIADAILVALIIAYVPYTKI 197 SSPA + +++NRS+ F K P +PFA A+++ADAILVALIIAYVPYTKI Sbjct: 5 SSPASLRASRSRRLGKETNRSDLF-----KKPAVPFAFALILADAILVALIIAYVPYTKI 59 Query: 198 DWDAYMSQVTGFLEGERDYSNLKGDTGPLVYPAGFLYIYSAIQYVTGGQVYPAQILFGFL 377 DWDAYMSQV+GFL GERDY NLKGDTGPLVYPAGFLY+YSA+Q +TGG+VYPAQILFG L Sbjct: 60 DWDAYMSQVSGFLGGERDYGNLKGDTGPLVYPAGFLYVYSAVQNLTGGEVYPAQILFGVL 119 Query: 378 YVLDLAIVLFIYLKTDVVPWWALSLLSLSKRVHSIFVLRLFNDCFATTLLHAALVSIICQ 557 Y+++L IVL IY+KTDVVPWWALSLL LSKR+HSIFVLRLFNDCFA TLLHA++ + + Sbjct: 120 YIVNLGIVLIIYVKTDVVPWWALSLLCLSKRIHSIFVLRLFNDCFAMTLLHASMALFLYR 179 Query: 558 KWHLGLVIFSGAVSIKMNVLLYAPPLVLLMVK 653 KWHLG+++FSGAVS+KMNVLLYAP L+LL++K Sbjct: 180 KWHLGMLVFSGAVSVKMNVLLYAPTLLLLLLK 211 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,933,424 Number of Sequences: 27288 Number of extensions: 325041 Number of successful extensions: 1020 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1001 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1020 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248961|gb|BI934489.1|BI934489 EST554378 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD20A17 5' end, mRNA sequence (745 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39680.1 hypothetical protein / 189 7e-57 >At4g39680.1 hypothetical protein / Length = 633 Score = 189 bits (480), Expect(2) = 7e-57 Identities = 106/215 (49%), Positives = 131/215 (60%), Gaps = 3/215 (1%) Frame = +2 Query: 5 DEAGGGSKEPAKRQRRWNTE--KTAEPQNSSIALTKKVVQPTPIKPILGRTNSTVGGDSP 178 D+ G+ EPAKR RRWN+ K E Q ++ A + T +K R++S+V D P Sbjct: 385 DQEAVGNNEPAKR-RRWNSNSIKVPEAQITNSATPTTTPRSTGLKRDFSRSDSSVSEDGP 443 Query: 179 KERFVPKSSKTATTSLKIENFLRPFTLKAVQELLARTGEVCSFWMDQIKTHCYVTYSSVE 358 KER VP S K T SL+I+ FLRPFTLKAVQELL +TG V SFWMD IKTHCYV+Y SVE Sbjct: 444 KERVVPPSPKEPTNSLRIDRFLRPFTLKAVQELLGKTGNVTSFWMDHIKTHCYVSYPSVE 503 Query: 359 EATETRNAVYNLQWPPNGGRLLVADFVDPQQVQTKIEGREPASPPKVTSPAVPASSFVQT 538 EA TR AVYNLQWPPNGGR L+A+FV ++V+ K+E P P A + + Sbjct: 504 EAAATREAVYNLQWPPNGGRHLIAEFVRAEEVKEKLEAPLPPQPQHQPQ----AQTLSRP 559 Query: 539 PPAQQQGRKQQAELEHSLTRQP-PPAPPSAPPTKE 640 PP A+ H + R P PP PP AP +E Sbjct: 560 PPTALPPPPPLAKPPHVVERLPLPPPPPIAPEEQE 594 Score = 49.3 bits (116), Expect(2) = 7e-57 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +1 Query: 670 DPPIVTLDDLFRKTKVTPRIYYLPL 744 +PPIVTLDDLF+KTK PRIYYLPL Sbjct: 594 EPPIVTLDDLFKKTKAIPRIYYLPL 618 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,771,768 Number of Sequences: 27288 Number of extensions: 486551 Number of successful extensions: 4337 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3438 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1330449000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248709|gb|BI934237.1|BI934237 EST554126 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD19O19 5' end, mRNA sequence (760 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g17033.1 Expressed protein / ; supported by cDNA: gi_13877... 187 5e-48 >At2g17033.1 Expressed protein / ; supported by cDNA: gi_13877876_gb_AF370201.1_AF370201 Length = 504 Score = 187 bits (475), Expect = 5e-48 Identities = 105/218 (48%), Positives = 141/218 (64%), Gaps = 1/218 (0%) Frame = +1 Query: 103 LSKQGHRFLSTLIATD-SDDISATRHLLRKFVGSSSKHVALSTLSHLVSPTTTSHYRLCS 279 L K G RFLS+L + + D SA ++KFV +S K VAL+ LSHL+S T SH L Sbjct: 88 LMKHGDRFLSSLSSPALAGDPSAINRHIKKFVAASPKSVALNVLSHLLSDQT-SHPHLSF 146 Query: 280 LALPLYLEISEASWFDWNSKLVAELVALLYKLERFDEAETLVTESVSKLGSRERDLCSFY 459 AL LY EI+EASWFDWN KL+AEL+ALL K ERFDE+ETL++ +VS+L S ERD F Sbjct: 147 FALSLYSEITEASWFDWNPKLIAELIALLNKQERFDESETLLSTAVSRLKSNERDFTLFL 206 Query: 460 SQLIYSQSKHNSERGVLDYCTKLKLVLLHSSSVYLKQRGYASMVEGFCLIGLPRKAEELM 639 L+ S SK S +G + +L+ ++ SSSVY+K + Y SMV G C + P AE ++ Sbjct: 207 CNLVESNSKQGSIQGFSEASFRLREIIQRSSSVYVKTQAYKSMVSGLCNMDQPHDAERVI 266 Query: 640 EEMKELGLKLSKFEFRSLVYSYGKSGYLRDMKRIVVEM 753 EEM+ +K FE++S++Y YG+ G DM R+V M Sbjct: 267 EEMRMEKIKPGLFEYKSVLYGYGRLGLFDDMNRVVHRM 304 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,686,721 Number of Sequences: 27288 Number of extensions: 385324 Number of successful extensions: 2631 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1829 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2595 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1374797300 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248526|gb|BI934054.1|BI934054 EST553943 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD18N19 5' end, mRNA sequence (613 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g02410.1 hypothetical protein / predicted by genscan 152 2e-37 >At2g02410.1 hypothetical protein / predicted by genscan Length = 152 Score = 152 bits (383), Expect = 2e-37 Identities = 72/89 (80%), Positives = 80/89 (88%), Gaps = 1/89 (1%) Frame = +1 Query: 349 KPATSYRKKKVEKEELPDDEEIYRDPTLALYYTNQ-VLDTVVPVLLVDGYNVCGYWPKLK 525 KPATSYRKKKVEK+ELPDD E+YRDPT LYYTNQ +LD VPVLLVDGYNVCGYW KLK Sbjct: 3 KPATSYRKKKVEKDELPDDSELYRDPTNTLYYTNQGLLDDAVPVLLVDGYNVCGYWMKLK 62 Query: 526 KHFMNGSLDIARQKLIDELVSFSLLREVK 612 KHFM G LD+ARQKL+DELVSFS+++EVK Sbjct: 63 KHFMKGRLDVARQKLVDELVSFSMVKEVK 91 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,101,216 Number of Sequences: 27288 Number of extensions: 318766 Number of successful extensions: 1156 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1089 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1153 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 963817488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248369|gb|BI933897.1|BI933897 EST553786 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD18O23 5' end, mRNA sequence (766 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80460.1 putative glycerol kinase / similar to GLYCEROL KI... 417 e-117 >At1g80460.1 putative glycerol kinase / similar to GLYCEROL KINASE GB:O69664 from [Mycobacterium tuberculosis] Length = 522 Score = 417 bits (1073), Expect = e-117 Identities = 206/255 (80%), Positives = 224/255 (87%) Frame = +1 Query: 1 TMLMNLKTLDWDKSTLDTLGISAKMLPKIISNSEIIGNIAKGWPITGIPISGCLGDQHAA 180 TMLMNLKTL WD+ TL TLGI A++LPKI+SNSE+IG I KGWPI GI I+GCLGDQHAA Sbjct: 200 TMLMNLKTLSWDQDTLKTLGIPAEILPKIVSNSEVIGEICKGWPIPGIKIAGCLGDQHAA 259 Query: 181 MVGQSCRKGEAKSTYGTGAFILLNTGEEVVKSNHGLLSTVAYKLGPKAPVNYALEGSIAI 360 M+GQ+CRKGEAKSTYGTGAFILLNTGE +KS HGLL+T+AYKLGP+A NYALEGSIAI Sbjct: 260 MLGQACRKGEAKSTYGTGAFILLNTGEVPIKSGHGLLTTLAYKLGPQAQTNYALEGSIAI 319 Query: 361 AGAAVQWLRDSLGIISSASEIEELASKVSSTGGVYFVPAFNGLFAPWWRDDARGVCIGIT 540 AGAAVQWLRDSLGII SASEIE+LA+ V STGGVYFVPAFNGLFAPWWR+DARGVCIGIT Sbjct: 320 AGAAVQWLRDSLGIIKSASEIEDLAAMVDSTGGVYFVPAFNGLFAPWWREDARGVCIGIT 379 Query: 541 RFTNKSHIARAVLESMCFQVKDVLDSMHKDAGTKDEAKSDKTEFLLRVDGGATINNLLMQ 720 RFTNKSHIARAVLESMCFQVKDVLDSM+KDAG K + K EFLLRVDGGAT NNLLMQ Sbjct: 380 RFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLNNGKGEFLLRVDGGATANNLLMQ 439 Query: 721 FRLTWWGSSVVRPAD 765 + GS VVRP D Sbjct: 440 IQADLMGSPVVRPVD 454 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.134 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,272,113 Number of Sequences: 27288 Number of extensions: 381846 Number of successful extensions: 1143 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1094 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1142 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1392536620 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248365|gb|BI933893.1|BI933893 EST553782 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD18O15 5' end, mRNA sequence (719 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g22640.1 unknown protein / ; supported by cDNA: gi_20453115 327 4e-90 At1g20290.1 hypothetical protein / predicted by genemark.hmm 52 4e-07 >At5g22640.1 unknown protein / ; supported by cDNA: gi_20453115 Length = 871 Score = 327 bits (838), Expect = 4e-90 Identities = 159/245 (64%), Positives = 194/245 (78%), Gaps = 7/245 (2%) Frame = +2 Query: 5 YTHDVDEEREMWLNSFYKAPLRLPMPAELEHWWSKDE-KPEFILLNKEPEPDPEDPSKLV 181 Y +VD+EREMWLNSFYKAPLRLPMPAELEHWW E PEF+LLNKEPEPDP DPSKLV Sbjct: 446 YVGEVDQEREMWLNSFYKAPLRLPMPAELEHWWENVEVTPEFVLLNKEPEPDPNDPSKLV 505 Query: 182 YTEDPVILHTPTGRIINYVEDEEHGLRLFWQPPVKEGEDVDPDKVEFLPLGFDEFYGRGG 361 EDPVILHTPTGRIINYVEDE+HG+RLFWQPP++EGE+VDP KVEFLPLGFDEFYG+ Sbjct: 506 QKEDPVILHTPTGRIINYVEDEKHGIRLFWQPPLEEGEEVDPSKVEFLPLGFDEFYGKEV 565 Query: 362 TVKSDSVWKRFVTSVENACKPMFDKLEKWTEEKKKAGEMKIELLKKELELAEAELSLKEA 541 VK + K FV +E + KPM D LEKWTEEKKKA E + E++++ELEL EAE+ L+EA Sbjct: 566 VVKKEHPIKSFVLGIEKSVKPMLDGLEKWTEEKKKAYEERKEMIQQELELVEAEICLEEA 625 Query: 542 LEDMDDELKRMQEEEEKKVAMGTQEEDD--IVPSESTDEL----EKTWAEKKEE*GRDED 703 +EDMD+ELK+ ++EEEKK MG EED+ +VP +++ EK K+EE +D+D Sbjct: 626 IEDMDEELKKKEQEEEKKTEMGLTEEDEDVLVPVYKEEKVVTAKEKIQENKQEEKYKDDD 685 Query: 704 EEDEE 718 +ED++ Sbjct: 686 DEDDD 690 >At1g20290.1 hypothetical protein / predicted by genemark.hmm Length = 497 Score = 51.6 bits (122), Expect = 4e-07 Identities = 34/116 (29%), Positives = 65/116 (55%) Frame = +2 Query: 371 SDSVWKRFVTSVENACKPMFDKLEKWTEEKKKAGEMKIELLKKELELAEAELSLKEALED 550 SDS + +F S+ + + + E+ EE+++ E + E ++E E E E +E E+ Sbjct: 341 SDSDFYKFTPSMVHVGEGTIVQAEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 400 Query: 551 MDDELKRMQEEEEKKVAMGTQEEDDIVPSESTDELEKTWAEKKEE*GRDEDEEDEE 718 ++E + +EEEE++ +EE++ E +E E+ E++EE +E+EE+EE Sbjct: 401 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 456 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,591,675 Number of Sequences: 27288 Number of extensions: 455653 Number of successful extensions: 4407 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 2719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3676 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1272263564 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248322|gb|BI933850.1|BI933850 EST553739 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD18G9 5' end, mRNA sequence (798 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g31210.1 DNA topoisomerase I, putative / Bacillus subtilis... 235 3e-73 >At4g31210.1 DNA topoisomerase I, putative / Bacillus subtilis DNA Topoisomerase I; PID:G520753 Length = 1179 Score = 235 bits (600), Expect(3) = 3e-73 Identities = 126/229 (55%), Positives = 154/229 (67%) Frame = +2 Query: 77 ELPGCQSAGRVQSAALSLICDREMEIDGFKPQEYWTVLVEFKKNKNLDLANNFLSSHLTH 256 +LPGC SAGRVQSAAL+L+CDRE EIDGFKPQEYWTV ++ K N + S+HLT Sbjct: 600 KLPGCPSAGRVQSAALALVCDRESEIDGFKPQEYWTVGIKVKGKDN----SATFSAHLTS 655 Query: 257 FDTKKLSQFSVSSHTEAMEIEGKINSSNFEVLSSKITKKQRNPSPPYITSTLQQDAANKL 436 ++K+L+Q S+SS A +IE +I S F V +K + ++NP PYITSTLQQDAANKL Sbjct: 656 LNSKRLNQLSISSEANAQDIEQRIKSEGFLVKGTKTSTTRKNPPTPYITSTLQQDAANKL 715 Query: 437 DFSSTYTMKLAQKLYEGIQLSDGKSTGLITYIRTDGLHISDEATKDIQSYISERYGQNFA 616 FS+ +TMK+A DEA KDIQS ++ERYG+NF Sbjct: 716 HFSTAHTMKIA-----------------------------DEAIKDIQSLVAERYGKNFT 746 Query: 617 SKNGRKYFKKVKNAQEAHEAIRTTDIRRLPSKLCRVLDDDALKLYKLIW 763 S + RKYFKKVKNAQEAHEAIR TDIRRLPS + +LD D+LKLY LIW Sbjct: 747 SDSPRKYFKKVKNAQEAHEAIRPTDIRRLPSTIASLLDADSLKLYTLIW 795 Score = 55.1 bits (131), Expect(3) = 3e-73 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 3 LVHAYLARRALDYLIGFNISPLLWR 77 LVHAYLARRALDYLIGFNISPLLWR Sbjct: 575 LVHAYLARRALDYLIGFNISPLLWR 599 Score = 24.3 bits (51), Expect(3) = 3e-73 Identities = 11/19 (57%), Positives = 12/19 (62%) Frame = +3 Query: 741 LSYTNLYGSRTMACQMEPA 797 L L SR +ACQMEPA Sbjct: 788 LKLYTLIWSRAVACQMEPA 806 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,230,797 Number of Sequences: 27288 Number of extensions: 399128 Number of successful extensions: 1203 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1200 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1476676124 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248244|gb|BI933772.1|BI933772 EST553661 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17H22 5' end, mRNA sequence (729 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g03560.1 putative calcium channel / ; supported by cDNA: g... 343 4e-95 >At4g03560.1 putative calcium channel / ; supported by cDNA: gi_13786068_gb_AF360372.1_AF360372 Length = 733 Score = 343 bits (881), Expect = 4e-95 Identities = 162/241 (67%), Positives = 195/241 (80%) Frame = +2 Query: 5 LKKAFSLIDDSNTGVLDKKQCILLFEELNKYRTLPKISGDDFESIFNELDDTGDFKINLE 184 L+KAF LID G +DK QCI LFE+L YRTLPKIS ++F IF+ELDDT DFKIN + Sbjct: 327 LEKAFGLIDSDKNGEIDKNQCIKLFEQLTNYRTLPKISKEEFGLIFDELDDTRDFKINKD 386 Query: 185 EFADLCTAIGLRFQKEDSLPIFEACPNFYHSAASEKLRDFVRGDTFEYIIVSVLLVNLVA 364 EFADLC AI LRFQKE+ +FE P YHSA S++LR FVR F Y I +L++N +A Sbjct: 387 EFADLCQAIALRFQKEEVPSLFEHFPQIYHSALSQQLRAFVRSPNFGYAISFILIINFIA 446 Query: 365 VIIETTLDIQNNSGQTFWQKVEFTFGWLYVIEMALKVYTYGFENYWRDGQNQFDFIVTWV 544 V++ETTLDI+ +S Q WQ EF FGW+YV+EMALK+YTYGFENYWR+G N+FDF+VTWV Sbjct: 447 VVVETTLDIEESSAQKPWQVAEFVFGWIYVLEMALKIYTYGFENYWREGANRFDFLVTWV 506 Query: 545 IVIGETATFVAPDDLTFLSNGEWIRYLLIARMLRLMRLLLHVERYRAFCATFLTLIPSLM 724 IVIGETATF+ PD+ TF SNGEWIRYLL+ARMLRL+RLL++V+RYRAF ATF+TLIPSLM Sbjct: 507 IVIGETATFITPDENTFFSNGEWIRYLLLARMLRLIRLLMNVQRYRAFIATFITLIPSLM 566 Query: 725 P 727 P Sbjct: 567 P 567 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,645,450 Number of Sequences: 27288 Number of extensions: 341718 Number of successful extensions: 1038 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 998 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1037 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1286100700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248241|gb|BI933769.1|BI933769 EST553658 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17H16 5' end, mRNA sequence (721 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04930.1 putative fatty acid desaturase / similar to D. me... 368 e-102 >At4g04930.1 putative fatty acid desaturase / similar to D. melanogaster Des-1 protein, GenBank accession number X94180, regulator of meiosis in spermatogenesis similar to human MLD protein, GenBank accession number AF002668, regulator of EGF receptor biosynthesis as a membrane-bound fatty acid desat Length = 332 Score = 368 bits (944), Expect = e-102 Identities = 175/220 (79%), Positives = 195/220 (88%) Frame = +3 Query: 45 EEEEGVRMANDFFWSYTDEPHASRRRQILSQYPQIKQLFGPDPFAFLKISGVVLLQLWTA 224 EE EGV MA DFFWSYTDEPHASRRRQILS YPQI+QLFGPDP+AFLKI+ VV+LQL TA Sbjct: 14 EEREGV-MATDFFWSYTDEPHASRRRQILSCYPQIRQLFGPDPWAFLKITLVVILQLSTA 72 Query: 225 TFLHDATWLKILIVAYFFGSFLNHNLFLAIHELSHNLAFSTPTYNRWLGIFANLPVGVPM 404 LH++ WLKIL +AYFFGSFLNHNLFLAIHELSHNLAFSTP YNR LGIFANLP+GVPM Sbjct: 73 AILHNSGWLKILSIAYFFGSFLNHNLFLAIHELSHNLAFSTPVYNRCLGIFANLPIGVPM 132 Query: 405 SVTFQKYHLEHHRFQGVDGIDMDIPSQTEAHVVKNVLAKSIWVILQLFFYAFRPLFLKPK 584 SVTFQKYHLEHHRFQGVDGIDMD+P+ TEAH+V N+ AK+IWV LQLFFYA RP+F+KPK Sbjct: 133 SVTFQKYHLEHHRFQGVDGIDMDVPTYTEAHLVTNIFAKTIWVFLQLFFYALRPIFIKPK 192 Query: 585 PPGLWEFINFTIQLSLDGAMVYFWGWKSLAYLILSTFCWG 704 PPG WEFINF IQ+ LD ++V F+GW+S AYLILSTF G Sbjct: 193 PPGYWEFINFLIQIVLDVSVVLFFGWRSFAYLILSTFVGG 232 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,839,155 Number of Sequences: 27288 Number of extensions: 420308 Number of successful extensions: 1136 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1086 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1135 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1272263564 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248189|gb|BI933717.1|BI933717 EST553606 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17N15 5' end, mRNA sequence (689 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03555.1 Expressed protein / ; supported by full-length cD... 252 2e-69 >At5g03555.1 Expressed protein / ; supported by full-length cDNA: Ceres: 7425. Length = 502 Score = 252 bits (644), Expect(2) = 2e-69 Identities = 127/168 (75%), Positives = 138/168 (81%), Gaps = 1/168 (0%) Frame = +1 Query: 160 MASSSINQFD-DEFHPDPTLTNDDLKPTSIDQRNFSGWEMSSLWIGLVVGVPSYYLAGSL 336 M S IN DE DP+LTNDDLKPT+ QR FS +MSSLWIGLVVGVP+YYLAGSL Sbjct: 1 MTGSEINDHGYDESQFDPSLTNDDLKPTTPSQRTFSWLDMSSLWIGLVVGVPTYYLAGSL 60 Query: 337 VDLGMSWWQGIAIVVLANLITLLPLVLIGQPGTKFGISFPVLARSSFGIRGAHIPTLLRA 516 VDLGM+WWQGIA VV ANLI L+PLVL QPGT +GISFPVLARSSFGIRGAHIPTLLRA Sbjct: 61 VDLGMAWWQGIATVVTANLILLVPLVLTAQPGTLYGISFPVLARSSFGIRGAHIPTLLRA 120 Query: 517 LVGCGWYGIETWIGGEAIFLLLPKVVKDSHLSQSISWLGTSPVEIWVF 660 LVGCGWYGIETWIGGEAIFLLLP +K S LS ++ WLGTSP+E F Sbjct: 121 LVGCGWYGIETWIGGEAIFLLLPGHIKKSALSHTLPWLGTSPLEFSCF 168 Score = 28.1 bits (61), Expect(2) = 2e-69 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 644 LKFGCFVTFWIAQL 685 L+F CF+ FW+AQL Sbjct: 163 LEFSCFIVFWLAQL 176 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,693,239 Number of Sequences: 27288 Number of extensions: 351687 Number of successful extensions: 1015 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1015 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1183294084 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248184|gb|BI933712.1|BI933712 EST553601 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17N5 5' end, mRNA sequence (670 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g03090.1 NDX1 homeobox protein homolog / 92 3e-19 >At4g03090.1 NDX1 homeobox protein homolog / Length = 925 Score = 91.7 bits (226), Expect = 3e-19 Identities = 72/218 (33%), Positives = 104/218 (47%), Gaps = 7/218 (3%) Frame = +3 Query: 3 LVEKALMGEPDMQRNKNLLEKWAVKLSDHGSEVTKSQLKNWLNNRKARLARAAKDGRVL- 179 ++EKAL EPD+QRN + WA K+S K ++ LNNRKA+LARA K Sbjct: 733 MIEKALAEEPDLQRNSASRQLWADKISQ------KFIIR--LNNRKAKLARANKQTGPAH 784 Query: 180 ---SEGDSLDKQGGLLTLLPCGSPGSPVEDVGILSAARENAPRLTGLAPSSTCLTENTTA 350 S GD + G T P +P++D + + TG EN Sbjct: 785 DNNSSGDLPESPGDENTWQQ--KPSTPIKDQTVTETPK------TG---------ENLMR 827 Query: 351 VPAASSEPAVCVAGDYVVLINEKAEEIGRGKVCQVSGKWYQRDLEELGTCVVDIIDLKVE 530 ++S E G V L++E+ +EIG+G V + G+W LE CVVD+++L Sbjct: 828 TSSSSEEGIK--QGQQVRLMDERGDEIGKGTVLRTDGEWNGLSLETRQICVVDVMELSES 885 Query: 531 RSAK---LPYPSELTGTSFDQAERKFGFMRVLWQSSKL 635 +PY S+ G +F +A +FG MRV W +KL Sbjct: 886 YDGSKKMIPYGSDDVGRTFTEANSRFGVMRVAWDVNKL 923 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,567,795 Number of Sequences: 27288 Number of extensions: 351450 Number of successful extensions: 1045 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1002 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1042 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248132|gb|BI933660.1|BI933660 EST553549 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17D7 5' end, mRNA sequence (785 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g18593.1 Expressed protein / ; supported by full-length cD... 105 4e-23 >At4g18593.1 Expressed protein / ; supported by full-length cDNA: Ceres: 29009. Length = 142 Score = 105 bits (261), Expect = 4e-23 Identities = 51/111 (45%), Positives = 68/111 (60%), Gaps = 1/111 (0%) Frame = +3 Query: 438 ISSDVDVSLSKETTSART-YRCKKCRRVVALQGNVVDHVPGEGETAFEWHKRRSGNPYNK 614 + D + SL + + YRCKKCRR+VA++ N+V H PG+GE F W K+RSGN Sbjct: 8 VEVDTNSSLQESLPKPQVMYRCKKCRRIVAIEENIVPHEPGKGEECFAW-KKRSGN---S 63 Query: 615 PDDECSSVFVEPLKWMRTVEEGAMEGKLLCAHCEARLGYLTGQAFNAVAGA 767 +CSS+FVEP+KWM+T+ +G +E KLLC C RLGY GA Sbjct: 64 EQVQCSSIFVEPMKWMQTIHDGMVEEKLLCFGCNGRLGYFNWAGMQCSCGA 114 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,542,343 Number of Sequences: 27288 Number of extensions: 429116 Number of successful extensions: 1168 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1167 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248108|gb|BI933636.1|BI933636 EST553525 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17M20 5' end, mRNA sequence (760 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g20410.1 putative protein / gamma-SNAP protein, bovine, PI... 348 2e-96 At3g56190.1 alpha-soluble NSF attachment protein / ; support... 49 2e-06 >At4g20410.1 putative protein / gamma-SNAP protein, bovine, PIR2:S32369;supported by full-length cDNA: Ceres:267158. Length = 291 Score = 348 bits (893), Expect = 2e-96 Identities = 169/235 (71%), Positives = 193/235 (81%) Frame = +1 Query: 43 MGSDPEKLISKADKLTKLSFTRWSIDWKSATGLYEQAANGFRLAKSYEKAKEAFEKASKG 222 M SDP+K++SKADK+TKL+ TRWS DW+ AT LYEQAANGFR + YEKAK A EKASKG Sbjct: 1 MSSDPDKMMSKADKMTKLTLTRWSADWRGATELYEQAANGFRASNKYEKAKVALEKASKG 60 Query: 223 QEMLSSPWDAAKHMESAATMAKELGNWKEVADFYRRASELYNECGRPQPASDALGKGARA 402 QEM +SPWDAAKHMESAA +A++L W EVADFYR+ASELY ECGR QPASDALGK ARA Sbjct: 61 QEMQASPWDAAKHMESAAALAQKLSIWNEVADFYRKASELYVECGRAQPASDALGKAARA 120 Query: 403 LEDGAPDVAVQLYTEACAILEEDGKEQMAFDLYRDAARVYLKLEKYEDAATILISLALAA 582 LED PD A+QLYT+AC ILEEDG++QMAFDLYR A VY+KLEK+ DAAT + L +AA Sbjct: 121 LEDVKPDDAIQLYTDACEILEEDGRDQMAFDLYRACANVYIKLEKFTDAATFFLRLGVAA 180 Query: 583 DKCSATHSQCKAYLSAIIVYLYAHDFKQAEKCYNDWCQGEVFLNSDQGRCAGNFL 747 DKC AT+SQCKAYLSAII+YLYAHD +QAEKCYND Q + FL SDQ R A L Sbjct: 181 DKCDATNSQCKAYLSAIILYLYAHDLQQAEKCYNDCSQIDAFLKSDQSRSASRLL 235 >At3g56190.1 alpha-soluble NSF attachment protein / ; supported by cDNA: gi_6013203_gb_AF177989.1_AF177989 Length = 289 Score = 49.3 bits (116), Expect = 2e-06 Identities = 45/169 (26%), Positives = 75/169 (43%), Gaps = 4/169 (2%) Frame = +1 Query: 79 DKLTKLSFTRWSI---DWKSATGLYEQAANGFRLAKSYEKAKEAFEKASKGQEMLSSPWD 249 +K + W I ++ A L E+AAN ++LAKS+++A +A+ K + S D Sbjct: 12 EKKAEKKLNGWGIFGSKYEDAADLLEKAANSYKLAKSWDQAGKAYLKLADCHLKSDSKHD 71 Query: 250 AAKHMESAATMAKELGNWKEVADFYRRASELYNECGRPQPASDALGKGARALE-DGAPDV 426 AA AA K++ + E A RA ++ E GR A+ + A E D + Sbjct: 72 AANAYAEAAKCYKKV-DTNEAASCLERAVNIFCEIGRLNMAARYYKEIAEYYESDQKFEQ 130 Query: 427 AVQLYTEACAILEEDGKEQMAFDLYRDAARVYLKLEKYEDAATILISLA 573 A+ + +A + + A A+ +LE+YE A I +A Sbjct: 131 AIAYFEKAAEFFQNEEVTTSANQCNLKVAQYAAQLEQYEKAIKIYEDIA 179 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.129 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,171,940 Number of Sequences: 27288 Number of extensions: 348316 Number of successful extensions: 1076 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1024 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1072 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1374797300 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248099|gb|BI933627.1|BI933627 EST553516 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17K20 5' end, mRNA sequence (777 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g31040.1 expressed protein / ; supported by full-length cD... 247 2e-78 >At2g31040.1 expressed protein / ; supported by full-length cDNA: Ceres: 35095. Length = 350 Score = 247 bits (631), Expect(2) = 2e-78 Identities = 130/222 (58%), Positives = 158/222 (70%), Gaps = 8/222 (3%) Frame = +3 Query: 12 YLSVTSTATPKSQESASNSSPTQKLPTKVILPKKKPMKWSTGDAPGEYGGPPTTTKLRKY 191 Y+S TST P Q+ SP +LPTK+ILP KKP KWSTG APGEYGGPPTTTKLRKY Sbjct: 6 YISATSTTPPIPQDQ----SPNSRLPTKIILPNKKPEKWSTGVAPGEYGGPPTTTKLRKY 61 Query: 192 WGEDK-DPLTSDDFIWNKEFMGRMKKYVQDPQEKDTVSRFSPAKEESSGFLSLNRVMSLD 368 WG +K DP+TS D IWN++FM +MKK DP + SP+KE+SSGFLS +RVMSLD Sbjct: 62 WGGEKEDPITSTDLIWNRDFMDQMKKLFDDPNDSSLDP--SPSKEKSSGFLSFSRVMSLD 119 Query: 369 SMEIDLTKKLITPSKPT----LDAEVEENKASVS---ASQKWRPAPTRREQEKWVRAAKA 527 SM++DL+K+L + SK LD E K +S S KW+ APTRREQEKW RA KA Sbjct: 120 SMDVDLSKELASSSKSVVKNRLDTSKSEAKKQMSKAIVSPKWKLAPTRREQEKWDRATKA 179 Query: 528 ATGGSEVLLRETRRSQEDPNILAAQSEEQYLKLKDKLQLLTL 653 ATGGS+V+ RE RR + DP + AA+ EQY KLK+K+Q+LTL Sbjct: 180 ATGGSDVMFRELRRPRGDPEVQAAKDREQYFKLKNKIQVLTL 221 Score = 63.2 bits (152), Expect(2) = 2e-78 Identities = 29/41 (70%), Positives = 35/41 (84%) Frame = +1 Query: 652 LGIGGVGIVSAYVSYSPENAASYGAGLLGIVMYMRMFGETV 774 LGIGGVG+VSAY+SY+PE A S+GAGLLG + YMRM G +V Sbjct: 221 LGIGGVGLVSAYISYTPEIALSFGAGLLGSLAYMRMLGNSV 261 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,892,132 Number of Sequences: 27288 Number of extensions: 414547 Number of successful extensions: 1378 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1372 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1428015260 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248032|gb|BI933560.1|BI933560 EST553449 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17M17 5' end, mRNA sequence (746 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22590.1 unknown protein / ; supported by cDNA: gi_17529301 207 1e-53 >At3g22590.1 unknown protein / ; supported by cDNA: gi_17529301 Length = 415 Score = 207 bits (526), Expect(2) = 1e-53 Identities = 113/216 (52%), Positives = 150/216 (69%), Gaps = 14/216 (6%) Frame = +2 Query: 95 MDPLTLLREYTIRNDLHKIVRIGDDYRFGNDYTFPCTIETAYRSKHVQANRYTLETLINF 274 MDPL++L+E+TIR D+ KI R+G +YRFG++Y+FPC ETAYRSK + YTLE L+++ Sbjct: 1 MDPLSVLKEFTIRGDIDKIERVGANYRFGSEYSFPCATETAYRSK--SGSLYTLEALVHY 58 Query: 275 ITNHHLKHTEYIQQSRSLRIPAVTLPDRKPLLDYLTGKTASSDSIEFLKFPQSNDTSVPV 454 + N LKH EY+Q + +PAVTLPDRKPLLDYLTG+ ASSDSI+FL Q N S Sbjct: 59 VKNQQLKHGEYMQSTVKNSVPAVTLPDRKPLLDYLTGRVASSDSIDFLLLQQQNAQSQKQ 118 Query: 455 SV--------SAGVTGNEENVMSDVRVL------ENQNPIELIKAAEKPLKDREAILFCK 592 + SA V + EN ++D+ V E+ + I LI++ E+PLK R+AIL CK Sbjct: 119 NEEYRPDQDNSAFV--SRENAIADMEVEDFGKSGEDVDYIMLIRSNERPLKSRDAILQCK 176 Query: 593 NRDFYSVFTAALRKDEERHRAESLQRKDGLVAKNRI 700 NRDFYSV + +++EER R ES QRKDGLVAK+R+ Sbjct: 177 NRDFYSVLVNSTKREEERQRIESHQRKDGLVAKSRL 212 Score = 20.8 bits (42), Expect(2) = 1e-53 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +3 Query: 714 GGGDEIGYD 740 GGGD+ GYD Sbjct: 226 GGGDDNGYD 234 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,443,198 Number of Sequences: 27288 Number of extensions: 384169 Number of successful extensions: 2352 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2262 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16248006|gb|BI933534.1|BI933534 EST553423 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD17G21 5' end, mRNA sequence (655 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g01350.1 NADC homolog / identical to GP|1216074|gnl|PID|e2... 323 5e-89 >At2g01350.1 NADC homolog / identical to GP|1216074|gnl|PID|e225599|F20096;supported by full-length cDNA: Ceres:2877. Length = 348 Score = 323 bits (828), Expect = 5e-89 Identities = 162/211 (76%), Positives = 181/211 (85%) Frame = +1 Query: 22 PRLVVKMSAMATKNAGRTVESLVVKPPAHPTYDLKGVIQLALSEDAGDLGDVSCKATIPV 201 PR VKMSA AT+ AG S+ +KPP+HPTYDLK VI+LAL+EDAG GDV+C ATIP Sbjct: 16 PRSFVKMSASATQTAGEV--SMGIKPPSHPTYDLKAVIKLALAEDAGHTGDVTCMATIPF 73 Query: 202 ELESEAYFIAKEDGIVAGIALAEMIFAEVDPSLKVEWFIKDGDKVHKGLKFGKVQGKAHN 381 ++E EAYF+AKEDGIVAG+ALA+MIF VDPSLKVEW KDGD VHKGLKFGKV G AH Sbjct: 74 DMEVEAYFLAKEDGIVAGVALADMIFEHVDPSLKVEWMRKDGDYVHKGLKFGKVSGNAHK 133 Query: 382 IVIAERVVLNFMQRMSGIATLTKAMADAAHPAYILETMKTAPGLRLVDKWAVLIGGGKNH 561 IV+AERV+LNFMQRMSGIATLTK MADAA PA ILET KTAPGLRLVDKWAVLIGGG+NH Sbjct: 134 IVVAERVLLNFMQRMSGIATLTKLMADAASPACILETRKTAPGLRLVDKWAVLIGGGRNH 193 Query: 562 RMGLFDMVMIKDNHISAAGSVSKALESVDQY 654 RMGLFDMVMIKDNHISAAG + A++SVD+Y Sbjct: 194 RMGLFDMVMIKDNHISAAGGIVNAVKSVDEY 224 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,296,902 Number of Sequences: 27288 Number of extensions: 352250 Number of successful extensions: 810 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 783 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 810 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1088756792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247964|gb|BI933492.1|BI933492 EST553381 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD16N20 5' end, mRNA sequence (774 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20280.1 hypothetical protein / predicted by genefinder 373 e-104 >At2g20280.1 hypothetical protein / predicted by genefinder Length = 371 Score = 373 bits (957), Expect = e-104 Identities = 192/261 (73%), Positives = 217/261 (82%), Gaps = 4/261 (1%) Frame = +3 Query: 3 KVVEDKTFGLKNKNKSKNVQKYVQSLQQNVVPKADPKKLDAKKKKEEEKAREKELSELFK 182 K VEDKTFGLKNKNKSKNVQKYVQSL+Q+V PK D K AKKKKEEEKARE+EL+ELFK Sbjct: 16 KQVEDKTFGLKNKNKSKNVQKYVQSLKQSVQPKPDATKAAAKKKKEEEKAREQELNELFK 75 Query: 183 VAISQPKVPLGVDPKSILCEFFKAGQCVKGFKCKFSHDLNVQRKGEKIDIFSDKRDEDGK 362 VAISQPKVP+GVDPKSILCEFFKAGQC KGFKCKFSHDLN+QRKGEKIDI+SD RDEDG Sbjct: 76 VAISQPKVPVGVDPKSILCEFFKAGQCQKGFKCKFSHDLNIQRKGEKIDIYSDTRDEDG- 134 Query: 363 ETMDDWDQETLEKVVASKSQEYNKNKPTDIVCKFFLDAVEKKQYGWFWACPN-GKECHYR 539 MD+WDQETLEKVV SK EYN+NKPTDIVCK+FLDAVEKKQYGWFW+CPN GKECHYR Sbjct: 135 -DMDEWDQETLEKVVESKKNEYNQNKPTDIVCKYFLDAVEKKQYGWFWSCPNGGKECHYR 193 Query: 540 HALPPGYILKSQMKALLQEEAD-KMPIEEELINSVQN*LLQLP*PLNYLWKMEKRRRKKE 716 HALPPGY+LKSQMKALL+EE+ K+ +E+E+ N + LQ + ME +R+K Sbjct: 194 HALPPGYVLKSQMKALLEEESSKKLAVEDEIEN--ERAKLQTATQMTPALFMEWKRKKIA 251 Query: 717 KPIFG--QQRADRAKNDRMSG 773 + G +A+RAKNDRMSG Sbjct: 252 ERDAGLAASQAERAKNDRMSG 272 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,980,820 Number of Sequences: 27288 Number of extensions: 388968 Number of successful extensions: 1979 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1718 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1940 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247923|gb|BI933451.1|BI933451 EST553340 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD16F8 5' end, mRNA sequence (774 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g08370.1 expressed protein / similar to hypothetical prote... 324 3e-89 >At1g08370.1 expressed protein / similar to hypothetical protein GB:AAC17938 GI:3169719 from [Arabidopsis thaliana]; supported by cDNA: gi_3169718_gb_AF007109.1_AF007109 Length = 367 Score = 324 bits (831), Expect = 3e-89 Identities = 167/226 (73%), Positives = 190/226 (83%) Frame = +1 Query: 58 MSQNGKLMPNLDQNSTKLLNLTVLQRIDPFIEEILITAAHVTLYEFSIDNSQWSRKDIEG 237 MSQNGK++PNLDQNST+LLNLTVLQRIDP+IEEILITAAHVT YEF+I+ SQWSRKD+EG Sbjct: 1 MSQNGKIIPNLDQNSTRLLNLTVLQRIDPYIEEILITAAHVTFYEFNIELSQWSRKDVEG 60 Query: 238 SLFVVKRSSQPRFQFIVMNRRNTDNLVEDLLGDFEYEIQLPYLLYRNASQEVNGIWFYNQ 417 SLFVVKRS+QPRFQFIVMNRRNTDNLVE+LLGDFEYE+Q PYLLYRNASQEVNGIWFYN+ Sbjct: 61 SLFVVKRSTQPRFQFIVMNRRNTDNLVENLLGDFEYEVQGPYLLYRNASQEVNGIWFYNK 120 Query: 418 RECEEVANLFDRILGAYSKVPTKSKVPLTKSEFEELEAVPTMAVIDGPLEPSSSTASDAP 597 RECEEVA LF+RIL AYSKV K K +KSEFEELEA PTMAV+DGPLEP SSTA DA Sbjct: 121 RECEEVATLFNRILSAYSKVNQKPKASSSKSEFEELEAKPTMAVMDGPLEP-SSTARDA- 178 Query: 598 HLPEDNSFVNFFSNALTIGNASNTAVQGQLPLGKSQRPYGSSLL*H 735 P+D +FVNFFS+ + +GN ++ G + PY SS + H Sbjct: 179 --PDDPAFVNFFSSTMNLGNTAS---------GSASGPYQSSAIPH 213 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,663,761 Number of Sequences: 27288 Number of extensions: 398131 Number of successful extensions: 1185 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1183 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247902|gb|BI933418.1|BI933418 EST553319 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD16B8 5' end, mRNA sequence (724 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g22010.1 unknown protein / 288 2e-78 >At2g22010.1 unknown protein / Length = 343 Score = 288 bits (737), Expect = 2e-78 Identities = 150/242 (61%), Positives = 183/242 (74%), Gaps = 5/242 (2%) Frame = +3 Query: 12 SVIYQKLLREVCLHDEELFSTFLNHLFNTLSWAMTEFSVSVREMQESYKVLEFQQRKCSV 191 S ++Q LLR+ C++D EL STFLN LFNTLSW +TEFSVSVREMQE Y+V+EFQQRKC V Sbjct: 42 STVFQALLRDACINDGELLSTFLNRLFNTLSWTITEFSVSVREMQEKYQVMEFQQRKCCV 101 Query: 192 IFDLSCNLARILEFCTHEIPQAFISGADTNLRRLTEVIVFILNHLISAADQELFDLCHSC 371 IF+LS NLAR+LEFCT+ +PQAF++G DTNLRRLTE+I+FILNH+ SA D E FDL S Sbjct: 102 IFELSSNLARVLEFCTYAMPQAFLAGTDTNLRRLTELILFILNHMTSAVDDEFFDL--SV 159 Query: 372 SFVRRPGQPPEKPNRGMILAPLAGIILNLLEASGESDTR-DNDMVGIFASMDCPDTVVSG 548 +RR GQP EK +RG++LAPL GIILNLLEAS +S + +D++G+FASMDCPDTV G Sbjct: 160 RSLRRQGQPSEKVSRGILLAPLVGIILNLLEASEDSKPKQQHDVIGLFASMDCPDTVYYG 219 Query: 549 FQYLLEYNWASLFRGDD-YLEKIRQLEIFSGLLICRSKVVESERIAYG---G*TDYDDSI 716 FQYLLEYNW GDD Y++K+ QLE F LI R+ E ER TD +D+ Sbjct: 220 FQYLLEYNWDGCVSGDDAYVKKLGQLENFLSHLINRASSQEPERKEESFNKDTTDIEDNT 279 Query: 717 CC 722 CC Sbjct: 280 CC 281 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,724,596 Number of Sequences: 27288 Number of extensions: 344175 Number of successful extensions: 918 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 895 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 915 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1268361380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247883|gb|BI933423.1|BI933423 EST553300 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD16N7 5' end, mRNA sequence (684 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39580.1 unknown protein / 177 6e-45 >At2g39580.1 unknown protein / Length = 1567 Score = 177 bits (448), Expect = 6e-45 Identities = 98/204 (48%), Positives = 135/204 (66%), Gaps = 1/204 (0%) Frame = +3 Query: 6 QALKLLARALEVNPTSAVVWIVYLLLYYSSQKSIGKDDMFKCAVEHAEGSYELWLLYINS 185 QAL LL++ LE +PTS ++W VYLL+Y++ + S GKD MF V+H+ SY +WL+YINS Sbjct: 950 QALSLLSQGLEGDPTSEILWAVYLLIYHAYEGSDGKD-MFSYGVKHSSRSYVIWLMYINS 1008 Query: 186 RTQLDERLAAYDAALLALCRHASVS-DRNALFGSDGILDILLQMMNCLCMSGNIATAIDK 362 R QL+++L AYD AL ALC HAS S DRN S ILD+LLQM N LC+SGN++ AI + Sbjct: 1009 RGQLNDQLIAYDTALSALCNHASGSIDRN--HASACILDVLLQMFNLLCISGNVSKAIQR 1066 Query: 363 INELYPTEEKSDSPFRLSLPDIITCLTISDKCVFWVCCVYLVVYRKLPVTVLQRFEYQKE 542 I++L SD P + I+TCLT SDK +YRKLP ++++R E +KE Sbjct: 1067 ISKLQAPAAVSDDPDFSLMSHILTCLTYSDK----------FIYRKLPDSIIRRLEMEKE 1116 Query: 543 LSSIDWPSTDLNFDEKQRGVSLME 614 L I+WP+ +L+ D KQ + L + Sbjct: 1117 LLEIEWPTVNLDGDLKQMALRLFD 1140 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,546,235 Number of Sequences: 27288 Number of extensions: 309600 Number of successful extensions: 899 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 865 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 895 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1165500188 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247765|gb|BI933293.1|BI933293 EST553182 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD16G10 5' end, mRNA sequence (716 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g37510.1 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) 76K cha... 390 e-109 >At5g37510.1 NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) 76K chain precursor - like protein / NADH dehydrogenase (ubiquinone) (EC 1.6.5.3) 76K chain precursor, potato, PIR:S52737; supported by cDNA: gi_15810150_gb_AY056140.1_ Length = 748 Score = 390 bits (1003), Expect = e-109 Identities = 196/240 (81%), Positives = 214/240 (88%), Gaps = 7/240 (2%) Frame = +1 Query: 16 MGLGLLASRALR-SSRIIRNST-----RTIVSTPELKNADAAAAAAAAADAPSD-LPKRN 174 MGLG+LASR +R +SR++++ T RTIVS PEL++ ++AA + + P+ LP RN Sbjct: 1 MGLGILASRTIRPASRLLQSQTSNFFLRTIVSKPELQSPESAAVSEP--EPPTQILPPRN 58 Query: 175 PVGGARVHLPNPDDVIEVFVDGYPVKIPKGMTVLQACEIAGVDIPRFCYHSRLSIAGNCR 354 PVGGARVH NP+D IEVFVDGY VK+PKG TVLQACE+AGVDIPRFCYHSRLSIAGNCR Sbjct: 59 PVGGARVHFSNPEDAIEVFVDGYAVKVPKGFTVLQACEVAGVDIPRFCYHSRLSIAGNCR 118 Query: 355 MCLVEVEKSPKPVASCAMPALPGMKIKTDTPIAKKAREGVMEFLLMNHPLDCPICDQGGE 534 MCLVEVEKSPKPVASCAMPALPGMKIKTDTPIAKKAREGVMEFLLMNHPLDCPICDQGGE Sbjct: 119 MCLVEVEKSPKPVASCAMPALPGMKIKTDTPIAKKAREGVMEFLLMNHPLDCPICDQGGE 178 Query: 535 CDLQDQSMAFGSDRGRFTEMKRSVVDKNLGPLVKTVMTRCIQCTRCVRFASEVAGVEGPG 714 CDLQDQSMAFGSDRGRFTEMKRSVVDKNLGPLVKTVMTRCIQCTRCVRFASEVAGV+ G Sbjct: 179 CDLQDQSMAFGSDRGRFTEMKRSVVDKNLGPLVKTVMTRCIQCTRCVRFASEVAGVQDLG 238 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,370,703 Number of Sequences: 27288 Number of extensions: 415889 Number of successful extensions: 1651 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1613 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1263366616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247692|gb|BI933220.1|BI933220 EST553109 tomato flower, anthesis Lycopersicon esculentum cDNA clone cTOD16E21 5' end, mRNA sequence (719 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34700.1 putative protein / ; supported by full-length cD... 191 3e-49 >At4g34700.1 putative protein / ; supported by full-length cDNA: Ceres: 18715. Length = 117 Score = 191 bits (486), Expect = 3e-49 Identities = 86/115 (74%), Positives = 101/115 (87%) Frame = +2 Query: 38 MSGIASVSFLARRASQRERVRILYRRALRDTLNWAVHRHLFYPDADALRERFEVNRKVED 217 MSG+++ ++ ARRA+Q+ERVRILYRRAL+DTLNWAVHRH+FY DA LRE+F VN+ VED Sbjct: 1 MSGVSTAAYFARRAAQKERVRILYRRALKDTLNWAVHRHIFYRDASDLREKFNVNQDVED 60 Query: 218 VETIDRLIADGEASYNKWRHPDPYIVPWAPGGSKFNRNPVPPEGIEIVYDYGKEE 382 V+ ID+LIA GEA YNKWRHPDPYIVPWAPGGSKF RNP PP GIEIVY+YG E+ Sbjct: 61 VDRIDKLIAHGEAEYNKWRHPDPYIVPWAPGGSKFCRNPTPPAGIEIVYNYGLED 115 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,986,324 Number of Sequences: 27288 Number of extensions: 358945 Number of successful extensions: 824 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 824 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1272263564 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247615|gb|BI933143.1|BI933143 EST553032 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC25E22 5' end, mRNA sequence (718 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07340.1 expressed protein / supported by full-length Cere... 193 7e-50 >At2g07340.1 expressed protein / supported by full-length Ceres cDNA: Ceres:34060. Length = 128 Score = 193 bits (491), Expect = 7e-50 Identities = 97/128 (75%), Positives = 113/128 (87%) Frame = +3 Query: 30 MADEANRTAFIEIQGRMIETTGKLKQVQTQIRNKETEKKRAYLTLEELKQLSDDTNTYKA 209 MADEA R AF+EIQ MIE TGKLKQVQ Q+RNKE ++KRA+LTLEEL+ L ++TNTYK+ Sbjct: 1 MADEATRAAFMEIQASMIELTGKLKQVQNQMRNKEGDRKRAFLTLEELRPLPEETNTYKS 60 Query: 210 IGRTFVLEPKAVLMNEQEQKLKDGETAIASLQTSKEYLEKHMAEVENNLRELLQQDPGLA 389 IGRTFVLEPK VL EQEQKLKD E A+ASLQTSKEYLEK +AEVENNLRELLQQ+PG+A Sbjct: 61 IGRTFVLEPKTVLEGEQEQKLKDSEAAVASLQTSKEYLEKQVAEVENNLRELLQQEPGIA 120 Query: 390 RQIMTMSV 413 +QIM+MS+ Sbjct: 121 QQIMSMSM 128 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,500,243 Number of Sequences: 27288 Number of extensions: 335304 Number of successful extensions: 1157 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1093 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1157 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1263366616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247515|gb|BI933043.1|BI933043 EST552932 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC25C5 5' end, mRNA sequence (706 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54520.1 expressed protein / ;supported by full-length cDN... 210 5e-55 At5g57345.1 Expressed protein / ; supported by full-length cD... 49 2e-06 >At1g54520.1 expressed protein / ;supported by full-length cDNA: Ceres:13758. Length = 391 Score = 210 bits (535), Expect = 5e-55 Identities = 132/244 (54%), Positives = 171/244 (69%), Gaps = 13/244 (5%) Frame = +2 Query: 11 AAAPFLLESNLKWN-PLFYTPNPIQCTRLIHYQKLTPSKFSKTSKLTVKCFSKNHKNVCF 187 +++ FL + +WN PL YT P T L++ + P + S + +L + K ++ Sbjct: 3 SSSTFLELTPFQWNQPLPYTQRPHHRTVLLYSK---PQRRSNSIRLQISV--KYKQSTSS 57 Query: 188 NDGDGLEVKNKENPFEIVVKSVMKALKALQKPAVAAVLVGLLLMYDPNSALAASGGRIGG 367 +D D +++ NPFE + V KAL +L+KPA+AAVL+GLLL YDPNSALAASGGRIGG Sbjct: 58 SDPD---LRSNFNPFEQIAIQVKKALDSLKKPAIAAVLLGLLLFYDPNSALAASGGRIGG 114 Query: 368 KSFSS---SRSSAPSRGYSM-RTAEPSFSYS---APYYAPSPFGFSGGGVYVGPAVGFG- 523 SFSS S SS+ S+ YS+ RT+ PSFSYS APYY PSPF GG +VGPAVGFG Sbjct: 115 NSFSSRSRSSSSSSSQSYSVPRTSNPSFSYSARTAPYYGPSPF----GGGFVGPAVGFGF 170 Query: 524 ---SSAFLVMMGFAAFIMVSGFLSDRS-EGSVLTATGKTSVLKLQVGLLGLGRSLQKDLN 691 SS L+++GFAAF++VSGFLSDRS + S+LT T KTSV+KLQVGLLGLGR+LQ+D N Sbjct: 171 GGFSSFSLILVGFAAFVLVSGFLSDRSQDDSILTDTQKTSVIKLQVGLLGLGRTLQQDFN 230 Query: 692 RIAE 703 R+AE Sbjct: 231 RLAE 234 >At5g57345.1 Expressed protein / ; supported by full-length cDNA: Ceres: 39314. Length = 188 Score = 49.3 bits (116), Expect = 2e-06 Identities = 42/123 (34%), Positives = 55/123 (44%), Gaps = 14/123 (11%) Frame = +2 Query: 272 LQKPAVAAVLVGLLLMYDPNSALAA-SGGRIGGKSFSSSRSSAPSR---------GYSMR 421 L K A+A + VG+L + A AA SGGRIGG++F SS P R + + Sbjct: 59 LAKLAIATLAVGVLALGSVGDAFAAKSGGRIGGQAFRSSAPRPPPRINNRSRTNIYVNPQ 118 Query: 422 TAEP---SFSYSAPYYAPSPFGFSGGGVYVGPAVGFGSSAFLVMMGF-AAFIMVSGFLSD 589 A P + Y Y SPF F G V VG G L+ M F AA + F Sbjct: 119 VAPPLIGGYGYGYGGYGWSPFSFFAPGPAVAVGVGGGFDLLLLFMFFGAASAVARNFFRS 178 Query: 590 RSE 598 R++ Sbjct: 179 RND 181 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,239,018 Number of Sequences: 27288 Number of extensions: 424472 Number of successful extensions: 1583 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1561 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1227778824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247411|gb|BI932939.1|BI932939 EST552828 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC24P5 5' end, mRNA sequence (725 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11040.1 putative protein / predicted proteins, Arabidopsi... 234 e-101 >At5g11040.1 putative protein / predicted proteins, Arabidopsis thaliana Length = 1186 Score = 234 bits (596), Expect(3) = e-101 Identities = 115/136 (84%), Positives = 129/136 (94%) Frame = +1 Query: 259 VIKAKKRRLGRAQKTIGDYCLLAGSPVDANAHYTTSLELARLTGDFFWYAGAMEGSVCAL 438 VIKAKKRRLGRAQKTIGDY LLAGSPVDANAHY+T+LELARLTGD+FWYAGA+EGSVCAL Sbjct: 207 VIKAKKRRLGRAQKTIGDYSLLAGSPVDANAHYSTALELARLTGDYFWYAGALEGSVCAL 266 Query: 439 LIDQMGQRDQFLDDEVKHRYNNVILHYRKSFIQDNAQRVSPLSFELEATLKLARYLCRKG 618 L+D+MGQRD L+DEV++RY NVILHYRKSFIQ+ AQRVSPLSFELEATLKLAR+LCR+ Sbjct: 267 LVDRMGQRDVALEDEVRYRYTNVILHYRKSFIQEIAQRVSPLSFELEATLKLARFLCRRE 326 Query: 619 VAKEVVDLLTTAADGA 666 +AKEVV+LLT AADGA Sbjct: 327 LAKEVVELLTNAADGA 342 Score = 139 bits (350), Expect(3) = e-101 Identities = 70/82 (85%), Positives = 75/82 (91%) Frame = +3 Query: 3 QRCFAFCPGDSQLEDESFKGSNLILFPPADRQTQEFHLQTMMQDIAASLLMKFEKSVLQA 182 +RCFAF PGDSQLED KG NLILFPP+D+QTQEFHLQTMMQDIAASLLM+FEK VLQA Sbjct: 126 RRCFAFSPGDSQLEDGDKKGENLILFPPSDKQTQEFHLQTMMQDIAASLLMEFEKWVLQA 185 Query: 183 ESGGTILKTPLDSQASLSSEEV 248 ES GTILKTPLDSQASL+SEEV Sbjct: 186 ESAGTILKTPLDSQASLNSEEV 207 Score = 34.7 bits (78), Expect(3) = e-101 Identities = 15/19 (78%), Positives = 19/19 (99%) Frame = +3 Query: 663 SKSLIDASDRLILFIEIAR 719 +KSLIDASDRLIL++E+AR Sbjct: 342 AKSLIDASDRLILYVEVAR 360 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,974,876 Number of Sequences: 27288 Number of extensions: 321038 Number of successful extensions: 676 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1277231040 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247379|gb|BI932907.1|BI932907 EST552796 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC24H3 5' end, mRNA sequence (673 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g64350.1 G-protein beta family / supported by cDNA: Ceres:... 273 6e-74 At2g30050.1 G-protein beta family / ;supported by full-lengt... 54 1e-07 At3g01340.1 transport protein SEC13, putative / similar to pr... 52 3e-07 >At1g64350.1 G-protein beta family / supported by cDNA: Ceres:35985; supported by cDNA: gi_13877918_gb_AF370222.1_AF370222 Length = 326 Score = 273 bits (698), Expect = 6e-74 Identities = 130/210 (61%), Positives = 164/210 (77%) Frame = +1 Query: 43 MDKAIIKLEEGTTCTAWNYSGHRLAAGSTDGTLFVFDSTDPASSVFSGSSKFKVHESSIV 222 M K++ L+ GTTC++WN SG RLAAGS +G L +++S+ +SS FS +SK +V ESSIV Sbjct: 1 MAKSMATLDSGTTCSSWNQSGDRLAAGSLNGKLSIYESSTSSSSTFSCTSKVRVSESSIV 60 Query: 223 KVVWAPPEYGDVVACICADGSLLLWEEVVEDSELLQWKLCKCFDRISSLVLDVQFGVSQT 402 K+VW P EYGD VAC+C DGSL +WEE+ ED+ L+WKLCK SS VLDVQFGVS+ Sbjct: 61 KIVWLPSEYGDAVACVCEDGSLSIWEELSEDAHGLEWKLCKSMKNKSSQVLDVQFGVSRK 120 Query: 403 SLKLVAAYSDGQVKVFELLDPFELKNWQLQAEFQNVIESVSKFGNVSCRSASIAWKSLKG 582 SLK+VAAYSDG ++VFELL+P ELKNWQLQAEFQNVI+S+S G S SAS++W +KG Sbjct: 121 SLKMVAAYSDGYLRVFELLNPLELKNWQLQAEFQNVIDSLSTLGKPSSLSASVSWNPMKG 180 Query: 583 EIQQSSFVLGFDSDTPHLNSLKVWGFDQDH 672 E Q+ SFVL F+SD+PHLNS K+W FD+ H Sbjct: 181 EEQEPSFVLAFNSDSPHLNSSKIWEFDEAH 210 >At2g30050.1 G-protein beta family / ;supported by full-length cDNA: Ceres:36577. Length = 302 Score = 53.5 bits (127), Expect = 1e-07 Identities = 33/119 (27%), Positives = 54/119 (44%) Frame = +1 Query: 94 NYSGHRLAAGSTDGTLFVFDSTDPASSVFSGSSKFKVHESSIVKVVWAPPEYGDVVACIC 273 +Y G R+A S+D T+ + ++ S + H + +V WA P+YG ++A Sbjct: 20 DYYGKRIATASSDCTIKITGVSNNGGS--QQLATLTGHRGPVWEVAWAHPKYGSILASCS 77 Query: 274 ADGSLLLWEEVVEDSELLQWKLCKCFDRISSLVLDVQFGVSQTSLKLVAAYSDGQVKVF 450 DG ++LW+E ++ QW F S V + + L L SDG + VF Sbjct: 78 YDGQVILWKEGNQN----QWTQDHVFTDHKSSVNSIAWAPHDIGLSLACGSSDGNISVF 132 >At3g01340.1 transport protein SEC13, putative / similar to protein transport protein SEC13 GB:P53024 (Pichia pastoris);supported by full-length cDNA: Ceres:37331. Length = 302 Score = 52.0 bits (123), Expect = 3e-07 Identities = 35/134 (26%), Positives = 60/134 (44%), Gaps = 4/134 (2%) Frame = +1 Query: 61 KLEEGTTCT----AWNYSGHRLAAGSTDGTLFVFDSTDPASSVFSGSSKFKVHESSIVKV 228 K+E G + T +Y G R+A S+D T+ + ++ S + H + +V Sbjct: 5 KIETGHSDTIHDVVMDYYGKRVATASSDCTIKITGVSNSGGSQHLAT--LTGHRGPVWQV 62 Query: 229 VWAPPEYGDVVACICADGSLLLWEEVVEDSELLQWKLCKCFDRISSLVLDVQFGVSQTSL 408 WA P++G ++A DG ++LW+E ++ QW F V + + + L Sbjct: 63 AWAHPKFGSLLASCSYDGQIILWKEGNQN----QWTQAHVFTDHKVSVNSIAWAPHELGL 118 Query: 409 KLVAAYSDGQVKVF 450 L SDG + VF Sbjct: 119 SLACGASDGNISVF 132 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,649,185 Number of Sequences: 27288 Number of extensions: 343212 Number of successful extensions: 1196 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 1130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1188 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1129912396 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247365|gb|BI932893.1|BI932893 EST552782 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC24D13 5' end, mRNA sequence (694 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g06430.1 putative protein / similar to unknown protein (sp... 186 1e-47 At4g37200.1 thiol-disulfide interchange like protein / 55 5e-08 >At5g06430.1 putative protein / similar to unknown protein (sp|P73920) Length = 194 Score = 186 bits (472), Expect = 1e-47 Identities = 93/171 (54%), Positives = 111/171 (64%) Frame = +1 Query: 169 STSKNSPFCLKWPWDVHNQNPKNPLPCTFETPWLFKPFKNLGSGVFNFIQNISKPEPLSP 348 STSK+ FCLKWPWD + Q + C F+ PWLF+ + +GS Sbjct: 11 STSKDPFFCLKWPWDSNKQPKSSSSVCDFQGPWLFRSMQTIGS----------------- 53 Query: 349 KFNLQSNGGVNQNNTLKLVKKKLTPTEQAELEQSALACALASEKEATVIEFYSPKCRLCN 528 L S QN + KK L+ +EQ E EQ A A ALAS+KEATV+EFYS KCRLCN Sbjct: 54 -IALSSLTSFGQNPNFRPKKKPLSSSEQGEAEQRAFAAALASQKEATVLEFYSHKCRLCN 112 Query: 529 SLVNFVTEVENRNSDWLNIVMADAENDQWLPELLHYDIKYVPCFVLLDKTG 681 SL+ FV EVE RNS+WL+I MADAEN++W PELLHYD+KYVPCFVLLDK G Sbjct: 113 SLLKFVLEVEKRNSNWLSITMADAENEKWFPELLHYDVKYVPCFVLLDKNG 163 >At4g37200.1 thiol-disulfide interchange like protein / Length = 261 Score = 54.7 bits (130), Expect = 5e-08 Identities = 29/83 (34%), Positives = 46/83 (54%), Gaps = 1/83 (1%) Frame = +1 Query: 436 ELEQSALACALA-SEKEATVIEFYSPKCRLCNSLVNFVTEVENRNSDWLNIVMADAENDQ 612 +L SAL A S + TV+EFY+ C +C L V ++E + D +N VM + +N + Sbjct: 123 DLTASALPYEEALSNGKPTVVEFYADWCEVCRELAPDVYKIEQQYKDKVNFVMLNVDNTK 182 Query: 613 WLPELLHYDIKYVPCFVLLDKTG 681 W EL + ++ +P F LD+ G Sbjct: 183 WEQELDEFGVEGIPHFAFLDREG 205 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,044,128 Number of Sequences: 27288 Number of extensions: 366532 Number of successful extensions: 1054 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1009 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1052 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1192191032 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247338|gb|BI932866.1|BI932866 EST552755 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC24M18 5' end, mRNA sequence (691 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g27530.1 expressed protein / Similar to gb|AF151884 CGI-12... 348 2e-96 >At1g27530.1 expressed protein / Similar to gb|AF151884 CGI-126 protein from Homo sapiens. EST gb|Z18048 comes from this gene; supported by full-length cDNA: Ceres: 1715. Length = 174 Score = 348 bits (893), Expect = 2e-96 Identities = 158/174 (90%), Positives = 168/174 (95%) Frame = +3 Query: 30 MEGWDPSTKTTLTQIPLLTIKAGPRDGAAWTQRLKEEYKALIAYTSMNKSKDNDWFRISA 209 MEGWDP+TK+TLT+IPLLT KAGPRDGAAWTQRLKEEYK+LIAYT MNKS DNDWFRISA Sbjct: 1 MEGWDPNTKSTLTRIPLLTTKAGPRDGAAWTQRLKEEYKSLIAYTQMNKSNDNDWFRISA 60 Query: 210 ANPEGTRWKGKCWYVHNLLKYEFDLQFDIPVTYPATAPELELPELDGKTEKMYRGGKICL 389 +NPEGTRW GKCWYVHNLLKYEFDLQFDIP+TYPATAPELELPE+DGKT+KMYRGGKICL Sbjct: 61 SNPEGTRWTGKCWYVHNLLKYEFDLQFDIPITYPATAPELELPEIDGKTQKMYRGGKICL 120 Query: 390 TVHFKPLWAKNCPRFGIAHALCLGLAPWLAAEIPVLVDSGMIKHKDDVATSSES 551 TVHFKPLWAKNCPRFGIAHALCLGLAPWLAAEIP+LVDSG IKHKDD ATS+ES Sbjct: 121 TVHFKPLWAKNCPRFGIAHALCLGLAPWLAAEIPILVDSGAIKHKDDAATSAES 174 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,343,292 Number of Sequences: 27288 Number of extensions: 377351 Number of successful extensions: 1057 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1056 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1183294084 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247297|gb|BI932825.1|BI932825 EST552714 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC24E22 5' end, mRNA sequence (705 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03780.1 unknown protein / 356 6e-99 >At2g03780.1 unknown protein / Length = 299 Score = 356 bits (914), Expect = 6e-99 Identities = 179/229 (78%), Positives = 202/229 (88%) Frame = +3 Query: 18 MKKARTMSTETHTESSMKDGFSKYAEYLNNLNDKRERVVKASRDITMNSKKVIFQVHRMS 197 +KKARTMSTE SSMKD FS YA+YLNN N+KRERVVK SRDITMNSKKVIFQVHR+S Sbjct: 50 VKKARTMSTE----SSMKDAFSTYADYLNNFNEKRERVVKVSRDITMNSKKVIFQVHRLS 105 Query: 198 KQNKEEVLDKAVKDLAAVTDQYLSRLVKELQGTDFWKLRRAYSPGVQEYVEAATLCNFCK 377 K NKEEVL+KA KDL AV DQ+ +RL+KELQGTDFWKLRRAYSPGVQEYVEAAT FC Sbjct: 106 KDNKEEVLEKAGKDLEAVRDQHFARLMKELQGTDFWKLRRAYSPGVQEYVEAATFYKFCL 165 Query: 378 TGTLLTLDEMNATLLPLSDPSVEPLQINILDYILGLADLTGELMRLAIGRISEGELDFAE 557 +GTL TLDE+N TL+PLSDPS+EPLQINILDYILGLADLTGELMR+AIGRIS+GE++FA+ Sbjct: 166 SGTLCTLDEINTTLVPLSDPSLEPLQINILDYILGLADLTGELMRMAIGRISDGEIEFAQ 225 Query: 558 KICSFVREIYRNLTLIAPEMDDSSDMKQKMETMLQSVMKIENACFSGHV 704 +IC FVR+I+R L L+ P+MDDS DMK KME MLQSV+KIENACFS HV Sbjct: 226 RICQFVRQIHRELMLVVPKMDDSYDMKSKMEVMLQSVIKIENACFSVHV 274 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,347,744 Number of Sequences: 27288 Number of extensions: 293784 Number of successful extensions: 920 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 919 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1227778824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247200|gb|BI932728.1|BI932728 EST552617 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC24C23 5' end, mRNA sequence (767 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20830.1 expressed protein / ; supported by cDNA: gi_1343... 305 2e-83 >At2g20830.1 expressed protein / ; supported by cDNA: gi_13430685_gb_AF360255.1_AF360255 Length = 297 Score = 305 bits (780), Expect = 2e-83 Identities = 148/255 (58%), Positives = 191/255 (74%) Frame = +2 Query: 2 MLKLMLACCKVYISESRNRGALESIEKAAKLFPESPIINKFEDEIYNRVGYTLVSKISPN 181 ML+ ML CCKVYISE+RN+ ALE+IE+A K FP + I+NKFED Y RVGYT+VS ++ Sbjct: 1 MLREMLGCCKVYISEARNKTALEAIERALKPFPPAAIVNKFEDAAYGRVGYTVVSSLANG 60 Query: 182 SSSGSCSLTLKNASFAMVKAAFETIDLQEHCGTHPRLGVVDHICFHPLGTTSLDMVADTA 361 SSS +LKNA FAMVK A +TI+L+ HCG+HPRLGVVDHICFHPL TS++ V+ A Sbjct: 61 SSS-----SLKNAVFAMVKTALDTINLELHCGSHPRLGVVDHICFHPLSQTSIEQVSSVA 115 Query: 362 KTLAFEVGSNLKVPTFLYGAAQQEGRSLDSIRRELGYFHPNSSENQWIGGTKLETLQLKP 541 +LA ++GS L+VPT+LYGAA++E +LDSIRR+LGYF N ++W GG LE + LKP Sbjct: 116 NSLAMDIGSILRVPTYLYGAAEKEQCTLDSIRRKLGYFKANREGHEWAGGFDLEMVPLKP 175 Query: 542 DEGPPHATQAKGVITIGATRWVDNYNIPVFTNDISIVRKIAKRVSGRRGGLPSVQSMGVT 721 D GP ++AKGV+ +GA WV NYN+PV +ND+ VR+IA++ S R GGL SVQ+M + Sbjct: 176 DAGPQEVSKAKGVVAVGACGWVSNYNVPVMSNDLKAVRRIARKTSERGGGLASVQTMALV 235 Query: 722 HGSGTI*VALHLLEP 766 HG G I VA +LL P Sbjct: 236 HGEGVIEVACNLLNP 250 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,233,184 Number of Sequences: 27288 Number of extensions: 415287 Number of successful extensions: 1396 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1392 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1401406280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247178|gb|BI932706.1|BI932706 EST552595 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23P20 5' end, mRNA sequence (750 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66330.1 expressed protein / ;supported by full-length cDN... 122 2e-28 >At1g66330.1 expressed protein / ;supported by full-length cDNA: Ceres:269548. Length = 417 Score = 122 bits (306), Expect = 2e-28 Identities = 72/139 (51%), Positives = 87/139 (61%) Frame = +1 Query: 331 CGKLSNRVIFRGSPVLCLSTETRDTETECARNSDDCSNISSVQENDQATTVGKVIPSSQA 510 C K V R LC +++DTET S + + Q K SSQ Sbjct: 53 CTKTVTFVSSRRCSTLCFVGKSQDTETN--------SQVVQKEGEKQVMPRRKSSNSSQL 104 Query: 511 IAEACKFAYNDAKFVNERAKNDIVLLSREIMRMDARARQDVAFLGSEVLKLDARAREDTE 690 + E + NDAKFVNERA+ND VLLSR IMR+DARARQDVA LGS LKLDARAREDTE Sbjct: 105 LVE---YVSNDAKFVNERARNDFVLLSRGIMRLDARARQDVAILGSGFLKLDARAREDTE 161 Query: 691 KVDHNVKKRAERIQHVATI 747 K+D +VK++AER+ H+ATI Sbjct: 162 KIDRDVKRKAERLHHIATI 180 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,817,886 Number of Sequences: 27288 Number of extensions: 407961 Number of successful extensions: 1110 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1056 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1107 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247145|gb|BI932673.1|BI932673 EST552562 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23J22 5' end, mRNA sequence (706 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20430.1 unknown protein / 181 4e-46 >At3g20430.1 unknown protein / Length = 265 Score = 181 bits (458), Expect = 4e-46 Identities = 100/194 (51%), Positives = 133/194 (68%), Gaps = 8/194 (4%) Frame = +2 Query: 98 MELEDSILNFSDEDESFEDDEDVKMNDIEEGELV---EKISKTGLEETGDVCASSENPLP 268 ME E+S+L+ +E++ FE+ EDV+M D+EEGE+V + S + GD E L Sbjct: 1 MEGEESLLDAINEEDGFENLEDVEMVDVEEGEIVVDHDLDSGERQNDDGDGVKDKEAIL- 59 Query: 269 GKKNRRRRKNKGKNKSKRVS-SGPITD----INRFVLDVGRRLKERKSYLIWNAVGCLGL 433 G+KN ++ NK K K K+ GP+ D ++ FV D RRLKE+KSY+I+ AVGCLG+ Sbjct: 60 GEKNGLQQTNKNKRKKKKKKRKGPVMDKPMSVDWFVRDTCRRLKEKKSYMIYTAVGCLGI 119 Query: 434 SALSDLVKEVDAIQTCGGQKTADGRRFRTGGGILWSILKVRDPNAYKEIMKKGKEFEKQF 613 +ALSDLV EV AI+TCGGQ TADG R RT GG+LW+I+K R P AY+EIMKK KEFEKQF Sbjct: 120 AALSDLVNEVVAIETCGGQVTADGTRKRTSGGVLWNIIKARQPEAYREIMKKTKEFEKQF 179 Query: 614 RQANLKQEPPPNKE 655 RQ N + + P ++ Sbjct: 180 RQPNTRPKSGPKRD 193 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,150,765 Number of Sequences: 27288 Number of extensions: 382460 Number of successful extensions: 2632 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2516 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1227778824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247117|gb|BI932645.1|BI932645 EST552534 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23D24 5' end, mRNA sequence (694 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05480.1 hypothetical protein / predicted by genemark.hmm 312 1e-85 >At3g05480.1 hypothetical protein / predicted by genemark.hmm Length = 420 Score = 312 bits (799), Expect = 1e-85 Identities = 146/213 (68%), Positives = 177/213 (82%) Frame = +3 Query: 6 ARSITCLARIGNEVAIQASSTQLTFHTLNSSRSAYQSITFKPDYFDVFTVSAPQVQCSVL 185 +RSI CLAR+GNE+ +QAS TQL HTLN+SRSAYQ ITF+ +FDV+TVS PQ SVL Sbjct: 14 SRSIICLARVGNELVVQASPTQLALHTLNASRSAYQCITFQSSFFDVYTVSGPQAHFSVL 73 Query: 186 LKAICSVLRTPIASIDHLTVSLPNPDASKVQWTLNCHNGMRKAYWITCNVEPDIQHLSLD 365 LKA+CSVLRTP+ASIDH++V LP+ DASKV+WTL C++GM+K YWITCNVEPDIQHLSLD Sbjct: 74 LKAVCSVLRTPLASIDHMSVQLPDHDASKVKWTLQCYSGMKKTYWITCNVEPDIQHLSLD 133 Query: 366 RRKLPSNFVVRPRDLNRLLSNFQTTLQEITIIATNPTCLPPDTATEIGGKAVELRSYIDP 545 R + PS V+ PR+L++LL NFQ++LQEITIIAT+ T P D A+EIGGKAVE RSY+DP Sbjct: 134 RGRFPSTLVMHPRNLSKLLGNFQSSLQEITIIATDQTSFPSDAASEIGGKAVEFRSYVDP 193 Query: 546 TKENDSSLHTQLWIDPTEEFVQYNHITNPVDVT 644 TK+ DS LHTQLWIDP+EEF+QY H + VT Sbjct: 194 TKDGDSLLHTQLWIDPSEEFLQYTHAVTILSVT 226 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,796,243 Number of Sequences: 27288 Number of extensions: 339993 Number of successful extensions: 832 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 832 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1192191032 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247061|gb|BI932589.1|BI932589 EST552478 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23J11 5' end, mRNA sequence (718 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24160.1 putative protein / CGI-58 protein - Homo sapiens,... 313 4e-91 At1g64670.1 expressed protein / ;supported by full-length cDN... 52 2e-07 At5g41900.1 putative protein / strong similarity to unknown p... 52 3e-07 At5g38520.1 putative protein / similar to unknown protein (pi... 48 5e-06 >At4g24160.1 putative protein / CGI-58 protein - Homo sapiens,PID:g4929585 Length = 407 Score = 313 bits (803), Expect(2) = 4e-91 Identities = 148/177 (83%), Positives = 162/177 (90%), Gaps = 1/177 (0%) Frame = +2 Query: 98 SSATADGAKRWSF-WPSSLRWIPTSTDHIIAAEKRLLSLVRTPYTQEQVNIGSGPPGSKV 274 S+AT RW WP+SLRWIPTSTD+IIAAEKRLLS+++TPY QEQV+IGSGPPGSK+ Sbjct: 26 SAATNAAKSRWKILWPNSLRWIPTSTDYIIAAEKRLLSILKTPYVQEQVSIGSGPPGSKI 85 Query: 275 RWFRSVSNEPRFINTVTFDSKEGSPTLVMVHGYGASQGFFFRNFDALAKHFKVIAIDQLG 454 RWFRS SNE R+INTVTFD+KEG+PTLVMVHGYGASQGFFFRNFDALA F+VIAIDQLG Sbjct: 86 RWFRSTSNESRYINTVTFDAKEGAPTLVMVHGYGASQGFFFRNFDALASRFRVIAIDQLG 145 Query: 455 WGGSSRPDFTCKSTEETENWFIDSFEEWR*AKNLSNFILLGHSFGGYVAAKYALKHP 625 WGGSSRPDFTC+STEETE WFIDSFEEWR A+NLSNFILLGHSFGGYVAAKYALKHP Sbjct: 146 WGGSSRPDFTCRSTEETEAWFIDSFEEWRKAQNLSNFILLGHSFGGYVAAKYALKHP 202 Score = 39.3 bits (90), Expect(2) = 4e-91 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = +3 Query: 624 PERVQQLILVGPAGFTSQTEHMSERMTQFRA 716 PE VQ LILVG AGF+++ + SE +T+FRA Sbjct: 202 PEHVQHLILVGSAGFSAEADAKSEWLTKFRA 232 >At1g64670.1 expressed protein / ;supported by full-length cDNA: Ceres:11266. Length = 469 Score = 52.4 bits (124), Expect = 2e-07 Identities = 40/128 (31%), Positives = 62/128 (48%), Gaps = 9/128 (7%) Frame = +2 Query: 287 SVSNEPRFINTVTFDSKEGSPTLVMVHGYGASQGFF----FRNFDALAK-HFKVIAIDQL 451 S SN+ F+N + +V +HG+ +S F+ F NF AK +++ +A+D L Sbjct: 163 SSSNQSLFVNVQQPTDNKAQENVVFIHGFLSSSTFWTETLFPNFSDSAKSNYRFLAVDLL 222 Query: 452 GWGGSSRPD---FTCKS-TEETENWFIDSFEEWR*AKNLSNFILLGHSFGGYVAAKYALK 619 G+G S +P+ +T K E E I F L F L+ HS G +A A+K Sbjct: 223 GYGKSPKPNDSLYTLKEHLEMIERSVISQFR-------LKTFHLVAHSLGCILALALAVK 275 Query: 620 HP*ACSAV 643 HP A ++ Sbjct: 276 HPGAIKSL 283 >At5g41900.1 putative protein / strong similarity to unknown protein (gb|AAF19684.1) Length = 471 Score = 52.0 bits (123), Expect = 3e-07 Identities = 39/132 (29%), Positives = 65/132 (48%), Gaps = 10/132 (7%) Frame = +2 Query: 278 WFRSVSNEPRFINTVT-FDSKEGSPTLVMVHGYGASQGFF----FRNFDALAK-HFKVIA 439 W S + + F+ D+K+ +V +HG+ +S F+ F NF AK +++ IA Sbjct: 167 WLTSTNRDSLFVKVQQPKDNKKARDNVVFIHGFVSSSAFWTETLFPNFSDSAKSNYRFIA 226 Query: 440 IDQLGWGGSSRPD---FTCKS-TEETENWFIDSFEEWR*AKNLSNFILLGHSFGGYVAAK 607 +D LG+G S +P+ +T + E E I F+ L F ++ HS G +A Sbjct: 227 VDLLGYGRSPKPNDSLYTLREHLEMIEKSVISKFK-------LKTFHIVAHSLGCILALA 279 Query: 608 YALKHP*ACSAV 643 A+KHP A ++ Sbjct: 280 LAVKHPGAIKSL 291 >At5g38520.1 putative protein / similar to unknown protein (pir||S75227);supported by full-length cDNA: Ceres:22. Length = 362 Score = 48.1 bits (113), Expect = 5e-06 Identities = 29/79 (36%), Positives = 43/79 (53%), Gaps = 4/79 (5%) Frame = +2 Query: 311 INTVTFDSKE----GSPTLVMVHGYGASQGFFFRNFDALAKHFKVIAIDQLGWGGSSRPD 478 +N DS E S T+++VHG+GAS + RN +AL+K+ V AID LG+G S +P Sbjct: 75 VNYFVKDSPEEVTPASQTVLLVHGFGASIPHWRRNINALSKNHTVYAIDLLGFGASDKPP 134 Query: 479 FTCKSTEETENWFIDSFEE 535 + E ++ EE Sbjct: 135 GFSYTMESWAELILNFLEE 153 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,399,157 Number of Sequences: 27288 Number of extensions: 368073 Number of successful extensions: 1032 Number of sequences better than 1.0e-05: 8 Number of HSP's better than 0.0 without gapping: 987 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1022 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1263366616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16247031|gb|BI932559.1|BI932559 EST552448 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23D15 5' end, mRNA sequence (762 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g05385.1 Expressed protein / ; supported by cDNA: gi_13877... 183 1e-46 >At1g05385.1 Expressed protein / ; supported by cDNA: gi_13877958_gb_AF370242.1_AF370242 Length = 199 Score = 183 bits (464), Expect = 1e-46 Identities = 96/151 (63%), Positives = 117/151 (76%), Gaps = 2/151 (1%) Frame = +2 Query: 314 GFASPLVSLLTYSCSLKV--LPAWAEDQEIQDKDESVVGAIKSLFDPNETTKSGKVLPKA 487 GF +V ++ +++ L A A ++++ D+ E VVGA K+LFDPNE TKSGK LPKA Sbjct: 43 GFLKCVVGASSFMATIEFSGLQAQASEEKL-DEGEGVVGAFKTLFDPNERTKSGKELPKA 101 Query: 488 YLNSVREVVKTLRESLKEDPNDMSKFRRTADAAKESIREYLGGWRGQKSVVNEESYVLLE 667 YL S REVVKT+RESLKE+P D +KFRR+ADAAKESIR+YL WRGQK+V EESYV LE Sbjct: 102 YLKSAREVVKTMRESLKENPKDNAKFRRSADAAKESIRDYLSNWRGQKTVAGEESYVELE 161 Query: 668 KAIRSLASFYSKAGPSAALPERVKSEILDDL 760 IR+LA FYSKAGPSA LP+ VK+EILDDL Sbjct: 162 NVIRALAKFYSKAGPSAPLPDEVKTEILDDL 192 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,684,389 Number of Sequences: 27288 Number of extensions: 367767 Number of successful extensions: 1136 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1136 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1383666960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246978|gb|BI932506.1|BI932506 EST552395 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23I18 5' end, mRNA sequence (688 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16810.1 hypothetical protein / 202 2e-52 >At5g16810.1 hypothetical protein / Length = 351 Score = 202 bits (513), Expect = 2e-52 Identities = 119/217 (54%), Positives = 140/217 (63%), Gaps = 23/217 (10%) Frame = +3 Query: 6 SFAARSSSSSFCGIGLRLNLNSNINRTIRPRQAFVGLCVASLITDSDSFEVGRLIGSYGF 185 S R S F G R+ + NR IR A ASLIT +DSFEVGRLIGSYGF Sbjct: 18 SLKHRESGDGFSGC--RIVNSRGRNRPIRRLHAVT----ASLITSADSFEVGRLIGSYGF 71 Query: 186 MNVTS-----------------------YSGLQSGMAMDYAVSEDIGNFKVQDIGEGSVK 296 MNVTS Y+GLQSG +Y S+DIG K QDIGEG+VK Sbjct: 72 MNVTSFTLLSAAVFYFVYLAFHHFYTPSYTGLQSGSDFEYT-SDDIGRLKSQDIGEGAVK 130 Query: 297 IRLYEGRVAQGPLRGTRVIFKVYPGQQVGGTEADMMAANELNAHASLQSNPKDICPHIQA 476 IRLY+GR++QGP RGT V+FKVYPGQ+ GG EADMMAANELNAH+ LQS K + ++ Sbjct: 131 IRLYQGRISQGPFRGTPVVFKVYPGQRAGGVEADMMAANELNAHSFLQS--KSLPANLLL 188 Query: 477 LLGGFETKTGEQWLAFRDIGKYSAADYAKITSENMSK 587 L+GGFET+ GEQWLAFRD GK SAADYA+ SE ++ Sbjct: 189 LVGGFETQLGEQWLAFRDGGKDSAADYAQTASEKTTR 225 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,808,586 Number of Sequences: 27288 Number of extensions: 362999 Number of successful extensions: 1018 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 987 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1015 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1174397136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246952|gb|BI932480.1|BI932480 EST552369 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23E12 5' end, mRNA sequence (717 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g36630.1 hypothetical protein / ; supported by cDNA: gi_20... 325 1e-89 >At4g36630.1 hypothetical protein / ; supported by cDNA: gi_20466825 Length = 519 Score = 325 bits (833), Expect = 1e-89 Identities = 156/230 (67%), Positives = 191/230 (82%), Gaps = 1/230 (0%) Frame = +3 Query: 30 MVHTAYDTFQLLNNSPSKIDAIESYRSNLLIACSDGSLRVYVP-ESSVSDQSDFHSETLG 206 MVH AYD+FQLL + P++IDA+ESY S L C DGSLR+Y P ESS SD S+ H ET Sbjct: 1 MVHNAYDSFQLLKDCPARIDAVESYGSKLFAGCYDGSLRIYSPPESSASDPSELHQET-- 58 Query: 207 LHQGPYVLERTLNGFSRRQMLAMEVLVSRELLLSLSESIALHRLPDLETLSVITKAKGAN 386 YVLE+T+ GFS++ ++AMEVL SRELLLSLSESIA H LP+LET++VITKAKGAN Sbjct: 59 -----YVLEKTVAGFSKKPIVAMEVLASRELLLSLSESIAFHGLPNLETVAVITKAKGAN 113 Query: 387 VYSWDDKRGLLCFGRQKRVCIYKHDGGSGFVEVKEFGVPDTVKSMSWCGENICLGIRREY 566 YSWDD+RG LCF RQKRVC++KHDGG GFVEV+++GVPDTVKS+SWCGENICLGI++EY Sbjct: 114 AYSWDDRRGFLCFSRQKRVCVFKHDGGGGFVEVRDYGVPDTVKSISWCGENICLGIKKEY 173 Query: 567 KILNTTNGVLSEVFSSGRIAAPLVVALPPGELLLGQDNIGILVNKTGKLI 716 ILNT NG LSEVF SGR+A PLV++LP GEL+LG++NIG+ V++ GKL+ Sbjct: 174 VILNTANGTLSEVFPSGRVAPPLVISLPSGELILGKENIGVFVDQNGKLL 223 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,804,049 Number of Sequences: 27288 Number of extensions: 430154 Number of successful extensions: 1247 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1186 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1245 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1263366616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246942|gb|BI932470.1|BI932470 EST552359 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23C12 5' end, mRNA sequence (751 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g15980.1 expressed protein / ;supported by full-length cDN... 387 e-108 >At1g15980.1 expressed protein / ;supported by full-length cDNA: Ceres:122986. Length = 461 Score = 387 bits (994), Expect = e-108 Identities = 188/251 (74%), Positives = 206/251 (81%), Gaps = 2/251 (0%) Frame = +1 Query: 4 ISPFFANPPNFPVTHVTNVP--FLNHNPSFPARKSGNFCLNAKKKNPWLDPFDYGDDPEM 177 ISPFF PP T+ P FLN +R S KK NPWLDPFD G+DP+ Sbjct: 12 ISPFFKTPP-----FSTSKPLVFLNFQTRLTSRSSDVSVNLKKKNNPWLDPFDSGEDPDN 66 Query: 178 EYGSLFSEGKQDEDPRPPDNPDNPYGFLKFPMGYSVEIASLGLKIRGDVRRCCCVIDGGV 357 EYGSLF++GKQDEDPRPPDNPDNPYGFLKFP GY+VE+ASL LKIRGDVRRCCCVI GGV Sbjct: 67 EYGSLFADGKQDEDPRPPDNPDNPYGFLKFPKGYTVELASLPLKIRGDVRRCCCVISGGV 126 Query: 358 YENLLFFPVIQMIKDRYPGVQVDILATARGKQTFEMNKNVRWANAYDLDDDFPEPAEYTD 537 YENLLFFP IQ+IKDRYPGVQVDIL T RGKQT+E+NKNVRWAN YD DD +PEPAEYTD Sbjct: 127 YENLLFFPTIQLIKDRYPGVQVDILTTERGKQTYELNKNVRWANVYDPDDHWPEPAEYTD 186 Query: 538 MLGILKSRYYDMILSTKLAGIGHAVFLFMSTARDRVSYIYPNVNSAGAGLFLSETFTPES 717 M+G+LK RYYDM+LSTKLAG+GHA FLFM+TARDRVSYIYPNVNSAGAGL LSETFT E+ Sbjct: 187 MIGLLKGRYYDMVLSTKLAGLGHAAFLFMTTARDRVSYIYPNVNSAGAGLMLSETFTAEN 246 Query: 718 MNLSEGGYHMY 750 NLSE GY MY Sbjct: 247 TNLSELGYSMY 257 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,509,181 Number of Sequences: 27288 Number of extensions: 448261 Number of successful extensions: 1381 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1376 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246915|gb|BI932443.1|BI932443 EST552332 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23M21 5' end, mRNA sequence (769 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74470.1 geranylgeranyl reductase / identical to geranylge... 437 e-123 >At1g74470.1 geranylgeranyl reductase / identical to geranylgeranyl reductase GB:Y14044 [Arabidopsis thaliana] (involvement: chlorophyll, the tocopherol and the phylloquinone pathways Eur J Biochem 1998 Jan 15;251(1-2):413-7); supported by cDNA: gi_15292918_gb_AY050893.1_ Length = 467 Score = 437 bits (1124), Expect = e-123 Identities = 212/254 (83%), Positives = 230/254 (90%) Frame = +2 Query: 2 KPCGGAIPLCMVGEFDLPLDIIDRKVTKMKMISPSNVAVDIGQTLKPHEYIGMVRREVLD 181 KPCGGAIPLCMVGEF+LPLDIIDR+VTKMKMISPSN+AVDIG+TLK HEYIGMVRREVLD Sbjct: 92 KPCGGAIPLCMVGEFNLPLDIIDRRVTKMKMISPSNIAVDIGRTLKEHEYIGMVRREVLD 151 Query: 182 AYLRDRAAEAGASVLNGLFLRMDMPKAPNSPYVLHYTSYDSKTNGAGEKCTLEVDAVIGA 361 AYLR+RA ++GA+V+NGLFL+MD P+ +SPY LHYT YD KT G K T+EVDAVIGA Sbjct: 152 AYLRERAEKSGATVINGLFLKMDHPENWDSPYTLHYTEYDGKTGATGTKKTMEVDAVIGA 211 Query: 362 DGANSRVAKSINAGDYEYAIAFQERIRISDDKMKYYENLAEMYVGDDVSPDFYGWVFPKC 541 DGANSRVAKSI+AGDY+YAIAFQERIRI D+KM YYE+LAEMYVGDDVSPDFYGWVFPKC Sbjct: 212 DGANSRVAKSIDAGDYDYAIAFQERIRIPDEKMTYYEDLAEMYVGDDVSPDFYGWVFPKC 271 Query: 542 DHVAVGTGTVTHKADIKKFQLATRLRADSKITGGKIIRVEAHPIPEHPRPRRLQDRVALV 721 DHVAVGTGTVTHK DIKKFQLATR RA KI GGKIIRVEAHPIPEHPRPRRL RVALV Sbjct: 272 DHVAVGTGTVTHKGDIKKFQLATRNRAKDKILGGKIIRVEAHPIPEHPRPRRLSKRVALV 331 Query: 722 GDAAGYVTKCQAKG 763 GDAAGYVTKC +G Sbjct: 332 GDAAGYVTKCSGEG 345 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,747,071 Number of Sequences: 27288 Number of extensions: 448842 Number of successful extensions: 1333 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1275 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1333 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1401406280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246874|gb|BI932402.1|BI932402 EST552291 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC23E13 5' end, mRNA sequence (697 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27340.1 hypothetical protein / predicted by genemark.hmm 179 1e-45 >At3g27340.1 hypothetical protein / predicted by genemark.hmm Length = 141 Score = 179 bits (454), Expect = 1e-45 Identities = 82/119 (68%), Positives = 102/119 (84%) Frame = +3 Query: 33 PRLTRFALQPPKFVEVEFENGSLYKLSAEYLRIYSPAVDSKIRSICGEKVISGRRHVGIM 212 P+L+ F++ PK VEVE+ +G+ + S+E+LRI+SPA D K+RSI GEKVISGRR+VGIM Sbjct: 21 PKLSGFSIVSPKQVEVEYADGTKFNFSSEFLRIHSPAADGKVRSIGGEKVISGRRYVGIM 80 Query: 213 SAEPIGNYGVRLLFDDLHKTGIFTWDYFYHLGSNKFALMRNYIRTLKKHGLSRDPPRRR 389 SAEP+GNYGVRL+FDDLH+TGI+ WDYFY LGSNKF LMRNYI+TL+KH LSR+PP R Sbjct: 81 SAEPVGNYGVRLVFDDLHRTGIYPWDYFYELGSNKFGLMRNYIKTLQKHNLSREPPPSR 139 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,062,927 Number of Sequences: 27288 Number of extensions: 314735 Number of successful extensions: 718 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 718 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1201087980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|16246799|gb|BI932327.1|BI932327 EST552216 tomato flower, 8 mm to preanthesis buds Lycopersicon esculentum cDNA clone cTOC22F8 5' end, mRNA sequence (702 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g21200.1 expressed protein / ;supported by full-length cD... 255 2e-68 >At3g21200.1 expressed protein / ;supported by full-length cDNA: Ceres:39041. Length = 317 Score = 255 bits (651), Expect = 2e-68 Identities = 125/207 (60%), Positives = 160/207 (76%), Gaps = 3/207 (1%) Frame = +3 Query: 81 PIVRNSHGKPFPAEVSRTILELSSVGTLSTPTQDGWPLGIAVPFAVDPHGTPLLFLNHST 260 P ++H KPFPAEVSR+I+ELSSVGTLST T DGWPLG+ V FAVD GTP+L LN S Sbjct: 51 PATASTH-KPFPAEVSRSIMELSSVGTLSTLTHDGWPLGVGVRFAVDKDGTPVLCLNRSV 109 Query: 261 SNFALNSKSSFLVQLQQYGLRTPQCTIQGTLQKP---TALKMLHSLWENRFGHQVDDDRL 431 S + +S+ VQL+Q GLRTPQCTIQG++ +P T LK L + W +FG +V +D L Sbjct: 110 SP---DKRSALHVQLEQCGLRTPQCTIQGSIGRPGDDTVLKRLSATWREKFGEEVKEDSL 166 Query: 432 FLLSVERVLQMDDFAEDGIWVTSEEYKSANPDPLRDFAERMIDEINTNNREDILRFCNIY 611 ++++V+RVLQM+DF EDGIWV S +YK+A+PDPLRD AE ++++IN NN EDI RFCN+Y Sbjct: 167 YVVAVDRVLQMEDFMEDGIWVASSDYKNASPDPLRDIAEDIVNQINANNMEDIFRFCNVY 226 Query: 612 LDLDFQVCDGKMLWGDRLGFDVRVSSP 692 +DLDF V + KM+W DRLGFD+RV SP Sbjct: 227 VDLDFVVSETKMIWMDRLGFDLRVWSP 253 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,378,122 Number of Sequences: 27288 Number of extensions: 368505 Number of successful extensions: 1151 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1096 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1147 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1218881876 frameshift window, d