BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA10A15.yg.ab1 (508 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79140.1 unknown protein / 123 1e-39 >At1g79140.1 unknown protein / Length = 311 Score = 123 bits (309), Expect(2) = 1e-39 Identities = 59/104 (56%), Positives = 77/104 (73%) Frame = +1 Query: 133 RDLLXNDXXXXXXXXXIAKYQPYASDPNLSGAFATVLWELSGLSKHYHPSVSTMASGISN 312 R+LL ND IAKYQPYA+DPNLSGA ATVLWELS LSKHYHP++STMA+ +SN Sbjct: 137 RNLLENDAGGGSVSGSIAKYQPYATDPNLSGALATVLWELSLLSKHYHPAISTMATTVSN 196 Query: 313 MANANNQGYGASISPQQAFSDMTLDKEKFTVKTTQKQSNSKRKR 444 M + +Q + ++++PQQAF+D +L KE F K ++ N+KRKR Sbjct: 197 MNTSQSQTFLSAVTPQQAFADFSLVKESFEPKNESRKLNNKRKR 240 Score = 56.2 bits (134), Expect(2) = 1e-39 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 18 QRAAAFIKRLASFSLCFGAAESMAALVTLKHLLXK 122 Q+AAAF+KRLA+F+LCFG AESM+ALVTLK LL K Sbjct: 98 QKAAAFVKRLATFALCFGCAESMSALVTLKTLLQK 132 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.131 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,909,590 Number of Sequences: 27288 Number of extensions: 225122 Number of successful extensions: 748 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 748 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 684463600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA10F21.yg.ab1 (560 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g33270.1 expressed protein / contains Patatin domain PF01734 66 1e-11 >At1g33270.1 expressed protein / contains Patatin domain PF01734 Length = 364 Score = 65.9 bits (159), Expect = 1e-11 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +3 Query: 9 RELFNWALEPAADSILDNLYELGYMDAAVWAASNPVEDLVQEDNLT 146 R+L NWALEPA D +L+ L+ELGY DAA WA NPVE LV +D T Sbjct: 312 RQLLNWALEPAEDEVLERLFELGYADAATWAEMNPVEGLVYDDTPT 357 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,021,749 Number of Sequences: 27288 Number of extensions: 217510 Number of successful extensions: 569 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 567 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 835029516 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA10O14.yg.ab1 (297 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done ***** No hits found ****** Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.141 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,188,532 Number of Sequences: 27288 Number of extensions: 57108 Number of successful extensions: 98 Number of sequences better than 1.0e-05: 0 Number of HSP's better than 0.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 11,516,596 effective HSP length: 74 effective length of database: 9,497,284 effective search space used: 227934816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA11C07.yg.ab1 (378 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05000.1 unknown protein / similar to GB:CAB05547 [Caenorh... 89 8e-19 >At3g05000.1 unknown protein / similar to GB:CAB05547 [Caenorhabditis elegans] Length = 173 Score = 88.6 bits (218), Expect = 8e-19 Identities = 42/64 (65%), Positives = 52/64 (80%), Gaps = 2/64 (3%) Frame = +2 Query: 2 EPSTE--TRGSATEAGNKAAETTGMHLYFPCGIIRGALSNMGIPCAVSADISNLPACSFV 175 +PS+E T+ +T +KAA+ M+LYFPCGIIRG LSN+GIPCAVSADIS+LP CSFV Sbjct: 109 DPSSENETQDPSTPGESKAAQAVSMYLYFPCGIIRGVLSNLGIPCAVSADISSLPTCSFV 168 Query: 176 IRIK 187 IR+K Sbjct: 169 IRVK 172 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,290,716 Number of Sequences: 27288 Number of extensions: 163659 Number of successful extensions: 427 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 427 length of database: 11,516,596 effective HSP length: 87 effective length of database: 9,142,540 effective search space used: 347416520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA11D11.yg.ab1 (440 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g16810.1 expressed protein / ;supported by full-length cDN... 99 7e-22 >At1g16810.1 expressed protein / ;supported by full-length cDNA: Ceres:4887. Length = 144 Score = 99.4 bits (246), Expect = 7e-22 Identities = 49/81 (60%), Positives = 63/81 (77%), Gaps = 7/81 (8%) Frame = +2 Query: 11 EEELNDGSSSKAKGGAHV-------DSLTPAEKRYMEQRQKIDMQKMAKTSNKSHRDRLS 169 +EE+N S KA A + D LTPAE+RY+EQ+Q++D+QK+AK +NKSHR+R+ Sbjct: 66 DEEMN--RSEKASEDAKLQQQLDDDDHLTPAERRYIEQKQRLDVQKLAKEANKSHRNRIE 123 Query: 170 EFNQYLANMSEHYDIPKVGPG 232 +FNQYLANMSEHYDIPKVGPG Sbjct: 124 DFNQYLANMSEHYDIPKVGPG 144 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,604,722 Number of Sequences: 27288 Number of extensions: 158373 Number of successful extensions: 422 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 422 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 507397856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA11M21.yg.ab1 (301 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g23570.1 putative protein / similar to unknown protein (em... 113 2e-26 >At5g23570.1 putative protein / similar to unknown protein (emb|CAB62356.1) Length = 625 Score = 113 bits (282), Expect = 2e-26 Identities = 57/100 (57%), Positives = 73/100 (73%) Frame = +2 Query: 2 MSVLIFDTSAVGYFNAERLSNHFNRQGLDKNAWNHHPNLFTPDCKRQLYGFMATKQDLDI 181 MSVL+F++SA GY AERL GLD+ AW ++F+ RQLYGF+ATKQDLDI Sbjct: 354 MSVLMFESSATGYLEAERLHRELAEMGLDRIAWGQKRSMFSGGV-RQLYGFLATKQDLDI 412 Query: 182 LNQHSPGKLKLKFELASYQEKVVDQLKKMSEDSQELLRYK 301 NQHS GK +LKFEL SYQE VV +L+++SED+Q+L +K Sbjct: 413 FNQHSQGKTRLKFELKSYQEMVVKELRQISEDNQQLNYFK 452 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,986,459 Number of Sequences: 27288 Number of extensions: 106388 Number of successful extensions: 314 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 313 length of database: 11,516,596 effective HSP length: 75 effective length of database: 9,469,996 effective search space used: 227279904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA12B16.yg.ab1 (424 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g05060.1 expressed protein / ;supported by full-length cDN... 97 4e-21 >At1g05060.1 expressed protein / ;supported by full-length cDNA: Ceres:37455. Length = 253 Score = 96.7 bits (239), Expect = 4e-21 Identities = 44/74 (59%), Positives = 59/74 (79%), Gaps = 2/74 (2%) Frame = +1 Query: 70 GLAVSQLELHTTDDIRTKGKDIVQPKFESIKERVTPLRTWAEDVANKWHIKTE--EDIKE 243 G A S+L++ DDIRTKGKD+ QPK ES+KE+V PLRTWAE+++ KWHI+ E IKE Sbjct: 179 GTAASKLDMRNADDIRTKGKDLFQPKLESMKEQVEPLRTWAENMSKKWHIENEGGNTIKE 238 Query: 244 KPLIKELSRMMGAK 285 KP++KELS+++G K Sbjct: 239 KPILKELSKILGPK 252 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,405,824 Number of Sequences: 27288 Number of extensions: 136302 Number of successful extensions: 380 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 375 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 378 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 463486164 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA12P03.yg.ab1 (684 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30790.1 putative protein / 186 1e-47 >At4g30790.1 putative protein / Length = 1148 Score = 186 bits (471), Expect = 1e-47 Identities = 101/178 (56%), Positives = 117/178 (64%), Gaps = 40/178 (22%) Frame = +3 Query: 3 ELIDRYTKTEASHEQLTKELEEKKDLVNALYMKLQSEKQVNKEKITFGRLELHEIAAFVL 182 EL+++ EA+ EQ K+LEEKK+LV LY K Q KQ NKEKI+FGRLE+HEIAAFVL Sbjct: 967 ELLEKCQNLEATSEQTRKDLEEKKELVKTLYTKHQLGKQANKEKISFGRLEVHEIAAFVL 1026 Query: 183 NEAGHYEAINRNCTHYYLSSESVALFTDHLPHQPTHIVGQIVHIERQTVK--------SS 338 N+AGHYEAINRNC +YYLSSES ALFTDHLP +PT+IVGQIVHIERQ VK +S Sbjct: 1027 NQAGHYEAINRNCPNYYLSSESEALFTDHLPSRPTYIVGQIVHIERQIVKLPSQLSASAS 1086 Query: 339 PV--------------------------------PYGLPVGCEYFVVTVAMIPDTAIH 416 P PYGL GCEYF+VT+AM+PDTAIH Sbjct: 1087 PEAGKTHHLCSDQGSRTLASSSISTSTSATTTSNPYGLSSGCEYFIVTIAMLPDTAIH 1144 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,014,662 Number of Sequences: 27288 Number of extensions: 329765 Number of successful extensions: 938 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 938 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1165500188 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13C12.yg.ab1 (407 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79040.1 photosystem II polypeptide, putative / similar to... 114 1e-26 >At1g79040.1 photosystem II polypeptide, putative / similar to photosystem II polypeptide GI:967967 from [Brassica rapa];supported by full-length cDNA: Ceres:110067. Length = 140 Score = 114 bits (286), Expect = 1e-26 Identities = 56/87 (64%), Positives = 61/87 (69%) Frame = +1 Query: 1 GVNGGMALRDGLDASGRKPKGKGVYQYVDKYGANVDGYSPIYNEDEWSPSGDVYVGGKTX 180 G+NG M LRDG+DASGRK KG GVY+YVDKYGANVDGYSPIYNE+EWS SGDVY GG T Sbjct: 54 GINGSMDLRDGVDASGRKGKGYGVYKYVDKYGANVDGYSPIYNENEWSASGDVYKGGVTG 113 Query: 181 XXXXXXXXXXXXXXXXXXVYSTSALAQ 261 VY+TSALAQ Sbjct: 114 LAIWAVTLAGILAGGALLVYNTSALAQ 140 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,289,718 Number of Sequences: 27288 Number of extensions: 165216 Number of successful extensions: 399 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 399 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 418046344 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13F19.yg.ab1 (653 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26280.1 unknown protein / 246 1e-65 At5g58720.1 putative PRL1 associated protein / ;supported by... 58 4e-09 >At2g26280.1 unknown protein / Length = 567 Score = 246 bits (627), Expect = 1e-65 Identities = 123/157 (78%), Positives = 136/157 (86%) Frame = +3 Query: 3 EARDHARLRNSYFEQARQAYLVGQKALAKELSAKGQLHNMQMKAAHEKAQESIYYQRNPG 182 EARD+ARLRN YFEQARQAYLVG KALAKELS KGQLHNMQMKAAH KAQE+IY QRNP Sbjct: 414 EARDYARLRNVYFEQARQAYLVGNKALAKELSVKGQLHNMQMKAAHGKAQEAIYRQRNPV 473 Query: 183 SLDIQGNGRGQERIIDLHGLHVNEAIHVLKRDLMTLRNIARSTDQRLQAYICVGTGHHTK 362 QGN RG ER+IDLHGLHV+EA+ VLK +L LR+ AR+T +RLQ YICVGTGHHT+ Sbjct: 474 G---QGNSRGNERMIDLHGLHVSEALQVLKHELSVLRSTARATQERLQIYICVGTGHHTR 530 Query: 363 GTRTPARLPVAVQRYLLEVEGLDYSEPQPGLLRVVLY 473 G+RTPARLPVAVQRYLLE EGLDYSEPQ GLLRV++Y Sbjct: 531 GSRTPARLPVAVQRYLLEEEGLDYSEPQAGLLRVIIY 567 >At5g58720.1 putative PRL1 associated protein / ;supported by full-length cDNA: Ceres:150336. Length = 519 Score = 58.2 bits (139), Expect = 4e-09 Identities = 48/155 (30%), Positives = 71/155 (44%) Frame = +3 Query: 6 ARDHARLRNSYFEQARQAYLVGQKALAKELSAKGQLHNMQMKAAHEKAQESIYYQRNPGS 185 A D + SY+++A +AY G +A A LS KG++ + Q + A E+A + I+ RN G Sbjct: 363 ANDQWNVTKSYYQKAAEAYSKGGRAHAAYLSDKGRVASKQAQRADERASQDIFVARNKGI 422 Query: 186 LDIQGNGRGQERIIDLHGLHVNEAIHVLKRDLMTLRNIARSTDQRLQAYICVGTGHHTKG 365 ++ IDLHG HV A+ +LK L+ + R + G G G Sbjct: 423 ENVV--------TIDLHGQHVKPAMKLLKLHLLFGSYVPSIQTLR----VITGCGASGFG 470 Query: 366 TRTPARLPVAVQRYLLEVEGLDYSEPQPGLLRVVL 470 + V LLE EG+ Y E G L + L Sbjct: 471 KSKVKQSVVK----LLEREGVRYCEENRGTLLIKL 501 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,522,817 Number of Sequences: 27288 Number of extensions: 280876 Number of successful extensions: 631 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 617 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1088756792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13G18.yg.ab1 (750 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g36305.1 similar to CAAX prenyl protease 2 / temporary aut... 216 1e-56 >At2g36305.1 similar to CAAX prenyl protease 2 / temporary automated functional assignment Length = 242 Score = 216 bits (550), Expect = 1e-56 Identities = 100/169 (59%), Positives = 122/169 (72%) Frame = +3 Query: 57 NWMVSAVYDISVWRMYIVAPVTEELVFRACMISLLLCGGFKAYTVILLSPVLFSLAHLNH 236 +W S + + R +APVTEELVFR+CMI LLLC GF+ T I L PVLFSLAHLNH Sbjct: 73 SWEASYILGVYGIRKDHLAPVTEELVFRSCMIPLLLCAGFRINTAIFLCPVLFSLAHLNH 132 Query: 237 LLEYYMQQNTSLLKASMVVGFQLGYTVIFGSYASFLFVRTGHIAAPLVSHIFCNIMGLPA 416 E Y++ N S L+AS++VG QLGYTVIFG+YASFLF+RTGH+AAPL +HIFCN MGLP Sbjct: 133 FREMYIRHNRSYLRASLIVGLQLGYTVIFGAYASFLFIRTGHLAAPLFAHIFCNYMGLPV 192 Query: 417 FFSRRTWLVGVGFVAGAISFVYLLFPLTSPALYNDRTDNCECWHTYCYW 563 ++ LV F+ G + FV LLFPLT P +YND T++C CW YC W Sbjct: 193 LYANGKGLVSAAFLGGVVGFVLLLFPLTKPLMYNDSTNDCPCWLGYCLW 241 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,029,781 Number of Sequences: 27288 Number of extensions: 376377 Number of successful extensions: 1036 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1036 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13H06.yg.ab1 (495 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g04305.1 hypothetical protein / predicted by genefinder; s... 74 5e-16 >At2g04305.1 hypothetical protein / predicted by genefinder; supported by cDNA: gi_19310533 Length = 434 Score = 73.9 bits (180), Expect(2) = 5e-16 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +3 Query: 66 IGRLRRLKENVGFISNRVTAVQAGLDSWLAEQINRKLY 179 IGRLRRLKENVGFI+NRVTA+QAGLDSW AEQINRKLY Sbjct: 294 IGRLRRLKENVGFIANRVTAIQAGLDSWQAEQINRKLY 331 Score = 26.6 bits (57), Expect(2) = 5e-16 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 2 VKEKCSVKDWFGTVDI 49 VKEKCS K WF DI Sbjct: 272 VKEKCSTKPWFLAEDI 287 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,558,494 Number of Sequences: 27288 Number of extensions: 171889 Number of successful extensions: 407 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 406 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 648439200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13J10.yg.ab1 (514 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54440.1 unknown protein / ; supported by cDNA: gi_20259378 114 2e-26 >At5g54440.1 unknown protein / ; supported by cDNA: gi_20259378 Length = 829 Score = 114 bits (286), Expect = 2e-26 Identities = 52/69 (75%), Positives = 60/69 (86%) Frame = +1 Query: 1 RKQGHVPLSIKQGSRIEISILCVPLTAGYVRPPQLELPNIGDANISCNPAGPHLVCVFPP 180 RK+GHV LS +QGSR+ ISILCVPL AGYVRPPQL LPN+ +AN+S NP+GPHLVCV PP Sbjct: 759 RKRGHVSLSEEQGSRVVISILCVPLVAGYVRPPQLGLPNVEEANVSSNPSGPHLVCVLPP 818 Query: 181 PLSSSYCIP 207 LSSSYC+P Sbjct: 819 LLSSSYCLP 827 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,015,260 Number of Sequences: 27288 Number of extensions: 238037 Number of successful extensions: 520 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 702475800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13O06.yg.ab1 (513 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g07910.1 expressed protein / ;supported by full-length cD... 73 7e-14 At4g33650.1 dynamin-like protein ADL2 / supported by cDNA gi:... 50 9e-07 At2g14120.2 dynamin-like protein / 47 7e-06 At2g14120.1 dynamin-like protein / 47 7e-06 >At3g07910.1 expressed protein / ;supported by full-length cDNA: Ceres:24905. Length = 74 Score = 73.2 bits (178), Expect = 7e-14 Identities = 36/74 (48%), Positives = 43/74 (57%) Frame = +2 Query: 110 VAKDSCLXXXXXXXXXXXXXXXXXXXXXXXXXXXKFEVPGLMKIRYIGETTLGSAAIFGL 289 +AK+SCL + +VPGL K+R+IG+TTL SAAIFGL Sbjct: 1 MAKNSCLAKITAGVAVGGALGGAVGAVYGTYEAIRVKVPGLHKVRFIGQTTLSSAAIFGL 60 Query: 290 FLGAGSLIHCGKSY 331 FLGAGSLIHCGK Y Sbjct: 61 FLGAGSLIHCGKGY 74 >At4g33650.1 dynamin-like protein ADL2 / supported by cDNA gi:19032336 Length = 808 Score = 49.7 bits (117), Expect = 9e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 93 VEENKGYFDKQIRLKIFSPNVLDITLVDLPG 1 V ENKG D QIRLKI SPNVL+ITLVDLPG Sbjct: 145 VGENKGVADTQIRLKISSPNVLNITLVDLPG 175 >At2g14120.2 dynamin-like protein / Length = 370 Score = 46.6 bits (109), Expect = 7e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -1 Query: 87 ENKGYFDKQIRLKIFSPNVLDITLVDLPG 1 ENKG D I LKIFSPNVLDI+LVDLPG Sbjct: 132 ENKGVSDIPIGLKIFSPNVLDISLVDLPG 160 >At2g14120.1 dynamin-like protein / Length = 780 Score = 46.6 bits (109), Expect = 7e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -1 Query: 87 ENKGYFDKQIRLKIFSPNVLDITLVDLPG 1 ENKG D I LKIFSPNVLDI+LVDLPG Sbjct: 132 ENKGVSDIPIGLKIFSPNVLDISLVDLPG 160 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,528,065 Number of Sequences: 27288 Number of extensions: 175921 Number of successful extensions: 513 Number of sequences better than 1.0e-05: 8 Number of HSP's better than 0.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 702475800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA14A15.yg.ab1 (616 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g14260.1 proline iminopeptidase / identical to GP:1710151:... 247 3e-66 >At2g14260.1 proline iminopeptidase / identical to GP:1710151:U72711; supported by cDNA: gi_15450388_gb_AY052295.1_ Length = 329 Score = 247 bits (631), Expect = 3e-66 Identities = 116/153 (75%), Positives = 129/153 (83%), Gaps = 1/153 (0%) Frame = +2 Query: 2 LIPENER-DCFVKAYHKRLNSDDLNTQYEAARAWTKWEMMTAHLIPNEETIKKGDSDEFS 178 LIPENER V AYHKRLNSDDL QY AARAWTKWEMMTA+L PN E ++K + D+FS Sbjct: 176 LIPENERGSSLVDAYHKRLNSDDLEIQYAAARAWTKWEMMTAYLRPNLENVQKAEDDKFS 235 Query: 179 LAFARIENHYFTNKGFFYTDSHLLDNIDKIRHINAVIVQGRYDCCCPMMSAWDLHKAWPE 358 LAFARIENHYF NKGFF +DSHLLDN+DKIRHI IVQGRYD CCPMMSAWDLHKAWPE Sbjct: 236 LAFARIENHYFVNKGFFPSDSHLLDNVDKIRHIKTTIVQGRYDVCCPMMSAWDLHKAWPE 295 Query: 359 ADFKVVTDAGHSVNEPGIAAELVAANEKLKNII 457 A+ K+V DAGHS NEPGI+AELV ANEK+K ++ Sbjct: 296 AELKIVYDAGHSANEPGISAELVVANEKMKALM 328 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,707,274 Number of Sequences: 27288 Number of extensions: 221001 Number of successful extensions: 621 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 621 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 972741724 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA14B10.yg.ab1 (368 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g43240.1 putative protein / predicted protein, Drosophila ... 109 4e-25 >At3g43240.1 putative protein / predicted protein, Drosophila melanogaster, EMBL:AE003789 Length = 717 Score = 109 bits (272), Expect = 4e-25 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = +1 Query: 1 DWVNCGVCGEWAHFGCDRRQGLGAFKDYAKTDGLEYICPQCSISNFKKKLPKT 159 DWVNCG CGEWAHFGCDRR GLGAFKDYAKTDGLEY+CP CS+SN++KK KT Sbjct: 657 DWVNCGSCGEWAHFGCDRRPGLGAFKDYAKTDGLEYVCPNCSVSNYRKKSQKT 709 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,841,678 Number of Sequences: 27288 Number of extensions: 145978 Number of successful extensions: 427 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 426 length of database: 11,516,596 effective HSP length: 87 effective length of database: 9,142,540 effective search space used: 319988900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA14E20.yg.ab1 (540 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g51820.1 chlorophyll synthetase / ; supported by cDNA: gi... 169 1e-42 >At3g51820.1 chlorophyll synthetase / ; supported by cDNA: gi_14596066_gb_AY042821.1_ Length = 387 Score = 169 bits (427), Expect = 1e-42 Identities = 81/96 (84%), Positives = 87/96 (90%) Frame = +3 Query: 3 DRKMGLQSLPVAFGEETAKWICVGAIDITQLSVAGYLLGAGKPYYAAALVGLIAPQVFFQ 182 DR +GLQSLPVAFG ETAKWICVGAIDITQLSVAGYLL +GKPYYA ALV LI PQ+ FQ Sbjct: 292 DRALGLQSLPVAFGTETAKWICVGAIDITQLSVAGYLLASGKPYYALALVALIIPQIVFQ 351 Query: 183 FKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 290 FKYFLKDPVKYDVKYQASAQPFL+LG+ VTALA+ H Sbjct: 352 FKYFLKDPVKYDVKYQASAQPFLVLGIFVTALASQH 387 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,800,495 Number of Sequences: 27288 Number of extensions: 209921 Number of successful extensions: 491 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 491 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 772177832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA14H16.yg.ab1 (372 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67740.1 F12A21.13 / putative photosystem II Core Complex ... 85 9e-18 >At1g67740.1 F12A21.13 / putative photosystem II Core Complex sp|049347|PSBY_ARATH; similar to ESTs gb|BE523181, dbj|AV531372.1, dbj|AV527826.1, dbj AV520274.1, dbj|AV522153.1, dbj|AV530317.1, dbj|AV526312.1, dbj|AV527090.1, dbj|AV521148.1, and dbj|AV531908.1;supported by full-l Length = 189 Score = 85.1 bits (209), Expect = 9e-18 Identities = 44/92 (47%), Positives = 52/92 (55%) Frame = +3 Query: 3 LYNIFQPAVNQINRMRTKXXXXXXXXXXXXXXXXXLFATPXXXXXXXXXXXXXXXXNDNR 182 LYNI QPA+NQ+N+MR L P +D+R Sbjct: 99 LYNILQPAINQVNKMRESKGIVVGLGIGGGLAASGLLTPPPEAYAAAEAAAAS---SDSR 155 Query: 183 GQLLLIVIAPAILWVLYNILQPALNQINKMRN 278 GQLLLIV+ PA+LWVLYNILQPALNQINKMR+ Sbjct: 156 GQLLLIVVTPALLWVLYNILQPALNQINKMRS 187 Score = 59.3 bits (142), Expect = 5e-10 Identities = 27/55 (49%), Positives = 33/55 (59%) Frame = +3 Query: 111 FATPXXXXXXXXXXXXXXXXNDNRGQLLLIVIAPAILWVLYNILQPALNQINKMR 275 ++ P +DNRG LL+ I PAI WVLYNILQPA+NQ+NKMR Sbjct: 60 YSEPALAIQQIAQLAAANASSDNRGLALLLPIVPAIAWVLYNILQPAINQVNKMR 114 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,748,192 Number of Sequences: 27288 Number of extensions: 87985 Number of successful extensions: 218 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 209 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 216 length of database: 11,516,596 effective HSP length: 87 effective length of database: 9,142,540 effective search space used: 329131440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA14P07.yg.ab1 (474 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20390.1 translational inhibitor protein, putative / simil... 129 1e-30 >At3g20390.1 translational inhibitor protein, putative / similar to GB:NP_005827 from [Homo sapiens], contains Pfam profile: PF01042 Domain of unknown function;supported by full-length cDNA: Ceres:20767. Length = 187 Score = 129 bits (323), Expect = 1e-30 Identities = 68/96 (70%), Positives = 73/96 (75%) Frame = +1 Query: 187 RSNRFACFAVSTDASLKEAVKTDKAPAALGPYSQAIKTGNTVYLSGALGLIPETGKFASH 366 RS FA +VS + KE V T+KAPAALGPYSQAIK N V+LSG LGLIPETGKF S Sbjct: 48 RSPPFASLSVSASSVKKEVVSTEKAPAALGPYSQAIKANNLVFLSGVLGLIPETGKFVSE 107 Query: 367 SVEEQTEQALNNMGEILKASGARYSSAATTTIMPAD 474 SVE+QTEQ L NMGEILKASGA YSS TTIM AD Sbjct: 108 SVEDQTEQVLKNMGEILKASGADYSSVVKTTIMLAD 143 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,485,690 Number of Sequences: 27288 Number of extensions: 215487 Number of successful extensions: 660 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 660 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 596203608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA15A14.yg.ab1 (441 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06890.1 expressed protein / ;supported by full-length cDN... 50 5e-07 >At3g06890.1 expressed protein / ;supported by full-length cDNA: Ceres:262487. Length = 128 Score = 50.1 bits (118), Expect = 5e-07 Identities = 29/84 (34%), Positives = 33/84 (38%) Frame = +3 Query: 21 GGGGEALTEFIAEXXXXXXXXXXXXXXXXAIQYLXXXXXXXXXXXXXAGEPSSIHRASGS 200 G GEA+T+ IAE IQ+L GEP SIHR SGS Sbjct: 39 GDSGEAITDAIAELLSPVGLLLLPIILLLTIQFLSSERGSFVSAIFSTGEPESIHRVSGS 98 Query: 201 PXXXXXXXXXXXXXXYNKFSIFGG 272 P Y +FSIFGG Sbjct: 99 PVGVALFLVLILFLLYYRFSIFGG 122 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,785,181 Number of Sequences: 27288 Number of extensions: 99027 Number of successful extensions: 425 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 424 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 507397856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA15B17.yg.ab1 (542 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g55010.1 phosphoribosylformylglycinamidine cyclo-ligase precu... 126 6e-30 >At3g55010.1 phosphoribosylformylglycinamidine cyclo-ligase precursor / ; supported by cDNA: gi_16974614_gb_AY060585.1_ Length = 389 Score = 126 bits (317), Expect = 6e-30 Identities = 59/92 (64%), Positives = 75/92 (81%), Gaps = 4/92 (4%) Frame = +2 Query: 2 GGFTDNIPRVFPQGLGARIYNNSWPVLPVFKWIQKAGNIEEAEMKRTFNMGIGMVLVASK 181 GGFTDNIPRVFP GLGA I+ ++W + P+FKWIQ+ G IE++EM+RTFN+GIGMV+V S Sbjct: 298 GGFTDNIPRVFPDGLGAVIHTDAWELPPLFKWIQQTGRIEDSEMRRTFNLGIGMVMVVSP 357 Query: 182 EAAERILSEGE----TAYRIGEVINGDGVTYQ 265 EAA RIL E + AYR+GEV+NG+GV+YQ Sbjct: 358 EAASRILEEVKNGDYVAYRVGEVVNGEGVSYQ 389 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,287,566 Number of Sequences: 27288 Number of extensions: 203894 Number of successful extensions: 550 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 549 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 781156644 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA15H21.yg.ab1 (398 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g09740.1 putative ER6 protein / similar to GB:AAD46412 fro... 53 6e-08 >At1g09740.1 putative ER6 protein / similar to GB:AAD46412 from [Lycopersicon esculentum], ESTs gb|ATTS1236,gb|T43334,gb|N97019,gb|AA395203 come from this gene Length = 174 Score = 52.8 bits (125), Expect = 6e-08 Identities = 27/48 (56%), Positives = 34/48 (70%), Gaps = 3/48 (6%) Frame = -1 Query: 143 MTENKKLRCVVVAVDGSEESMKGLQWALDNVKL---HPEGSLVIIHVQ 9 M + L CVVVAVDGSE SM+ L+WALDN+KL + S V++HVQ Sbjct: 1 MDVSGSLNCVVVAVDGSEVSMEALRWALDNLKLSSSSSDSSFVVLHVQ 48 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,035,317 Number of Sequences: 27288 Number of extensions: 84617 Number of successful extensions: 343 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 340 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 401071088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA16G07.yg.ab1 (351 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g42070.1 putative protein / similar to unknown protein (db... 69 3e-13 >At5g42070.1 putative protein / similar to unknown protein (dbj|BAA92898.1);supported by full-length cDNA: Ceres:97314. Length = 164 Score = 69.3 bits (168), Expect = 3e-13 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +2 Query: 2 FGWWPIKAYRPCPGFVATGGRYRRQGQSMDEVA 100 FGWWPIKAYRPCP FV GGRYRR GQSMDEVA Sbjct: 99 FGWWPIKAYRPCPAFVEAGGRYRRIGQSMDEVA 131 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,299,929 Number of Sequences: 27288 Number of extensions: 125435 Number of successful extensions: 338 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 338 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 216146400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA17A01.yg.ab1 (240 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20495.1 similar to Serine/threonine-protein kinase / temp... 72 4e-14 >At2g20495.1 similar to Serine/threonine-protein kinase / temporary automated functional assignment Length = 294 Score = 72.4 bits (176), Expect = 4e-14 Identities = 32/58 (55%), Positives = 46/58 (79%) Frame = +2 Query: 2 LSLLYLTKYYQLMLAILHNKRLRLSPLDITFHLPDLLGSGHLKTIQTPSGLVIRVVKN 175 LSL+ ++ ++ LA L KRLR SPLD+ FH+ DL+GSGHLKT+QT SGL++R++K+ Sbjct: 237 LSLIKRKRHKEMFLAELEKKRLRFSPLDVRFHVRDLIGSGHLKTVQTTSGLIVRILKD 294 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,223,120 Number of Sequences: 27288 Number of extensions: 96870 Number of successful extensions: 218 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 218 length of database: 11,516,596 effective HSP length: 55 effective length of database: 10,015,756 effective search space used: 240378144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA17D19.yg.ab1 (504 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25400.1 unknown protein / 111 2e-25 >At3g25400.1 unknown protein / Length = 99 Score = 111 bits (277), Expect = 2e-25 Identities = 52/64 (81%), Positives = 57/64 (88%) Frame = +3 Query: 72 SEIFQWKGEVPRGLPGWEDKEKQHLGEELSDVLLYLVRLSDICGVDLGKAALXKLEINAT 251 SEIFQWKGEV RG P W+++EK HLGEELSDVLLYLVRLSD CGVDLGKAAL K+E+NA Sbjct: 11 SEIFQWKGEVARGCPDWKEEEKVHLGEELSDVLLYLVRLSDACGVDLGKAALRKIELNAI 70 Query: 252 KYPV 263 KYPV Sbjct: 71 KYPV 74 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,296,816 Number of Sequences: 27288 Number of extensions: 166113 Number of successful extensions: 445 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 445 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 675457500 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA17I14.yg.ab1 (525 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16550.1 expressed protein / ; supported by cDNA: gi_1442... 101 3e-22 >At5g16550.1 expressed protein / ; supported by cDNA: gi_14423559_gb_AF387017.1_AF387017 Length = 249 Score = 101 bits (251), Expect = 3e-22 Identities = 45/96 (46%), Positives = 64/96 (65%) Frame = +3 Query: 6 LLALTGMLVFTVVFLAATVNAIVISLLISLAAVGGFLAIFFACMTTMYIGLLXXXXXXXX 185 LL ++VFT+ F+AAT NAI+ISLLISLA GGFLA+FF C+T +YIG L Sbjct: 124 LLTTMALVVFTLFFVAATANAIIISLLISLAVAGGFLALFFLCLTGVYIGALSVAAFVIS 183 Query: 186 XXXISSIIAALVAAGWIGFIWMIWLAASEGARMVKR 293 +S++++ L+A+GWIGF + +WL R+ K+ Sbjct: 184 TATVSAVVSVLIASGWIGFFYAVWLGTRGSLRLAKQ 219 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,128,308 Number of Sequences: 27288 Number of extensions: 210915 Number of successful extensions: 596 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 727283772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA17I19.yg.ab1 (571 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g42210.1 expressed protein / ; supported by full-length c... 122 2e-28 >At2g42210.1 expressed protein / ; supported by full-length cDNA: Ceres: 28982. Length = 159 Score = 122 bits (305), Expect = 2e-28 Identities = 58/105 (55%), Positives = 67/105 (63%) Frame = +3 Query: 18 PGLVRTLKMMGNHGLTFAAIGGVYIGVEQLTQNYRMKRDXXXXXXXXXXXXXXILGFKGK 197 PGL+RTLKMMG HGLTFAAIGGVYIGVEQL QN+R KRD +LG++ + Sbjct: 53 PGLIRTLKMMGTHGLTFAAIGGVYIGVEQLVQNFRSKRDFYNGAIGGFVAGASVLGYRAR 112 Query: 198 SIXXXXXXXXXXXXXXXXIDVGGQTTRVDTGKEYYPYTTKKRVDA 332 SI ID GGQTTRVD G+EYYPYT +KR +A Sbjct: 113 SIPTAIAAGATLAVTSALIDSGGQTTRVDNGREYYPYTVEKRAEA 157 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,118,832 Number of Sequences: 27288 Number of extensions: 209907 Number of successful extensions: 425 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 425 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 850394780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA17M20.yg.ab1 (726 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g27385.1 Expressed protein / ; supported by full-length cD... 201 4e-52 >At1g27385.1 Expressed protein / ; supported by full-length cDNA: Ceres: 39286. Length = 202 Score = 201 bits (510), Expect = 4e-52 Identities = 101/151 (66%), Positives = 115/151 (75%) Frame = +3 Query: 144 RFNCSHHDENLSSTEDDGDQEPPQEAVLKVISEVSKTEGRVGQTTNMVLGGTVTDDSSDE 323 R NCSH+D++ DQ PPQEAVLK ISEVSKT+GRVG+TTNM++GGTV DDS+ + Sbjct: 60 RLNCSHNDQS--------DQGPPQEAVLKAISEVSKTDGRVGKTTNMIIGGTVADDSAKD 111 Query: 324 WLTLDQKVNTYPTVRGFTAIGTGGDDFVQAMVIAVESVVQHPIPQGNVKQKMSSGGKYVS 503 WL LDQKVNTYPT RGFTAIGTGG+DFV AMV+AVESV+ IP+ VKQ +SS GKYVS Sbjct: 112 WLELDQKVNTYPTERGFTAIGTGGNDFVHAMVVAVESVIDRQIPEDCVKQTLSSKGKYVS 171 Query: 504 VNIGPXXXXXXXXXXXXYNAMRRDVRMKYFL 596 VNIGP YNAMRRD RMKYFL Sbjct: 172 VNIGPIQVVSSEQVQAVYNAMRRDERMKYFL 202 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,221,100 Number of Sequences: 27288 Number of extensions: 258371 Number of successful extensions: 814 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 783 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 811 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1277231040 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA19C23.yg.ab1 (602 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21110.1 G10 - like protein / Maternal G10 like protein, O... 292 1e-79 >At4g21110.1 G10 - like protein / Maternal G10 like protein, Oryza sativa, PATCHX:D1002643; supported by cDNA: gi_15294271_gb_AF410327.1_AF410327 Length = 145 Score = 292 bits (747), Expect = 1e-79 Identities = 127/145 (87%), Positives = 138/145 (94%) Frame = +2 Query: 23 MPKVKTNRVKYPEGWELIEPTLRELQGKMREAENDPHDGKRKCEALWPIFKIAHQKSRYI 202 MPKVKTNRVKYPEGWELIEPTLREL KMREAE D HDGKRKCE LWPIFK++HQ+SRY+ Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELDAKMREAETDSHDGKRKCETLWPIFKVSHQRSRYV 60 Query: 203 YDLYYRRKEISKELFEFCLDQGYADRNIIAKWKKPGYERLCCLRCIQPRDHNFQTTCVCR 382 YDLYYRR+EISKEL+EFCLDQGYADR++IAKWKK GYERLCCLRCIQPRDHN+ TTCVCR Sbjct: 61 YDLYYRREEISKELYEFCLDQGYADRSLIAKWKKSGYERLCCLRCIQPRDHNYGTTCVCR 120 Query: 383 VPKHLREEKVIECVHCGCKGCASGD 457 VPKHLREEKV+ECVHCGC+GCASGD Sbjct: 121 VPKHLREEKVVECVHCGCQGCASGD 145 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,560,626 Number of Sequences: 27288 Number of extensions: 307649 Number of successful extensions: 773 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 771 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 948861544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA1c02.yg.ab1 (391 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g31350.1 F-box protein family / similar to hypothetical pr... 63 5e-11 >At1g31350.1 F-box protein family / similar to hypothetical protein GB:AAF24593 GI:6692128 from [Arabidopsis thaliana] Length = 395 Score = 62.8 bits (151), Expect = 5e-11 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 3/72 (4%) Frame = -2 Query: 210 TTTSSGH-NPTLQLSSFDPISTDWSIITPPTPY--LRHICLRHPSFIARNLPMQSISVAG 40 +T+ +G NP+++ F+P+S+ W + PP P L I RHPSFI+ NLP+Q +S AG Sbjct: 86 STSDTGRVNPSVRFMCFNPVSSKWYPLPPPPPDPPLHRILYRHPSFISFNLPIQCVSAAG 145 Query: 39 NLVLLAGTTGDL 4 L+L+AG+ L Sbjct: 146 KLILIAGSNQQL 157 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,293,924 Number of Sequences: 27288 Number of extensions: 170158 Number of successful extensions: 754 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 373725332 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA1c12.yg.ab1 (513 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11980.1 putative protein / predicted protein W02G9.1 Caen... 41 2e-12 At2g05070.1 light-harvesting chlorophyll a/b binding protein /... 53 8e-08 At2g05100.1 light-harvesting chlorophyll a/b binding protein / 52 2e-07 At3g27690.1 light harvesting chlorophyll A/B binding protein, pu... 51 3e-07 At2g34430.1 photosystem II type I chlorophyll a /b binding prot... 49 2e-06 At1g29930.1 light-harvesting chlorophyll a/b binding protein /... 49 2e-06 At1g29920.1 photosystem II type I chlorophyll a /b binding prot... 49 2e-06 At1g29910.1 photosystem II type I chlorophyll a /b binding prot... 49 2e-06 At2g34420.1 photosystem II type I chlorophyll a /b binding prot... 49 2e-06 >At4g11980.1 putative protein / predicted protein W02G9.1 Caenorhabditis elegans cosmid W02G9, PID:g3165571; supported by cDNA: gi_15450340_gb_AY052271.1_ Length = 309 Score = 41.2 bits (95), Expect(3) = 2e-12 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = +1 Query: 163 LWHMTADAKELMSIAIYEMAKKEGLL 240 LW TADAK LMSI +YEMA++EGL+ Sbjct: 275 LWRKTADAKVLMSIGLYEMAQREGLV 300 Score = 35.8 bits (81), Expect(3) = 2e-12 Identities = 15/24 (62%), Positives = 19/24 (78%) Frame = +3 Query: 75 DDIKQMHGKETGLRVHGELIKVHV 146 + I+Q+ GKETGLR HGE IKV + Sbjct: 246 ETIRQLQGKETGLREHGEFIKVRL 269 Score = 30.8 bits (68), Expect(3) = 2e-12 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +2 Query: 8 YPLPGGWDEELSLLMYRG 61 +P PGG DEE+S+ +YRG Sbjct: 224 FPSPGGCDEEMSVFLYRG 241 >At2g05070.1 light-harvesting chlorophyll a/b binding protein / ; supported by cDNA: gi_4741945_gb_AF134123.1_AF134123 Length = 265 Score = 53.1 bits (126), Expect = 8e-08 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPVANNAWSYATNFVP K Sbjct: 229 VQAIVTGKGPIENLFDHLADPVANNAWSYATNFVPGK 265 >At2g05100.1 light-harvesting chlorophyll a/b binding protein / Length = 265 Score = 52.0 bits (123), Expect = 2e-07 Identities = 22/35 (62%), Positives = 28/35 (79%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVP 424 ++++ + +NL DHLADPVANNAWSYATNFVP Sbjct: 229 VQAIVTGKGPIENLFDHLADPVANNAWSYATNFVP 263 >At3g27690.1 light harvesting chlorophyll A/B binding protein, putative / similar to chlorophyll A-B binding protein 151 precursor (LHCP) GB:P27518 from [Gossypium hirsutum];supported by full-length cDNA: Ceres:7700.; supported by cDNA: gi_13899124 Length = 266 Score = 51.2 bits (121), Expect = 3e-07 Identities = 21/37 (56%), Positives = 29/37 (77%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DH+ADPVANNAW+YATNFVP K Sbjct: 230 VQAIVTGKGPIENLFDHIADPVANNAWAYATNFVPGK 266 >At2g34430.1 photosystem II type I chlorophyll a /b binding protein / ; supported by full-length cDNA: Ceres: 23727. Length = 266 Score = 48.5 bits (114), Expect = 2e-06 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPV NNAW++ATNFVP K Sbjct: 230 VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 266 >At1g29930.1 light-harvesting chlorophyll a/b binding protein / similar to photosystem II type I chlorophyll a /b binding protein GI:16364 from [Arabidopsis thaliana]; supported by cDNA: gi_15010743_gb_AY045673.1_ Length = 267 Score = 48.5 bits (114), Expect = 2e-06 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPV NNAW++ATNFVP K Sbjct: 231 VQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK 267 >At1g29920.1 photosystem II type I chlorophyll a /b binding protein, putative / similar to photosystem II type I chlorophyll a /b binding protein GI:16364 from [Arabidopsis thaliana];supported by full-length cDNA: Ceres:29298. Length = 267 Score = 48.5 bits (114), Expect = 2e-06 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPV NNAW++ATNFVP K Sbjct: 231 VQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK 267 >At1g29910.1 photosystem II type I chlorophyll a /b binding protein, putative / similar to photosystem II type I chlorophyll a /b binding protein GI:16364 from [Arabidopsis thaliana] Length = 267 Score = 48.5 bits (114), Expect = 2e-06 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPV NNAW++ATNFVP K Sbjct: 231 VQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK 267 >At2g34420.1 photosystem II type I chlorophyll a /b binding protein / identical to GB:X64460; supported by cDNA: gi_13926259_gb_AF372886.1_AF372886 Length = 265 Score = 48.5 bits (114), Expect = 2e-06 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPV NNAW++ATNFVP K Sbjct: 229 VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 265 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,947,673 Number of Sequences: 27288 Number of extensions: 215734 Number of successful extensions: 506 Number of sequences better than 1.0e-05: 18 Number of HSP's better than 0.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 506 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 702475800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA1g09.yg.ab1 (399 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g38240.1 glycosyltransferase like protein / alpha-1,3-mann... 101 1e-22 >At4g38240.1 glycosyltransferase like protein / alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (EC 2.4.1.101) I - rat,PIR2:JC2076 Length = 457 Score = 101 bits (251), Expect = 1e-22 Identities = 47/67 (70%), Positives = 55/67 (81%) Frame = +1 Query: 1 VNGDVRIHYTDQSHFENIARQFGIFEEWKDGVPRTAYKGIVVFRYQTSKXVXLVGPNSLQ 180 + DVRI Y DQ FE IA +FGIFEEWKDGVPRTAYKG+VVFR QT++ V LVGP+S+ Sbjct: 391 IKDDVRIRYKDQVEFERIAGEFGIFEEWKDGVPRTAYKGVVVFRIQTTRRVFLVGPDSVM 450 Query: 181 QLGIQNS 201 QLGI+NS Sbjct: 451 QLGIRNS 457 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,395,598 Number of Sequences: 27288 Number of extensions: 171380 Number of successful extensions: 324 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 322 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 324 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 401071088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA20B23.yg.ab1 (349 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62140.1 hypothetical protein / 70 2e-13 >At3g62140.1 hypothetical protein / Length = 241 Score = 69.7 bits (169), Expect = 2e-13 Identities = 46/108 (42%), Positives = 59/108 (54%), Gaps = 26/108 (24%) Frame = +2 Query: 8 VAAQSAVLHELKESPVAPPK--LQEQQPSGEKKTRARPLGVVIKVKPQPKKAKISTPEE- 178 VAA+SA+LHE KE+ + PP +EQ+P G++ RP +IKVKPQPKKAK + EE Sbjct: 133 VAARSAILHEPKEAALPPPAPVTKEQKPIGKRNPATRPFKAIIKVKPQPKKAKATEKEEK 192 Query: 179 -----SKPSVPVTNV--------VTG----------GLVSYSDESDDD 253 KP+ + VTG LVSYSDES+DD Sbjct: 193 EIPGNGKPASHIDQASLDSVKGNVTGKTTEGLQTGLALVSYSDESEDD 240 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,853,786 Number of Sequences: 27288 Number of extensions: 157068 Number of successful extensions: 516 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 509 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 216801312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA20G20.yg.ab1 (639 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61970.1 signal recognition particle - like protein / sign... 175 2e-44 >At5g61970.1 signal recognition particle - like protein / signal recognition particle 68, Homo sapiens, EMBL:AF195951; supported by cDNA: gi_15293136_gb_AY051002.1_ Length = 605 Score = 175 bits (444), Expect = 2e-44 Identities = 92/155 (59%), Positives = 120/155 (77%), Gaps = 5/155 (3%) Frame = +3 Query: 9 EAYSLFSFARSLAENALKKLRSATSRDQVTIKELETLHNNCRSNSCIEHAMGIMEHEKAP 188 EA++L+S ARSLAE+AL K +S +D+ TI+EL+TL CR+NSCIEHA GIME E+AP Sbjct: 452 EAFALYSRARSLAEDALNKFQSIAKKDEGTIQELKTLIKECRANSCIEHATGIMEEERAP 511 Query: 189 EDLSKKISTVSISGTDRKA-EKFLIEKLDSYESAVGDSSTKVAPRIAAYQPSFQPIARSP 365 E+LS ++ST+S++ T + EK+L++KLD YESAVGDS+TK AP+I + P+ Q I R+P Sbjct: 512 ENLSNRMSTISLNNTAAQVEEKYLLDKLDVYESAVGDSNTKTAPKIERFPPALQSIPRNP 571 Query: 366 IVLDLAYNSIDFPSIDNRMKQDKKGF----ISRLW 458 IVLDLAYN IDFP I+NRMK+ K GF IS LW Sbjct: 572 IVLDLAYNCIDFPVIENRMKK-KGGFFSSRISSLW 605 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,139,912 Number of Sequences: 27288 Number of extensions: 270763 Number of successful extensions: 833 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 800 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 832 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1044135612 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA20J16.yg.ab1 (518 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24460.1 unknown protein / ; supported by cDNA: gi_17065179 68 2e-12 >At5g24460.1 unknown protein / ; supported by cDNA: gi_17065179 Length = 300 Score = 68.2 bits (165), Expect = 2e-12 Identities = 37/69 (53%), Positives = 46/69 (66%), Gaps = 5/69 (7%) Frame = +3 Query: 84 VSYPGLPACYILHTVDAYVDGLPEGEFWTEEGDEYEGLGEKEHERCEL-----AVSCKKH 248 +SYPGLPA Y LH+V+A V+GLPE +F TEE EYEG G+ + E AV+ K+H Sbjct: 231 LSYPGLPARYALHSVNATVEGLPEQDFCTEE-KEYEG-GDSTKDSVETLAAGNAVTVKRH 288 Query: 249 YWKWVDEGS 275 YWKWV S Sbjct: 289 YWKWVSPDS 297 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,255,096 Number of Sequences: 27288 Number of extensions: 220859 Number of successful extensions: 990 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 832 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 976 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 720488000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA20P20.yg.ab1 (394 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done ***** No hits found ****** Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,175,225 Number of Sequences: 27288 Number of extensions: 68500 Number of successful extensions: 120 Number of sequences better than 1.0e-05: 0 Number of HSP's better than 0.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 382840584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA21B20.yg.ab1 (396 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79810.1 expressed protein / contains similarity to peroxi... 200 2e-52 >At1g79810.1 expressed protein / contains similarity to peroxisome membrane protein PEX2 GI:2623264 from [Mus musculus]; supported by full-length cDNA: Ceres: 118765. Length = 333 Score = 200 bits (509), Expect = 2e-52 Identities = 89/128 (69%), Positives = 107/128 (83%) Frame = +1 Query: 1 RYRNLIERALRARLVYGSPHMNRAVSFEYMNRQLVWNEFSEMXXXXXPILNSASIKSIFR 180 RYRNLIE+AL+ARLVY SPHMNR+VSFEYMNRQLVWNEFSEM P+LNS+++K+I Sbjct: 201 RYRNLIEKALKARLVYRSPHMNRSVSFEYMNRQLVWNEFSEMLLLLLPLLNSSAVKNILS 260 Query: 181 PFSKDKSSGSTGDETQCPICHINPTIGYVALPCQHRYCYYCLRTRCAATASFRCSRCSEP 360 PF+KDKSS + D CPIC ++P I ++ALPCQHRYCYYC+RTRCA+ ASFRC RC+EP Sbjct: 261 PFAKDKSSSTKEDTVTCPICQVDPAIPFIALPCQHRYCYYCIRTRCASAASFRCLRCNEP 320 Query: 361 VVAMQPPG 384 VVA+Q G Sbjct: 321 VVAIQREG 328 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,633,792 Number of Sequences: 27288 Number of extensions: 172896 Number of successful extensions: 570 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 391955836 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA22B12.yg.ab1 (461 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30820.1 Expressed protein / ; supported by full-length cD... 65 2e-11 >At4g30820.1 Expressed protein / ; supported by full-length cDNA: Ceres: 14193. Length = 178 Score = 64.7 bits (156), Expect = 2e-11 Identities = 39/70 (55%), Positives = 48/70 (67%), Gaps = 5/70 (7%) Frame = +2 Query: 17 AGGTIPQP-RPT----QPLPMGSGDDLHAYHMDGEETMRLKAERGGKAGGWSLEISRKRA 181 AG T Q RPT QP+P+ G + Y M+ E T R+KAER AGG+SLEIS++RA Sbjct: 112 AGTTYGQASRPTGMGPQPVPIVGGAERQHYAMEDEATRRMKAER---AGGFSLEISKRRA 168 Query: 182 LEEAFASIWI 211 LEEAFASIW+ Sbjct: 169 LEEAFASIWV 178 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,162,122 Number of Sequences: 27288 Number of extensions: 208489 Number of successful extensions: 496 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 487 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 495 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 560070056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA2f04.yg.ab1 (551 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25740.1 hypothetical protein / predicted by genscan; supp... 258 2e-69 >At2g25740.1 hypothetical protein / predicted by genscan; supported by cDNA: gi_18377846 Length = 547 Score = 258 bits (658), Expect = 2e-69 Identities = 120/173 (69%), Positives = 142/173 (81%) Frame = +3 Query: 33 RECPRAFWPYWVYRMHDSYCLAQRLSDMWKKIVGTPSMDAFVRQPGLLSFHVASKIPVSE 212 R PRAFWP+W YRM DSY LAQR D+WK+IVG P+M+AFV +P +LSF +ASKIPVSE Sbjct: 354 RMTPRAFWPFWAYRMFDSYYLAQRAVDLWKQIVGVPNMEAFVNKPDILSFSIASKIPVSE 413 Query: 213 STRQELLEIDGISYRLRREIELLENFDQIKCRSCQTLIANRSDMLVMSTDGPLGAYVNPS 392 S RQELLE+DG+SYRL+REIELLE+FD+++C CQT+IA R DMLVMS +GPLGAYVNP Sbjct: 414 SIRQELLELDGVSYRLQREIELLESFDRVRCIHCQTVIARRKDMLVMSNEGPLGAYVNPH 473 Query: 393 GYVHEIMTLLKASGLALIGVPTEEYSWFPGYAWTEAYWATCEYQMGWLLTATN 551 GYVHEIMT KA+ +AL G P ++ SWFPGYAWT A ATCE Q+GW TATN Sbjct: 474 GYVHEIMTFYKANDIALRGRPVKKDSWFPGYAWTIANCATCETQLGWHFTATN 526 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,671,192 Number of Sequences: 27288 Number of extensions: 268308 Number of successful extensions: 728 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 723 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 808093080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA3h02.yg.ab1 (347 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30900.1 hypothetical protein / ; supported by cDNA: gi_1... 100 1e-22 >At4g30900.1 hypothetical protein / ; supported by cDNA: gi_18958014 Length = 254 Score = 100 bits (250), Expect = 1e-22 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = +3 Query: 3 RQTQDLHIDWILFRGRSLAPVSCEVVNDNIDGHYPSSHYPVFAEFMLPRTVRPLEP 170 RQTQDLH DWIL+RGRS+ PV CE+VND ID YPSSHYPVFAEFMLPR+VR LEP Sbjct: 187 RQTQDLHTDWILYRGRSIVPVMCEIVNDKIDDLYPSSHYPVFAEFMLPRSVRMLEP 242 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,428,971 Number of Sequences: 27288 Number of extensions: 107678 Number of successful extensions: 260 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 260 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 216801312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA4f06.yg.ab1 (363 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done ***** No hits found ****** Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,124,917 Number of Sequences: 27288 Number of extensions: 106364 Number of successful extensions: 279 Number of sequences better than 1.0e-05: 0 Number of HSP's better than 0.0 without gapping: 277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 279 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 213526752 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA4g03.yg.ab1 (386 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g10780.1 putative protein / HSPC184, Homo sapiens, EMBL:AF... 120 2e-28 >At5g10780.1 putative protein / HSPC184, Homo sapiens, EMBL:AF151018; supported by cDNA: gi_14335059_gb_AY037209.1_ Length = 180 Score = 120 bits (302), Expect = 2e-28 Identities = 55/77 (71%), Positives = 64/77 (82%) Frame = +2 Query: 14 PLWPLYGVGKAFAPYKDSKVDLLAPKLLFIALNLGGMLLGVWKLNALGLLPTHASDWVSS 193 P+ L VGK F P+KD+KV+LL PKL+F+ALNLGG+ LGVWKLN LGLLPTHASDWVSS Sbjct: 104 PISALQSVGKIFEPFKDNKVELLMPKLVFLALNLGGLALGVWKLNTLGLLPTHASDWVSS 163 Query: 194 LPPAREVEYSGGGIALH 244 LPP +EVE+SGGG H Sbjct: 164 LPPPQEVEHSGGGFVFH 180 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,773,768 Number of Sequences: 27288 Number of extensions: 191498 Number of successful extensions: 492 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 364610080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA6G22.yg.ab1 (313 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g04700.1 putative ferredoxin-thioredoxin reductase / ;sup... 101 8e-23 >At2g04700.1 putative ferredoxin-thioredoxin reductase / ;supported by full-length cDNA: Ceres:40781. Length = 146 Score = 101 bits (251), Expect = 8e-23 Identities = 43/51 (84%), Positives = 46/51 (89%) Frame = +1 Query: 1 EATQGFWNCPCVPMRERKECHCMLFLTPDNDFAGNEQVITMEEIKESTANM 153 E QGFWNCPCVPMRERKECHCMLFLTPDNDFAG +Q IT +EIKE+TANM Sbjct: 96 EVGQGFWNCPCVPMRERKECHCMLFLTPDNDFAGKDQTITSDEIKETTANM 146 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,999,206 Number of Sequences: 27288 Number of extensions: 134929 Number of successful extensions: 245 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 241 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 245 length of database: 11,516,596 effective HSP length: 79 effective length of database: 9,360,844 effective search space used: 224660256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA6N18.yg.ab1 (500 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27050.1 expressed protein / ; supported by cDNA: gi_13937... 96 1e-20 >At3g27050.1 expressed protein / ; supported by cDNA: gi_13937132_gb_AF372920.1_AF372920 Length = 182 Score = 95.5 bits (236), Expect = 1e-20 Identities = 49/96 (51%), Positives = 65/96 (67%), Gaps = 1/96 (1%) Frame = +3 Query: 3 KINMEYENDQDLMISFYKFVAKEEMVCEEAELGPDEYAERXXXXXXXXXXXXXXXKHMRN 182 K+N YEND++LMI FYKF+AKEEM CEEAELG D + ++ K+MR Sbjct: 74 KLNSAYENDKELMIGFYKFLAKEEMACEEAELGQDGFEQKMKALQQLQEQQLEMLKYMRK 133 Query: 183 YGADDQSAILETLRQKMEKE-FESEASLLSVEEIKE 287 + DDQSAIL+ L++++E FE EASLLS EE++E Sbjct: 134 FSLDDQSAILQKLQKQLENAGFEPEASLLSGEEMEE 169 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,084,033 Number of Sequences: 27288 Number of extensions: 156788 Number of successful extensions: 428 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 427 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 666451400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA7F05.yg.ab1 (321 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48720.1 putative protein / similar to unknown protein (gb... 95 6e-21 >At5g48720.1 putative protein / similar to unknown protein (gb|AAD20092.1) Length = 286 Score = 95.1 bits (235), Expect = 6e-21 Identities = 49/107 (45%), Positives = 70/107 (64%) Frame = +1 Query: 1 GLHPSSEEWLADCLINDTEMHLHVDDMNPSGSTGGQIDLTESNNSEPENGCGTGQKLPTP 180 GL +EEW ADCL ND E + DD+N GS Q+D++E N PE Q+ T Sbjct: 131 GLDLYAEEWYADCL-NDAETPMLPDDLN-FGSPDVQVDISEYLNVPPETETREVQRPVTR 188 Query: 181 TSKNIVFKGKRSCIKTPTKMTSSVVRPFAFVKPCGMQGAVTIKDINQ 321 +S N++FKG++S + +K+ SS++ PFAF+KPCG+ G +T+KDINQ Sbjct: 189 SSPNVIFKGRKSFSRPVSKLPSSIIYPFAFIKPCGVHGGMTLKDINQ 235 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.312 0.131 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,654,460 Number of Sequences: 27288 Number of extensions: 167301 Number of successful extensions: 387 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 386 length of database: 11,516,596 effective HSP length: 82 effective length of database: 9,278,980 effective search space used: 222695520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA7G06.yg.ab1 (362 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28260.1 putative protein / 74 1e-14 >At4g28260.1 putative protein / Length = 516 Score = 73.9 bits (180), Expect = 1e-14 Identities = 35/76 (46%), Positives = 52/76 (68%), Gaps = 5/76 (6%) Frame = +3 Query: 3 TGIELGGDELEKPTVSLSEMFKYKMKASDGHKEYIKAPELLQNCSTGFYFPSQSEEAMQ- 179 TGI + G +E+ T LS+ +++++K S+G K ++K PE L+NCSTGF+FP Q+EE Q Sbjct: 437 TGINIEGAVIERDTFPLSQTWRFQVKVSEGRKAWVKNPERLKNCSTGFHFPQQAEETEQI 496 Query: 180 ----ENVSPLKLLRFY 215 E V +KL+RFY Sbjct: 497 PVQEERVQMMKLVRFY 512 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,381,342 Number of Sequences: 27288 Number of extensions: 149343 Number of successful extensions: 378 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 371 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 378 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 213526752 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA7G20.yg.ab1 (666 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79790.1 expressed protein / ; supported by full-length cD... 181 3e-46 >At1g79790.1 expressed protein / ; supported by full-length cDNA: Ceres: 268411. Length = 245 Score = 181 bits (459), Expect = 3e-46 Identities = 96/180 (53%), Positives = 116/180 (64%) Frame = +2 Query: 2 LIDEMELARIFFKDGRHFDLEGLKSCIYQGYSYIEGVEELLSTLKDNGYEIHAFTNYPIW 181 LIDE ELAR FF DGR FDLEGLK C+ GYSY++G++ELL TL + +EIHAFTNYPIW Sbjct: 94 LIDEEELARNFFIDGRDFDLEGLKECMRSGYSYLDGMQELLQTLAADDFEIHAFTNYPIW 153 Query: 182 YG*TARYKMIEDKLKLSSYLSWTFCSCVIGKYKT*ST*YQNTTFMCFSV*RYCRSINVGK 361 Y +IEDKLKLS+YLSWTFCSC+ GK Sbjct: 154 YN------IIEDKLKLSAYLSWTFCSCI-----------------------------AGK 178 Query: 362 RKPDPLFYSEVLQHLDTEPQNCVFIDDRLKNIEAAKDAGIIGIQFKNAHSLQQDLSLLGI 541 RKPDP FY EV+ HL EP +C+FIDDR N++ A + G+ G+ F+NA SL +DLS LGI Sbjct: 179 RKPDPEFYLEVVGHLGVEPCDCIFIDDRPTNVKCAIEIGMGGLCFENADSLAKDLSDLGI 238 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,483,170 Number of Sequences: 27288 Number of extensions: 274970 Number of successful extensions: 703 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 702 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1112118500 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA7M13.yg.ab1 (501 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53850.1 putative protein / contains similarity to enolase... 201 2e-52 >At5g53850.1 putative protein / contains similarity to enolase-phosphatase Length = 507 Score = 201 bits (510), Expect = 2e-52 Identities = 92/133 (69%), Positives = 116/133 (87%) Frame = +1 Query: 1 FEKNVIKGVVYDDVVQAFERWHASGVKVYIYSSGSRLAQRLIFGYTNYGDLRKYLCGFFD 180 FE + +K +V++DV A E+WH+SG+KVYIYSSGSRLAQ+L+FG T+YGDLRKY+ GFFD Sbjct: 375 FECDELKAIVFEDVADALEKWHSSGIKVYIYSSGSRLAQKLLFGNTDYGDLRKYISGFFD 434 Query: 181 TKVGNKRETKSYVEISESLGVDKPSEVLFVTDVVQEAVAAKAAGLEVIISVRPGNAPLPE 360 T +GNK+E++SY EI E+LGVD P+E++FVTDV QEAVAAKAAGLE IIS+RPGNAPLPE Sbjct: 435 TTIGNKKESRSYKEIKETLGVDDPAEIMFVTDVYQEAVAAKAAGLEAIISIRPGNAPLPE 494 Query: 361 NHGCDTVETFTEI 399 NHG TV +F++I Sbjct: 495 NHGFKTVTSFSQI 507 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,988,548 Number of Sequences: 27288 Number of extensions: 195489 Number of successful extensions: 572 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 666451400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA8L15.yg.ab1 (493 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g63980.1 expressed protein / similar to hypothetical prote... 57 5e-09 >At1g63980.1 expressed protein / similar to hypothetical protein GB:AAF07360 from [Arabidopsis thaliana]; supported by cDNA: gi_15810007_gb_AY054272.1_ Length = 391 Score = 57.0 bits (136), Expect = 5e-09 Identities = 28/52 (53%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = +1 Query: 166 LKLKQLMALVDEHH-SIFNNFSSKKHALAFFKNKLESSSKFIVEGKRVRLMS 318 +KLKQL +L+DE S+ + FSS+K A+A+ K KLE S KF+VEGK++ L+S Sbjct: 337 MKLKQLKSLIDEQAPSVLSEFSSRKDAIAYLKLKLERSGKFVVEGKKISLVS 388 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,450,104 Number of Sequences: 27288 Number of extensions: 127030 Number of successful extensions: 351 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 343 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 350 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 639433100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA8M14.yg.ab1 (397 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76150.1 hypothetical protein / contains similarity to 17-... 116 4e-27 >At1g76150.1 hypothetical protein / contains similarity to 17-beta-hydroxysteroid dehydrogenase type IV GI:2315980 from [Gallus gallus]; supported by cDNA: gi_17979530 Length = 309 Score = 116 bits (290), Expect = 4e-27 Identities = 55/77 (71%), Positives = 64/77 (82%) Frame = +1 Query: 1 LCTLGFAVRAIIKTICNGDANLVKAISGRFLLHVYPGETLITEMWLQGSRVLYQTKVKER 180 LCTLGFA++AIIK +C GD VK ISGRFL V+PGETLITEMWL+G RV+YQTKVKER Sbjct: 232 LCTLGFAIKAIIKCVCKGDPTAVKTISGRFLTTVFPGETLITEMWLEGLRVIYQTKVKER 291 Query: 181 NRAVLAGFVDLDQLRSS 231 N+ VLAG+VD+ L SS Sbjct: 292 NKTVLAGYVDIRGLSSS 308 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,284,773 Number of Sequences: 27288 Number of extensions: 152316 Number of successful extensions: 377 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 372 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 377 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 391955836 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA9A15.yg.ab1 (769 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34280.1 putative protein / damage-specific DNA binding pr... 271 3e-73 >At4g34280.1 putative protein / damage-specific DNA binding protein 2, Homo sapiens ,PIR2:I38909 Length = 748 Score = 271 bits (693), Expect = 3e-73 Identities = 135/190 (71%), Positives = 155/190 (81%), Gaps = 2/190 (1%) Frame = +3 Query: 3 HINVVKFANHSPSMFATSSFDHDVKMWDLRQKPIHPCYTVSSGRGNVMVCFSPDDHYLLA 182 HINVVKF+NHSP +FATSSFD DVK+WDLRQ+P PCYT SS +GNVMVCFSPDD YLLA Sbjct: 538 HINVVKFSNHSPFLFATSSFDKDVKLWDLRQEPSRPCYTASSTKGNVMVCFSPDDRYLLA 597 Query: 183 SAVDNEVKQLLAVDGRLHLDFGIPPTGSSQNYTRSYYMNGRDYILSGSCDEHVVRICSAQ 362 SAVDNEV+QLL VDGRLHL+F I P SS NYTRSYYMNG DYI+SGSCDE+V+R+C AQ Sbjct: 598 SAVDNEVRQLLTVDGRLHLNFEIVPRVSSMNYTRSYYMNGNDYIISGSCDENVIRVCCAQ 657 Query: 363 TGRRLRDISLEGRSSG-SSMFVQSLRGDPFRDFNLSVLAAYLSPNSSPEIVKVNM-LTSK 536 TGRRLRD++LEG S S M+VQSLRGDPFRDFN+SVLAAY +S EIVK+ + S Sbjct: 658 TGRRLRDVTLEGNGSDFSMMYVQSLRGDPFRDFNMSVLAAYARSSSLSEIVKIKFPILST 717 Query: 537 DADKDSLSDE 566 DK+ + E Sbjct: 718 VDDKNVTAGE 727 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,561,357 Number of Sequences: 27288 Number of extensions: 292898 Number of successful extensions: 883 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 832 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 875 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1401406280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA9D19.yg.ab1 (664 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25605.1 hypothetical protein / predicted by genscan+ 195 2e-50 >At2g25605.1 hypothetical protein / predicted by genscan+ Length = 191 Score = 195 bits (495), Expect = 2e-50 Identities = 98/159 (61%), Positives = 112/159 (69%), Gaps = 12/159 (7%) Frame = +1 Query: 1 KRPFGPRLSFNAEECVQYQLDALMLNDQPRPDYGVEVMYRFAGFDPFERSLYFGPSFDLG 180 KRPFGPRL F+AE+ V++QLDAL ND PR DYG+EVMYRF Sbjct: 54 KRPFGPRLDFSAEDAVRHQLDALKYNDHPRDDYGIEVMYRF------------------- 94 Query: 181 QFERFRRIFHHSSYRVLLNHKERKILSTLNVEE------------NRYKQRVWIRGARPE 324 ERFRRIFHHSSYRVLL HK+RK+LS+L VEE NR+KQR+WI+G RPE Sbjct: 95 --ERFRRIFHHSSYRVLLGHKDRKLLSSLFVEESSPHDILFFDMQNRFKQRIWIQGNRPE 152 Query: 325 EEETFQFTMVQRVGGFWDGYWLTESLHHDGDSFSGGVAY 441 EEE F+FTM QR+GG WDGYWLTESL HDGD FSGG+AY Sbjct: 153 EEEIFEFTMFQRIGGSWDGYWLTESLLHDGDVFSGGMAY 191 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,255,060 Number of Sequences: 27288 Number of extensions: 312667 Number of successful extensions: 723 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 721 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1103221552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA9N04.yg.ab1 (224 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63690.1 unknown protein / 93 3e-20 >At5g63690.1 unknown protein / Length = 139 Score = 92.8 bits (229), Expect = 3e-20 Identities = 43/72 (59%), Positives = 57/72 (78%) Frame = +2 Query: 8 DIVRLSNGIFSYNRSNHLLLRAGKRGKVDKAGEFTMAFVESSNMTEISWVPDPNNSSIYI 187 DIV+L+NGIFSY R++ L+LRAGKRGK++K GEFT+AFVE+ N++EI W+PDP N YI Sbjct: 64 DIVKLTNGIFSYVRNSGLILRAGKRGKMEKMGEFTVAFVETPNISEIQWIPDPENPKRYI 123 Query: 188 LHPIISPLSFIF 223 ++S S IF Sbjct: 124 QSGVVSAYSRIF 135 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,618,015 Number of Sequences: 27288 Number of extensions: 76824 Number of successful extensions: 164 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 164 length of database: 11,516,596 effective HSP length: 50 effective length of database: 10,152,196 effective search space used: 243652704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB10C12.yg.ab1 (635 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g06160.1 splicing factor 3a / ; supported by cDNA: gi_145... 236 1e-62 >At5g06160.1 splicing factor 3a / ; supported by cDNA: gi_14532639_gb_AY039944.1_ Length = 504 Score = 236 bits (601), Expect = 1e-62 Identities = 113/192 (58%), Positives = 142/192 (73%) Frame = +2 Query: 2 TNVFSAFYDRLKEIREYHRRHPSARVXXXXXXXXXXXXXXPQIEFSGEEAYGRYLDLHEL 181 TNVFS FYDRLKEIREYH+RHPS R+ P I FSGEE GRYLDLH++ Sbjct: 84 TNVFSEFYDRLKEIREYHKRHPSGRLVDANEDYEARLKEEPIIAFSGEEGNGRYLDLHDM 143 Query: 182 YNDYINSKFGKKIDYTAYLDVFSQPQHIPRKLKMTRQYKDYLSKMTEYLVYFLERTEPLQ 361 YN YINSKFG++++Y+AYLDVFSQP+ IPRKLK++RQY Y+ + EYLVYF +RTEPLQ Sbjct: 144 YNQYINSKFGERVEYSAYLDVFSQPEKIPRKLKLSRQYMKYMEALLEYLVYFFQRTEPLQ 203 Query: 362 DLDRLFLKVTAEFEEQWADGKVDGWKDEAQENGHATDKNTSELDLEYYSTVNDLVIIGPE 541 DLDR+ KV ++FEEQ+ADG V+G +E + H +DL+YYSTV +LV +GPE Sbjct: 204 DLDRILSKVCSDFEEQYADGIVEGLDNELIPSQHTV------IDLDYYSTVEELVDVGPE 257 Query: 542 RLKEAIGCTGIK 577 +LKEA+G G+K Sbjct: 258 KLKEALGALGLK 269 Score = 51.6 bits (122), Expect = 3e-07 Identities = 24/29 (82%), Positives = 25/29 (85%) Frame = +3 Query: 549 RRPLGALGLKTGGTVQQRAERLFLTKHTP 635 + LGALGLK GGT QQRAERLFLTKHTP Sbjct: 260 KEALGALGLKVGGTPQQRAERLFLTKHTP 288 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,615,712 Number of Sequences: 27288 Number of extensions: 249810 Number of successful extensions: 705 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 703 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB10J02.yg.ab1 (609 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21150.1 putative protein / ribophorin II precursor, Homo ... 241 2e-64 >At4g21150.1 putative protein / ribophorin II precursor, Homo sapiens, PIR2:B26168; supported by cDNA: gi_16604453 Length = 691 Score = 241 bits (615), Expect = 2e-64 Identities = 118/197 (59%), Positives = 148/197 (74%), Gaps = 2/197 (1%) Frame = +3 Query: 3 LEGDI--VESEKKLDLPGKNDLALSANHLQKLHVSFLLTTPFGKPFKPHQALLKLRHESG 176 L+ DI VES+KKLDL ++LSANHLQKL +SF LTTP G FKPHQA KL+HES Sbjct: 433 LDSDIGSVESQKKLDLTKDGAVSLSANHLQKLRLSFQLTTPLGNAFKPHQAFFKLKHESQ 492 Query: 177 VEHIFVVGNSGTHFEITLDFLSLVEKFYYLSGQYDIELTVGDAVMENSFLQPLGSIELDL 356 VEHIF+V SG E+ LDFL LVEK YYLSG+Y+I+LT+GDA MENS L +G IELDL Sbjct: 493 VEHIFLVKTSGKKSELVLDFLGLVEKLYYLSGKYEIQLTIGDASMENSLLSNIGHIELDL 552 Query: 357 PKAPEKSTQPPPQAVNPYLRYGPKPEIAHIFRVPEKLPPQEVSFAFLGLVLVPFLAFXXX 536 P+ PEK+T+PP Q+ PY RYGPK EI+HIFR+PEKLP +++S FLG++++PF+ F Sbjct: 553 PERPEKATRPPLQSTEPYSRYGPKAEISHIFRIPEKLPAKQLSLVFLGVIVLPFIGFLIG 612 Query: 537 XXXXXVNLKNFPTSAHS 587 VN+K+FP+S S Sbjct: 613 LTRLGVNIKSFPSSTGS 629 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,590,457 Number of Sequences: 27288 Number of extensions: 314015 Number of successful extensions: 1089 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1000 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1085 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 966764592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB10J12.yg.ab1 (729 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g10370.1 putative glycerol-3-phosphate dehydrogenase / sim... 244 3e-65 >At3g10370.1 putative glycerol-3-phosphate dehydrogenase / similar to glycerol-3-phosphate dehydrogenase GB:BAA08926 [Mus musculus]; supported by cDNA: gi_17380777 Length = 629 Score = 244 bits (624), Expect = 3e-65 Identities = 114/152 (75%), Positives = 136/152 (89%) Frame = +1 Query: 4 GWDPAYFTVLSQEYVRMKVSHTGKVVPGVMDTAVAKHLSHSYGTMAEKVAAIAQNENLGK 183 GW+P+ FT L+Q+YVRMK ++ GKVVPG MDTA AKHLSH+YG+MA++VA IAQ E LGK Sbjct: 477 GWEPSSFTTLAQQYVRMKKTYGGKVVPGAMDTAAAKHLSHAYGSMADRVATIAQEEGLGK 536 Query: 184 RLAHGYPYLEAEVAYCARNEYCESATDFIARRSRLAFLDTDAAGRAVPRVIQILASEHQW 363 RLAHG+P+LEAEVAYCAR+EYCESA DFIARR R+AFLDTDAA RA+ RV++ILASEH+W Sbjct: 537 RLAHGHPFLEAEVAYCARHEYCESAVDFIARRCRIAFLDTDAAARALQRVVEILASEHKW 596 Query: 364 DKGRQKQELESATKFLESFKSSKNAQFHDGKH 459 DK RQKQEL+ A +FLE+FKSSKNAQF+DGKH Sbjct: 597 DKSRQKQELQKAKEFLETFKSSKNAQFNDGKH 628 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,072,190 Number of Sequences: 27288 Number of extensions: 334273 Number of successful extensions: 923 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 890 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 922 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1286100700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB10J15.yg.ab1 (695 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g15140.1 expressed protein / Contains a PF|00175 Oxidoredu... 317 3e-89 >At1g15140.1 expressed protein / Contains a PF|00175 Oxidoreductase FAD/NADH-binding domain. ESTs gb|H76345 and gb|AA651465 come from this gene; supported by cDNA: gi_15451091_gb_AY054626.1_ Length = 295 Score = 317 bits (813), Expect(2) = 3e-89 Identities = 153/209 (73%), Positives = 181/209 (86%) Frame = +3 Query: 3 VRQPDTTLWTPSPLAGVKPAAESLFHVTIDVSDSPDLASTYTVAGQYLQIRIPNVEKPSF 182 VRQ D +LWTP+PL+ ++ AAESLFH++ID+S++PDL ++YT GQYLQIR+P+VEKPSF Sbjct: 51 VRQ-DASLWTPAPLSLIESAAESLFHISIDISNAPDLVASYTRPGQYLQIRVPDVEKPSF 109 Query: 183 LAIASPPSVAVTNGVFEFLVKSIAGSTAELLCGLGKGDVVELSPVMGKGFGVDQISPPED 362 +AIASPPS+A + G FEFLVKSIAGSTAE+LCGL KG+ VELS VMG GF +D I PPE+ Sbjct: 110 MAIASPPSLASSRGAFEFLVKSIAGSTAEILCGLKKGETVELSSVMGNGFNIDLIDPPEE 169 Query: 363 YQSVFIFATGSGISPIRSLIESGFSADKRSDVRLYYGARNLQRMAYQDRFKAWESSGVTI 542 Y +V IFATGSGISPIRSLIESGF AD+RSDVRLYYGARNL RMAYQ++FK WES+GV + Sbjct: 170 YPTVLIFATGSGISPIRSLIESGFGADRRSDVRLYYGARNLNRMAYQEKFKEWESAGVKV 229 Query: 543 VPVLSQPDDGWAGEAGYVQAAFARANNFT 629 VPVLSQPDDGW GE GYVQAAFARA + Sbjct: 230 VPVLSQPDDGWKGETGYVQAAFARAKQLS 258 Score = 29.3 bits (64), Expect(2) = 3e-89 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +2 Query: 614 SEQLYAPDSTGAVLCGQNK 670 ++QL AP +TGAVLCGQ + Sbjct: 254 AKQLSAPKATGAVLCGQKQ 272 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,589,495 Number of Sequences: 27288 Number of extensions: 355496 Number of successful extensions: 966 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 962 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1201087980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB10K16.yg.ab1 (669 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28430.1 expressed protein / ;supported by full-length cD... 104 1e-29 At5g58000.1 putative protein / similar to unknown protein (gb... 62 4e-10 >At4g28430.1 expressed protein / ;supported by full-length cDNA: Ceres:1885. Length = 457 Score = 104 bits (260), Expect(2) = 1e-29 Identities = 67/171 (39%), Positives = 87/171 (50%) Frame = +1 Query: 67 VNDLIMWNDVAKSTL*FGFG*LCILSSCFTTGVSXXXXXXXXXXXXXQNFSFIKGT***K 246 ++DLIMW DVAKSTL FGFG +C LS+CF + F+F Sbjct: 195 ISDLIMWRDVAKSTLWFGFGCICFLSTCF----------------AAKGFNF-------- 230 Query: 247 PHNILYIIDQLYIGIH*RCYNKPELKCFIFVFSMVALVSQLGLLCLCVLFISNMIAQRNG 426 S+ + +S LGLL L V F+SN + QR Sbjct: 231 --------------------------------SVFSAISYLGLLFLGVSFLSNTLRQRVT 258 Query: 427 IESKRELKLKEEDILRAARVILPAVNFAISKARKLFSGQPSTTLKVAPLLL 579 E++RELKL E+D+LR AR +LP N AISK +LFSG+P+ TLKVAP +L Sbjct: 259 EEARRELKLSEDDVLRIARRMLPITNLAISKTSELFSGEPAMTLKVAPFVL 309 Score = 42.7 bits (99), Expect(2) = 1e-29 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = +3 Query: 570 IVASEYGHIATFKRLCALGFFIGFTGPKLDSLY 668 ++ +EYG++ T RLCA GFF+ FT PKL S Y Sbjct: 309 LMGAEYGYLITLWRLCAFGFFLSFTIPKLYSCY 341 >At5g58000.1 putative protein / similar to unknown protein (gb|AAD25584.1) Length = 1008 Score = 61.6 bits (148), Expect = 4e-10 Identities = 30/81 (37%), Positives = 54/81 (66%), Gaps = 2/81 (2%) Frame = +1 Query: 340 FSMVALVSQLGLLCLCVLFISNMIAQRNGIESKRE--LKLKEEDILRAARVILPAVNFAI 513 FS +++V+ +GL+ L ++F+ + R +E +R + ++EED+ R R+I+P +N ++ Sbjct: 367 FSFISVVAYMGLIYLGLMFVLKSLIHRGMVEEERHKVVGVREEDVKRMLRLIMPYLNESL 426 Query: 514 SKARKLFSGQPSTTLKVAPLL 576 + R LFSG PSTTLK+ +L Sbjct: 427 HQLRALFSGDPSTTLKMGVVL 447 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,368,569 Number of Sequences: 27288 Number of extensions: 300640 Number of successful extensions: 719 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 718 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB10N19.yg.ab1 (573 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13750.1 hypothetical protein / 107 5e-28 >At4g13750.1 hypothetical protein / Length = 2137 Score = 107 bits (266), Expect(2) = 5e-28 Identities = 49/85 (57%), Positives = 67/85 (78%), Gaps = 1/85 (1%) Frame = +1 Query: 1 RTGEVVAFKYYLSKIG-EKCVKWVNEVKESGLPYDIVVKGENNKKEYIEVKATSNARKDW 177 R GE +A++Y+++K G E VKWVN+ E+GLPYD++++ KKEY+EVKAT + RKD+ Sbjct: 2014 RKGEEIAYRYFVAKYGNEALVKWVNDQSETGLPYDLMIENRGGKKEYVEVKATVSTRKDY 2073 Query: 178 FVITVREWQFAVEKGESFSIARVVL 252 F +TVREWQFA EKGES+ IA V+L Sbjct: 2074 FNLTVREWQFANEKGESYIIAHVLL 2098 Score = 34.3 bits (77), Expect(2) = 5e-28 Identities = 14/24 (58%), Positives = 19/24 (78%) Frame = +2 Query: 266 SAQITIYRNPFKLCQSGHLQLAIL 337 +A +T +RNP KLCQ GHL+L +L Sbjct: 2102 NAILTQHRNPVKLCQEGHLRLLVL 2125 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,963,719 Number of Sequences: 27288 Number of extensions: 236595 Number of successful extensions: 677 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 677 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 859346304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB11B14.yg.ab1 (748 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g06510.1 hypothetical protein / predicted by genemark.hmm 140 5e-34 >At1g06510.1 hypothetical protein / predicted by genemark.hmm Length = 265 Score = 140 bits (354), Expect = 5e-34 Identities = 80/188 (42%), Positives = 125/188 (65%), Gaps = 1/188 (0%) Frame = +2 Query: 23 GKENEARDMLFQKKKVMQALDNTKSQIELLDELAAKLIEAISLKERQLVTTVSSDLEIEK 202 GKEN+ARD+L QKKKVMQALD K++IELLD L++KL EAIS+KE QL+ +S DLE + Sbjct: 81 GKENDARDLLLQKKKVMQALDKAKARIELLDTLSSKLNEAISVKETQLIGNISLDLEEDG 140 Query: 203 EDDESPVRVMSPSSENSEKDSLNMNDNQEPQERTNELSTEHETDDLEGFLEDHGIDKNDD 382 E+ + ++SP E++E D + ND+ +L E +D + L+ + D Sbjct: 141 ENTSGGIHIVSPKPESTE-DGVE-NDHTHLDSEGIQL-IERNVEDYQELLDTNNNVLEDV 197 Query: 383 LISS-LTGLTSFVDFLDRVDEQLNKVEAEVFTVMKFSNLILESEERPTNPKVQQLMEILD 559 I S L ++S+ FL+ +D++L+++EAE+ TV+ ++L+L E++P N KVQQ EIL+ Sbjct: 198 SIGSILKEVSSYESFLENLDQKLSRIEAELVTVVNVASLVLNHEDKPKNLKVQQTAEILE 257 Query: 560 AVQRIRKR 583 ++R+R+R Sbjct: 258 EIRRVRER 265 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,598,010 Number of Sequences: 27288 Number of extensions: 233188 Number of successful extensions: 1247 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1238 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB11H08.yg.ab1 (238 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g30610.1 unknown protein / 61 1e-10 >At2g30610.1 unknown protein / Length = 114 Score = 61.2 bits (147), Expect = 1e-10 Identities = 24/36 (66%), Positives = 27/36 (74%) Frame = +2 Query: 5 NALLPFRYFRVALVAPTTDNINPWTLCICFLELYGY 112 NALLPFR+FR+ L PT D PW CIC+LELYGY Sbjct: 77 NALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGY 112 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,872,678 Number of Sequences: 27288 Number of extensions: 80843 Number of successful extensions: 185 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 185 length of database: 11,516,596 effective HSP length: 54 effective length of database: 10,043,044 effective search space used: 241033056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB11K02.yg.ab1 (700 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g64050.1 unknown protein / 75 3e-14 >At1g64050.1 unknown protein / Length = 668 Score = 75.5 bits (184), Expect = 3e-14 Identities = 61/225 (27%), Positives = 95/225 (42%), Gaps = 7/225 (3%) Frame = +2 Query: 11 PRNGEAFVDHDMVSGQEAKQSQRKTGKXXXXXXXXXXXXXVAQMGASLNVTGVADTSDLH 190 P+NG + ++ E+ +S RK GK + V D Sbjct: 102 PQNG-----YSPIASPESAESPRKRGKLSRSSSGNGTPRRTKLILLDETVRTQRDNDT-- 154 Query: 191 KELGSYSGKYNIAEKTQTAKPKTAVSGKRSEKRNGKIPKNKCDSFSVKXXXXXXXXXXXX 370 KE+ G + +K K +++ +GKR +KR K+P + + Sbjct: 155 KEICG-QGSTSCLDKPFVVKQRSSYNGKRGDKRISKVPVRTLSTIN---------SATGE 204 Query: 371 NNILGVYGSKHDIRDLVKHVEDVSLNELLDGSYKCPNSVKVKEKSTEALNGSILQSVREA 550 N G YG K I D+ K VED SL LL+GSY+CP+ K K K +E N ++L V+ Sbjct: 205 NAFFGAYGLKPAINDVTKLVEDFSLKSLLEGSYECPSLGKDKMKKSENTNNTLLSVVKNV 264 Query: 551 CSVLHLQKLSQTPKVPAADTTYN-------YSASSFLPNTSTNDE 664 S+L ++ Q+ DT + S S+ LPN+ D+ Sbjct: 265 WSILPTKRPVQSQSSTELDTCLSRTLGSPPSSISATLPNSENIDK 309 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,014,148 Number of Sequences: 27288 Number of extensions: 261578 Number of successful extensions: 782 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 781 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1209984928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB12D22.yg.ab1 (760 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g62840.1 putative protein / ;supported by full-length cDN... 224 8e-78 >At5g62840.1 putative protein / ;supported by full-length cDNA: Ceres:5589. Length = 297 Score = 224 bits (572), Expect(2) = 8e-78 Identities = 116/185 (62%), Positives = 141/185 (75%), Gaps = 9/185 (4%) Frame = +3 Query: 84 HPQP-PQTTIKPIH--------RRHILASLAATITPFFAPHPHPNSDQSPHIPISVLPSA 236 HP P P+T P++ RR + +L+ I +P + +S+ A Sbjct: 15 HPPPSPETYQIPLNLLSSPHITRRDLFKTLSVCIA-------------TPSLSVSIAAPA 61 Query: 237 NARGLFQMPPVRLTNRYFLVRAGESEYESLGVINTNPVAKTSVDNGLSTIGKKQTVRAAL 416 NARGLFQMPP+RL+NRY+LVRAGES+YESLG+INTNPVAKTSVD+GLS GKKQT+RAAL Sbjct: 62 NARGLFQMPPLRLSNRYYLVRAGESDYESLGIINTNPVAKTSVDSGLSEKGKKQTLRAAL 121 Query: 417 RLKEMGACENSCWIWPSITQRAYQAAEIIAAVNGVNRSNIVPEYSFLDARGLGAYEGKAL 596 +LK MGAC+ +CW+WPSITQRAYQAAEIIAA+NG++RS IVPEYSFLDARGLGAYEGK L Sbjct: 122 QLKAMGACDRNCWLWPSITQRAYQAAEIIAAINGISRSYIVPEYSFLDARGLGAYEGKKL 181 Query: 597 QSFSE 611 +S SE Sbjct: 182 ESISE 186 Score = 84.0 bits (206), Expect(2) = 8e-78 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +2 Query: 611 IYASDLVSPDIKPPPINDGTPNESVADVFVRVTQLMSILETQYSEDTVII 760 +YA D +S KPPPI+DGTPNESV+DVFVRVTQLMSILETQYSEDT++I Sbjct: 187 VYALDSISMKTKPPPISDGTPNESVSDVFVRVTQLMSILETQYSEDTIVI 236 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,301,439 Number of Sequences: 27288 Number of extensions: 385284 Number of successful extensions: 1663 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1627 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1374797300 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB13M09.yg.ab1 (669 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g17610.1 putative protein / 260 5e-70 >At4g17610.1 putative protein / Length = 1850 Score = 260 bits (664), Expect = 5e-70 Identities = 135/226 (59%), Positives = 164/226 (71%), Gaps = 10/226 (4%) Frame = +3 Query: 18 SLQSGKLFLLELLQSVVSDTDLAKELYKKCSATHRRKVRAWQMICILSRFVDEDIISQVM 197 +L +GKLFLLELL + V D DLAKELYKK SA HRRK+RAWQMICI+SRFV DI+ QVM Sbjct: 1330 ALVAGKLFLLELLDAAVHDKDLAKELYKKYSAIHRRKIRAWQMICIMSRFVCNDIVGQVM 1389 Query: 198 DHLHTALY--------RNNMPGVRQYMETFAIHVYLKFPLLVGEQLVPMARKYDMRTQA- 350 D +H L+ RNN+P VRQY+ETFAI++YLKFP LV EQLVP+ + YD + Q Sbjct: 1390 DSVHICLHVSLQEQTERNNLPAVRQYLETFAINIYLKFPALVKEQLVPILKNYDSKAQVN 1449 Query: 351 -LSSYVFIAANVILHATKDTQSRHLDELLPPIVPLLTSHHHSLRGFTQLLVYQVLSKLLP 527 + + + ANVILHA K Q HL ELLPPI+PLLTSHHHSLRGF QLLV++VL +L P Sbjct: 1450 LRKTKMIVFANVILHAEKIAQQTHLRELLPPILPLLTSHHHSLRGFAQLLVHRVLFRLFP 1509 Query: 528 SINSYANGTLPLEKRCFMELQSYLQVTSDCARLRVSMEVHLHAFDP 665 + S ++ T+ LEK F L+SYL DC+RLR SME L A+DP Sbjct: 1510 PVESTSSHTISLEKLSFENLKSYLDKNPDCSRLRASMEGFLDAYDP 1555 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,286,375 Number of Sequences: 27288 Number of extensions: 333924 Number of successful extensions: 773 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 771 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB14B08.yg.ab1 (654 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g03910.1 hypothetical protein / predicted by genscan 283 4e-77 >At1g03910.1 hypothetical protein / predicted by genscan Length = 672 Score = 283 bits (725), Expect = 4e-77 Identities = 131/201 (65%), Positives = 158/201 (78%), Gaps = 2/201 (0%) Frame = +3 Query: 57 DLEGDEVPEAIPRSEQQEMEDEEAGSFSPELLHGXXXXXXXXXXXXRAILERNRIQVVEE 236 D E PE + E+ + E AGSFSPEL+HG + +L+ R+ V+E+ Sbjct: 436 DAEEAFSPEPVAEEEEADEAAEAAGSFSPELMHGDDREEAIDPEEDKKLLQMKRMIVLEK 495 Query: 237 QQRKLQEAMALPPP--EDSLEMRAVKAMGAMDNGDEVFGNSDEVNVDSQVYWWHDKYRPR 410 Q+++L+EAM P ED+LE++A+KAMGAM+ GD +FG++ EVN+DS+VYWWHDKYRPR Sbjct: 496 QKKRLKEAMDSKPAPVEDNLELKAMKAMGAMEEGDAIFGSNAEVNLDSEVYWWHDKYRPR 555 Query: 411 KPKYFNRVHTGYEWNKYNQTHYDHDNPPPKIVQGYKFNIFYPDLVDKTKAPVYTIERDGD 590 KPKYFNRVHTGYEWNKYNQTHYDHDNPPPKIVQGYKFNIFYPDLVDK KAP+YTIE+DG Sbjct: 556 KPKYFNRVHTGYEWNKYNQTHYDHDNPPPKIVQGYKFNIFYPDLVDKIKAPIYTIEKDGT 615 Query: 591 SAXTCIIRFHAGPTYEDIAFR 653 SA TC+IRFHAGP YEDIAFR Sbjct: 616 SAETCMIRFHAGPPYEDIAFR 636 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,561,555 Number of Sequences: 27288 Number of extensions: 336980 Number of successful extensions: 1217 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1211 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1088756792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB14G10.yg.ab1 (744 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g46450.1 SEC14 cytosolic factor, putative / supported by c... 162 6e-59 >At3g46450.1 SEC14 cytosolic factor, putative / supported by cDNA: gi_20453103 Length = 486 Score = 162 bits (410), Expect(2) = 6e-59 Identities = 80/174 (45%), Positives = 114/174 (64%), Gaps = 8/174 (4%) Frame = +1 Query: 10 VFLLTTAALEIVRRFSSAHCPFIWRGIQALQILCCPPFKWIQKWAPFTGLVKGMQTLSKP 189 VFLL A LE+VRR S A CP +W +QALQ LC PP KWIQ+WAPF L+ MQ LS+P Sbjct: 62 VFLLKIAVLEVVRRVSKAKCPHLWNSLQALQCLCYPPLKWIQRWAPFKELINAMQMLSRP 121 Query: 190 LLLLSVATGLFSELDSPKGTLSGSGAEL-TELSSQLATQDTRPANKVSRH-------VAE 345 LL++++A L + + + G+ + +E SQ +Q + + + +++ Sbjct: 122 LLVITIAEALTDQSELKQEASGGTNSHASSESESQSDSQTLQSPSDIRIEDEAPLPVISQ 181 Query: 346 NWLVQLYAELDKEGLTIPERMNEEELRRFYAVSDGDFALFLSSVKKTILWRQTY 507 +WL +LY EL+K+ L++PER+NE+EL RFY VS+GDF LSS+KKTI WR+TY Sbjct: 182 DWLRKLYEELEKQRLSLPERLNEDELHRFYRVSNGDFTSLLSSIKKTIHWRETY 235 Score = 83.2 bits (204), Expect(2) = 6e-59 Identities = 38/76 (50%), Positives = 57/76 (75%), Gaps = 1/76 (1%) Frame = +2 Query: 518 SPQELDAWANFVFWHGSDSMQRPCLIVRIGLA-ADLASIAQAQFVRAVVSQVEYXSINLL 694 S +EL+ W++ +FWHG D QRPCLIVR+GLA L S + +F +A++SQVE+ ++LL Sbjct: 239 SEEELETWSSLLFWHGYDKNQRPCLIVRLGLAFLKLPSHERPRFAQAIISQVEHGVLHLL 298 Query: 695 DAEHPQVTVLMDCDGL 742 E+ ++TVL+DC+GL Sbjct: 299 TPENSELTVLVDCEGL 314 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,537,934 Number of Sequences: 27288 Number of extensions: 409262 Number of successful extensions: 1180 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1176 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1330449000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB14K03.yg.ab1 (669 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60340.1 putative protein / predicted proteins from variou... 150 4e-37 >At5g60340.1 putative protein / predicted proteins from various species, Human, yeast, Oryctolagus sp. Length = 337 Score = 150 bits (380), Expect = 4e-37 Identities = 70/94 (74%), Positives = 83/94 (87%) Frame = +2 Query: 2 TGKTTTSSALAEATHLRHINIGDLVKDKKLHDGWDDHLQCYIINEDLVCDELEDIMEEGG 181 TGK+TT+SALAEAT+LR+I IGDLVK+K+ + GWD+ L+C+ INED V DEL+D M EGG Sbjct: 24 TGKSTTASALAEATNLRYICIGDLVKEKEFYHGWDNELECHFINEDSVIDELDDAMIEGG 83 Query: 182 IIVDYHGCDFFPERWFDRVVVLRTETSVLYDRLS 283 IVDYHGCDFFP+RWFDRVVVLRTE SVLYDRL+ Sbjct: 84 NIVDYHGCDFFPQRWFDRVVVLRTENSVLYDRLT 117 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,463,390 Number of Sequences: 27288 Number of extensions: 329001 Number of successful extensions: 1036 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1035 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB14L12.yg.ab1 (790 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16620.1 translocon Tic40-like protein / ; supported by c... 235 2e-62 >At5g16620.1 translocon Tic40-like protein / ; supported by cDNA: gi_16226312_gb_AF428299.1_AF428299 Length = 447 Score = 235 bits (600), Expect = 2e-62 Identities = 122/189 (64%), Positives = 142/189 (74%), Gaps = 3/189 (1%) Frame = +1 Query: 232 KEPKKSAFIDVSPEETLKTS-FEKLEESTDTESPKDSQFPNQVSQNGSAFKPMDSSFEGA 408 KE K AF D+SPEET K S F E ++T SPK+++ V QNG+ ++ E Sbjct: 228 KEEKNYAFEDISPEETTKESPFSNYAEVSETNSPKETRLFEDVLQNGAGPANGATASEVF 287 Query: 409 SSTG--TKGPAMSVEALEKMMEDPTVQKMVYPYLPEEMRNPTSFKWMLQNPQYRQQLQDM 582 S G GP +SVEALEKMMEDPTVQKMVYPYLPEEMRNP +FKWML+NPQYRQQLQDM Sbjct: 288 QSLGGGKGGPGLSVEALEKMMEDPTVQKMVYPYLPEEMRNPETFKWMLKNPQYRQQLQDM 347 Query: 583 LNNMGGSPEWDSRMMDSLXNFDISSPEVKEQFDQIGLTPERSISKIMANP*CALAFQNPR 762 LNNM GS EWD RM D+L NFD++SPEVK+QF+QIGLTPE ISKIM NP A+AFQNPR Sbjct: 348 LNNMSGSGEWDKRMTDTLKNFDLNSPEVKQQFNQIGLTPEEVISKIMENPDVAMAFQNPR 407 Query: 763 KSAAIMDCS 789 AA+M+CS Sbjct: 408 VQAALMECS 416 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.130 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,664,170 Number of Sequences: 27288 Number of extensions: 385872 Number of successful extensions: 1416 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1408 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1463493900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB14N11.yg.ab1 (347 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g36930.1 expressed protein / ; supported by cDNA: gi_1502... 121 7e-29 >At2g36930.1 expressed protein / ; supported by cDNA: gi_15027948_gb_AY045831.1_ Length = 198 Score = 121 bits (303), Expect = 7e-29 Identities = 51/64 (79%), Positives = 60/64 (93%) Frame = +1 Query: 46 GMGQYYCLHCDRYFANVAVRDEHFKTKRHKKRLKVMAGPAPHTQIDADLAAGMGMPDNGP 225 GMGQ+YCLHCDRYF+NV+VRD+HFKTK+HKKR+ +M G APH+Q+DADLA GMGMPDNGP Sbjct: 54 GMGQFYCLHCDRYFSNVSVRDDHFKTKKHKKRVNMMMGQAPHSQLDADLAGGMGMPDNGP 113 Query: 226 KLMS 237 KLMS Sbjct: 114 KLMS 117 Score = 101 bits (251), Expect = 8e-23 Identities = 45/64 (70%), Positives = 53/64 (82%) Frame = +1 Query: 46 GMGQYYCLHCDRYFANVAVRDEHFKTKRHKKRLKVMAGPAPHTQIDADLAAGMGMPDNGP 225 GMGQ+ CL C R F+N +V D HFKTK+HKKR+K + PAPH+Q+DADLA GMGMPDNGP Sbjct: 134 GMGQFNCLLCHRNFSNASVMDYHFKTKKHKKRVKKIERPAPHSQLDADLAGGMGMPDNGP 193 Query: 226 KLMS 237 KLMS Sbjct: 194 KLMS 197 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,159,264 Number of Sequences: 27288 Number of extensions: 144001 Number of successful extensions: 321 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 315 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 321 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 216801312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB15J02.yg.ab1 (649 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57850.1 branched-chain amino acid aminotransferase-like prot... 291 3e-79 At3g05190.1 putative branched-chain amino acid aminotransferase ... 59 2e-09 At5g27410.1 putative amino acid aminotransferase / branched-c... 57 6e-09 >At5g57850.1 branched-chain amino acid aminotransferase-like protein / ; supported by cDNA: gi_20466633 Length = 373 Score = 291 bits (744), Expect = 3e-79 Identities = 143/210 (68%), Positives = 171/210 (81%), Gaps = 1/210 (0%) Frame = +3 Query: 18 QRYLAMYSSVFGGITTDQGAMVIPMDDHMVHRGHGVFDTAAIVDGFLYELEQHLDRFLGS 197 Q++LAMYSSV GITTD AMV+P+DDHMVHRGHGVFDTA I++G+LYEL+QHLDR L S Sbjct: 73 QQFLAMYSSVVDGITTDPAAMVLPLDDHMVHRGHGVFDTALIINGYLYELDQHLDRILRS 132 Query: 198 ASKAKIKPPFDKETTKRILVQTASASSCKNGSLRYWLSSGPGDFQLSPSGCHQSTLYAIV 377 AS AKI PFD+ET KRIL+QT S S C++GSLRYWLS+GPGDF LSPS C + TLYAIV Sbjct: 133 ASMAKIPLPFDRETIKRILIQTVSVSGCRDGSLRYWLSAGPGDFLLSPSQCLKPTLYAIV 192 Query: 378 IQDLSPPNYNGIKVITSSVPIKPPQFATMKSVNYLPNVLSKMEAEENGAYAAIWLDEQGF 557 I+ N G+KV+TSS+PIKPP+FAT+KSVNYLPNVLS+MEAE GAYA IW+ + GF Sbjct: 193 IKTNFAINPIGVKVVTSSIPIKPPEFATVKSVNYLPNVLSQMEAEAKGAYAGIWVCKDGF 252 Query: 558 VAEGPNMNVAFVA-PESDLLMPPFEKYSAG 644 +AEGPNMNVAFV +L+MP F+ +G Sbjct: 253 IAEGPNMNVAFVVNGGKELVMPRFDNVLSG 282 >At3g05190.1 putative branched-chain amino acid aminotransferase / ; supported by cDNA: gi_18087611 Length = 555 Score = 59.3 bits (142), Expect = 2e-09 Identities = 50/187 (26%), Positives = 82/187 (43%), Gaps = 12/187 (6%) Frame = +3 Query: 96 DHMVHRGHGVFDTAAIVDGFLYELEQHLDRFLGSASKAKIKPPFDKETTKRILVQTASAS 275 D +V G V++ I G +++LE+HLDR SA +E K + +T + Sbjct: 282 DSVVQGGDSVWEGLRIYKGKIFKLEEHLDRLFDSAKALAFDNVPAREEVKEAIFRTLITN 341 Query: 276 SC-KNGSLRYWLSSGPGDFQLSPSGCHQSTLYAIVIQDLSPPNYN---GIKVITSSVPIK 443 N +R L+ G ++ IV+ + PP Y+ GI ++T++ Sbjct: 342 GMFDNTHIRLSLTRGKKVTSGMSPAYNRYGCTLIVLAEWKPPVYDNEGGIVLVTATTRRN 401 Query: 444 PPQFATMK--SVNYLPNVLSKMEAEENGAYAAIWLDEQGFVAEGPNMNVAFV------AP 599 P K N L N+L+K+E+ A AI LD+ G+V+E N+ V P Sbjct: 402 SPNNLDSKIHHNNLLNNILAKIESNNTNAADAIMLDKDGYVSETNATNIFMVKKGCVLTP 461 Query: 600 ESDLLMP 620 +D +P Sbjct: 462 HADYCLP 468 >At5g27410.1 putative amino acid aminotransferase / branched-chain amino acid aminotransferase - Pseudomonas aeruginosa, SWISSPROT:ILVE_PSEAE; supported by cDNA: gi_13605848_gb_AF367323.1_AF367323 Length = 559 Score = 57.4 bits (137), Expect = 6e-09 Identities = 50/186 (26%), Positives = 82/186 (43%), Gaps = 6/186 (3%) Frame = +3 Query: 96 DHMVHRGHGVFDTAAIVDGFLYELEQHLDRFLGSASKAKIKPPFDKETTKRILVQTASAS 275 D +V G V++ I G +++LE+HLDR SA +E K + +T + Sbjct: 279 DSVVQGGDSVWEGLRIYKGKVFKLEEHLDRLSDSAKALAFNNVPTREEIKEAIFRTLITN 338 Query: 276 SC-KNGSLRYWLSSGPGDFQLSPSGCHQSTLYAIVIQDLSPPNYN---GIKVITSSVPIK 443 N +R L+ G ++ IV+ + PP Y+ GI ++T++ Sbjct: 339 GMFDNTHIRLSLTRGKKVTSGMSPAFNRYGCTLIVLAEWKPPVYDNDGGIVLVTATTRRN 398 Query: 444 PPQFATMK--SVNYLPNVLSKMEAEENGAYAAIWLDEQGFVAEGPNMNVAFVAPESDLLM 617 P K N L N+L+K+E+ AI LD+ GFV+E N+ V + D ++ Sbjct: 399 SPNNLDSKIHHNNLLNNILAKIESNNANVDDAIMLDKDGFVSETNATNIFMV--KKDRVL 456 Query: 618 PPFEKY 635 P Y Sbjct: 457 TPHADY 462 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,096,645 Number of Sequences: 27288 Number of extensions: 381869 Number of successful extensions: 1115 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 1059 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1113 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1070908320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB15M19.yg.ab1 (667 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13330.1 hypothetical protein / predicted by genscan+ 327 4e-90 >At3g13330.1 hypothetical protein / predicted by genscan+ Length = 1709 Score = 327 bits (837), Expect = 4e-90 Identities = 157/210 (74%), Positives = 184/210 (86%) Frame = -3 Query: 632 QEEGFFSDTFDSLSNIHIISDNENSSRGGHGNSSFQSLADKSITRFYFDFSSSWPRTPTW 453 +EEGFF +TF+SLS+IHI +D ++SSRG HG+SSFQS+ADKSITRFYF+FS+SWPRTP+W Sbjct: 1124 REEGFFKETFESLSHIHI-TDTDSSSRGNHGSSSFQSMADKSITRFYFEFSASWPRTPSW 1182 Query: 452 ISLFGTDTFYSSFARIFKRLVQECGVPVLLSLKTALNEFVNAKERSKQCVAAEAFAGLLH 273 ISL G+D FY SFARIFKRL QECGVPVLL+LK+ L EF NAKER KQCVAAEA AG+LH Sbjct: 1183 ISLLGSDIFYPSFARIFKRLAQECGVPVLLALKSPLEEFCNAKERPKQCVAAEALAGVLH 1242 Query: 272 ADVVGLVEAWDSWMMAQLQNILLAPSVESIHEWAACIRYAVTGKGKYGIKVPLLRQRILD 93 +DV GL WDSW+M QLQN++L SVESI EWAACIRYAVTGKGK G K+P++RQ+ILD Sbjct: 1243 SDVNGLFNEWDSWIMVQLQNVILGQSVESIPEWAACIRYAVTGKGKQGTKIPVMRQQILD 1302 Query: 92 CLVEPLPQTVTTTVVAKRYSFLSAALIEVS 3 C+V PLP T TTTVVAKRY+FLSAALIE+S Sbjct: 1303 CIVAPLPPTATTTVVAKRYAFLSAALIELS 1332 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,108,598 Number of Sequences: 27288 Number of extensions: 291831 Number of successful extensions: 924 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 922 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1112118500 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB15P11.yg.ab1 (616 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g21860.1 expressed protein / ;supported by full-length cDN... 80 9e-17 >At2g21860.1 expressed protein / ;supported by full-length cDNA: Ceres:38497. Length = 522 Score = 79.7 bits (195), Expect(2) = 9e-17 Identities = 35/55 (63%), Positives = 42/55 (75%) Frame = +1 Query: 73 VSRDGEYPNEMP*DRLYSALDRCCIKEWELFEVDNCSCEGAPLGLPEGSRLHMTV 237 V+ DG YP E +RL SAL++C IKEWELF VDNCSCE PLG+P+GSRLH + Sbjct: 455 VTPDGSYPAEKDKERLQSALEKCGIKEWELFAVDNCSCENPPLGIPQGSRLHSRI 509 Score = 23.9 bits (50), Expect(2) = 9e-17 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 Query: 36 RTAGRSYTGAVL 71 R AG+SYTGAVL Sbjct: 443 RVAGQSYTGAVL 454 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,449,852 Number of Sequences: 27288 Number of extensions: 329899 Number of successful extensions: 874 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 837 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 873 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 972741724 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB15P21.yg.ab1 (498 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g67030.1 zeaxanthin epoxidase precursor (LOS6/ABA1)(ZEP) / ... 114 4e-26 >At5g67030.1 zeaxanthin epoxidase precursor (LOS6/ABA1)(ZEP) / identical to GI:9857296 AtABA1; supported by cDNA: gi_10444087_gb_AF281655.1_AF281655 Length = 667 Score = 114 bits (284), Expect = 4e-26 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 3/87 (3%) Frame = -3 Query: 472 EVSKLHARISCKDGAFFVTDLRSEHGTWITDNEDRRYRVPPNFPARFHPSDVIDFGANKK 293 +VSK+HAR+ KDGAFF+ DLRSEHGT++TDNE RRYR PNFPARF SD+I+FG++KK Sbjct: 579 QVSKMHARVIYKDGAFFLMDLRSEHGTYVTDNEGRRYRATPNFPARFRSSDIIEFGSDKK 638 Query: 292 VAFRVKVMRYPPKI---SEGAGDRVFQ 221 AFRVKV+R PK +E D++ Q Sbjct: 639 AAFRVKVIRKTPKSTRKNESNNDKLLQ 665 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,235,043 Number of Sequences: 27288 Number of extensions: 247626 Number of successful extensions: 606 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 606 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 657445300 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB16I04.yg.ab1 (660 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24830.1 argininosuccinate synthase -like protein / argini... 202 1e-52 >At4g24830.1 argininosuccinate synthase -like protein / argininosuccinate synthase, Aquifex aeolicus, PIR2:B70398; supported by cDNA: gi_17529035 Length = 494 Score = 202 bits (515), Expect = 1e-52 Identities = 98/128 (76%), Positives = 107/128 (83%) Frame = +3 Query: 33 GAVYERKYLLGTSMARPVIAKAMVDVAKEVGADAVGHGCTGKGNDQVRIELTFFSLNPDL 212 GA+YERKYLLGTSMARPVIAKAMVDVA EVGADAV HGCTGKGNDQVR ELTFFSLNP+L Sbjct: 174 GAIYERKYLLGTSMARPVIAKAMVDVAAEVGADAVAHGCTGKGNDQVRFELTFFSLNPEL 233 Query: 213 QVVAPWREWDITR*GRCY*ICQKTQCSRPITKKSIYTRDRNLWHLRHDGDILEYPANEPN 392 +VVAPWREW+I +K P+TKKSIY+RDRNLWHL H+GD+LE PANEP Sbjct: 234 KVVAPWREWEIQGREDAIEYAKKHNVPVPVTKKSIYSRDRNLWHLSHEGDLLEDPANEPK 293 Query: 393 KDMYMMSV 416 KDMYMMSV Sbjct: 294 KDMYMMSV 301 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,065,654 Number of Sequences: 27288 Number of extensions: 334404 Number of successful extensions: 876 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 847 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 874 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1106605264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB16N08.yg.ab1 (785 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09210.1 expressed protein / ; est match;supported by full... 68 2e-19 >At3g09210.1 expressed protein / ; est match;supported by full-length cDNA: Ceres:3820. Length = 333 Score = 68.2 bits (165), Expect(2) = 2e-19 Identities = 42/117 (35%), Positives = 54/117 (45%), Gaps = 30/117 (25%) Frame = +1 Query: 127 GNTKRQINKPRPVSKDDMESIFEEVKEKQEAADRAFE-----EEQAXXXXX--------- 264 GNTKRQINKPRPV D+E+IF++ KE QE AD FE EE+A Sbjct: 187 GNTKRQINKPRPVDDSDLEAIFKQAKEAQEKADSEFEEADRAEEEASILASQELLALSNS 246 Query: 265 ----------------XXXXXXXXXXXXXRTLLGSTVRIVSGDFVDFSGTVKKLDKK 387 + GSTVR++SG F +F G +KKL++K Sbjct: 247 DVIETVAESKPKRAPRKATLATETKAKKKKLAAGSTVRVLSGTFAEFVGNLKKLNRK 303 Score = 45.4 bits (106), Expect(2) = 2e-19 Identities = 21/37 (56%), Positives = 27/37 (72%) Frame = +3 Query: 27 PGGVFIHCILNRELHNFIREDCEGVGGFVGRMVRKYK 137 PG +FI CILN+E+H+ IR D +GVGGF+G V K Sbjct: 155 PGCIFIRCILNKEIHDSIR-DVDGVGGFIGSKVGNTK 190 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,885,875 Number of Sequences: 27288 Number of extensions: 317789 Number of successful extensions: 826 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 823 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB16N24.yg.ab1 (809 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g01000.1 putative protein / ; supported by cDNA: gi_16209... 97 1e-20 At5g06160.1 splicing factor 3a / ; supported by cDNA: gi_145... 48 7e-06 >At4g01000.1 putative protein / ; supported by cDNA: gi_16209706 Length = 415 Score = 97.1 bits (240), Expect = 1e-20 Identities = 46/67 (68%), Positives = 58/67 (85%) Frame = +3 Query: 495 EEKVSTKSDCDDILKPLNFDEFNSAAELEVLGMERLKTELQERGLKCGGTLQERAARLYL 674 +E VS + C ++PLNFD+FNS A++EVLGMERLKTELQ RGLKCGGTL+ERAARL+L Sbjct: 339 KETVSVDAVCCKPVEPLNFDDFNSPADMEVLGMERLKTELQSRGLKCGGTLRERAARLFL 398 Query: 675 LKTTPVE 695 LK+TP++ Sbjct: 399 LKSTPLD 405 >At5g06160.1 splicing factor 3a / ; supported by cDNA: gi_14532639_gb_AY039944.1_ Length = 504 Score = 47.8 bits (112), Expect = 7e-06 Identities = 24/51 (47%), Positives = 34/51 (66%) Frame = +3 Query: 543 LNFDEFNSAAELEVLGMERLKTELQERGLKCGGTLQERAARLYLLKTTPVE 695 ++ D +++ EL +G E+LK L GLK GGT Q+RA RL+L K TP+E Sbjct: 240 IDLDYYSTVEELVDVGPEKLKEALGALGLKVGGTPQQRAERLFLTKHTPLE 290 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,732,863 Number of Sequences: 27288 Number of extensions: 308982 Number of successful extensions: 1032 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 986 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1031 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1512045612 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB16O17.yg.ab1 (787 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56720.1 putative protein / 134 4e-32 >At3g56720.1 putative protein / Length = 390 Score = 134 bits (338), Expect = 4e-32 Identities = 94/208 (45%), Positives = 126/208 (60%), Gaps = 19/208 (9%) Frame = +1 Query: 220 KDDEKRSS-WRDSKELDDMKYTRFEKGKSYDQQTRGVKDRYFKEPRQLLDDRSGATANKS 396 +D+EKR S W +++R E+ + D + K+ + K R D + AT ++ Sbjct: 180 EDNEKRGSRWGFGD-----RHSRVERKEHEDPEISKEKEVHVKSSRDRSDGKCLATEDRD 234 Query: 397 N------------FSVGKDTNDASKHVHHEVQSSSSKQ--GQELAAQVAAMKAAELVNRN 534 F+ G +TNDA+ E Q+S K G AA+VAAM+AAELVN+N Sbjct: 235 THSKKLKGFISDKFTTG-NTNDAAAE---EKQTSILKPSPGDVDAAKVAAMQAAELVNKN 290 Query: 535 LIGTGVGMSTDQKKKLLWGSKKTTPTQEVAHRWD--TSMFSDRERQEKFNKLMGVKVEPK 708 L+GTG ++TDQKKKLLWG KK+T ++E AHRWD +++ D ERQEKFNKLMGVK + Sbjct: 291 LVGTGY-LTTDQKKKLLWGKKKSTASEESAHRWDNASALIGDPERQEKFNKLMGVKAKVV 349 Query: 709 PEIQD--SSLAEKQIELQMDLEKQYTAG 786 + Q+ AEKQ ELQMDLEKQYTAG Sbjct: 350 NQEQNLGEVEAEKQKELQMDLEKQYTAG 377 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.309 0.127 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,290,260 Number of Sequences: 27288 Number of extensions: 349473 Number of successful extensions: 825 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 820 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB16P11.yg.ab1 (401 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g58470.1 putative protein / several hypothetical proteins ... 104 2e-23 >At3g58470.1 putative protein / several hypothetical proteins - Saccharomyces cerevisiae; supported by cDNA: gi_16648682_gb_AY058117.1_ Length = 248 Score = 104 bits (259), Expect = 2e-23 Identities = 49/75 (65%), Positives = 60/75 (79%) Frame = +2 Query: 14 RECLEKVSETVSFLKKPGESYLLLLTGAVQHDRAAQLLGLRPCGFRPQHSSKLGNEFRLF 193 RECLE+VS+T+ FL P +S LLLLTG VQ + AA+LLG+RPC F+P HSSKLGNEFRLF Sbjct: 173 RECLERVSQTILFLASPVDSLLLLLTGEVQREHAAELLGVRPCVFKPHHSSKLGNEFRLF 232 Query: 194 TNYHPGLRLCGWEQE 238 +Y PG RL G E++ Sbjct: 233 ISYDPGTRLGGLEED 247 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,133,949 Number of Sequences: 27288 Number of extensions: 151537 Number of successful extensions: 295 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 295 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 410186340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB17C03.yg.ab1 (657 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39070.1 unknown protein / 155 1e-38 At2g39080.1 unknown protein / 69 2e-12 >At2g39070.1 unknown protein / Length = 124 Score = 155 bits (393), Expect = 1e-38 Identities = 74/104 (71%), Positives = 84/104 (80%) Frame = +1 Query: 346 LYKLDRGMHLYYLKQGTIEANPHHLVNLIHYEDAASLCVAILKKKLCGRLFLGCDNHPVS 525 LY RG H Y+L + TI+A P H++NLIHYEDAASL VAI+KKK R+FLGCDNHP+S Sbjct: 7 LYTETRGAHTYWLSKETIDARPDHILNLIHYEDAASLAVAIMKKKAGARIFLGCDNHPLS 66 Query: 526 RQEVMDLVAKSGKFDNTFVGFTGTDGVLGKKLNNSKTREEIGWE 657 RQEVMDL+A+SGKFD F GFT T G LGKKLNNSKTR EIGWE Sbjct: 67 RQEVMDLMAQSGKFDKKFKGFTSTSGPLGKKLNNSKTRAEIGWE 110 >At2g39080.1 unknown protein / Length = 167 Score = 68.9 bits (167), Expect = 2e-12 Identities = 30/48 (62%), Positives = 39/48 (80%) Frame = +1 Query: 1 ETVTTDHHDELIKMGINPTLKGVKREHKFPYVIYCAPPSRSSDYAGDV 144 +TVTT+HH EL +GI P+LKG + KF YVI+CAPPS+S+DYAG+V Sbjct: 119 QTVTTNHHGELENLGIKPSLKGTEYGGKFSYVIFCAPPSQSADYAGEV 166 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,361,614 Number of Sequences: 27288 Number of extensions: 312465 Number of successful extensions: 824 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 800 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 824 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1097681028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB17C14.yg.ab1 (562 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g22570.1 expressed protein / ; supported by full-length cD... 207 2e-57 >At2g22570.1 expressed protein / ; supported by full-length cDNA: Ceres: 117955. Length = 244 Score = 207 bits (528), Expect(2) = 2e-57 Identities = 98/172 (56%), Positives = 131/172 (75%), Gaps = 1/172 (0%) Frame = +1 Query: 1 LPVDEDS-MTLTGDVTIGLVLVDIVNGFCTVGAGHLAPKVPDKQISRMVDESTQLARTFC 177 +PVDE+ + L D ++GLV+VD+VNGFCT+G+G++AP ++QIS+MV+ES +LAR FC Sbjct: 15 IPVDEEEPLILNRDSSVGLVIVDVVNGFCTIGSGNMAPTKHNEQISKMVEESAKLAREFC 74 Query: 178 EKKWPVFAFLDTXXXXXXXXXXXXXCIAGTDEANLVPALQWLENESNVTLRRKDCIDGFV 357 ++KWPV AF+D+ CI GT+E+ LVPAL+WLE+E TLRRKDCI+GFV Sbjct: 75 DRKWPVLAFIDSHHPDIPERPYPPHCIIGTEESELVPALKWLESEDCATLRRKDCINGFV 134 Query: 358 GSFEKHGSNVFVHWVKKHQIEAVLVVGICTDICVLDFRCSALSAKNRGHVTP 513 GS E GSNVFV WVK+ QI+ ++VVGICTDICV DF +ALSA+N G ++P Sbjct: 135 GSMESDGSNVFVDWVKEKQIKVIVVVGICTDICVFDFVATALSARNHGVLSP 186 Score = 32.0 bits (71), Expect(2) = 2e-57 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 503 MLLPLRDVIVYSGACATFDL 562 +L P+ DV+VYS CATFDL Sbjct: 183 VLSPVEDVVVYSRGCATFDL 202 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,903,148 Number of Sequences: 27288 Number of extensions: 301204 Number of successful extensions: 875 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 874 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 835029516 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18A13.yg.ab1 (237 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46540.1 expressed protein / ; supported by full-length c... 74 1e-14 >At2g46540.1 expressed protein / ; supported by full-length cDNA: Ceres: 25575. Length = 65 Score = 73.9 bits (180), Expect = 1e-14 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -2 Query: 176 PIVAASCLIGGFGLALPAFVRPMLDSFESTKQAPQPALSDVVAGMTGKKE 27 P+VAASCLIGG GL LPA VRP+LDS E++KQ P L+DV+AG+TGKK+ Sbjct: 15 PVVAASCLIGGVGLFLPAVVRPILDSLEASKQVKAPPLTDVIAGVTGKKQ 64 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,543,439 Number of Sequences: 27288 Number of extensions: 68958 Number of successful extensions: 191 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 191 length of database: 11,516,596 effective HSP length: 54 effective length of database: 10,043,044 effective search space used: 241033056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18B14.yg.ab1 (675 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66680.1 dolichyl-di-phosphooligosaccharide-protein glycotran... 329 9e-91 >At5g66680.1 dolichyl-di-phosphooligosaccharide-protein glycotransferase (oligosaccharyltransferase)-like / ;supported by full-length cDNA: Ceres:18419. Length = 437 Score = 329 bits (843), Expect = 9e-91 Identities = 152/175 (86%), Positives = 165/175 (93%) Frame = +2 Query: 23 AGSSNKYAKSGNEQFVTELSKWVFHERGHLKAVNVKHHRVGETDEPAIYRINDDLEYSVE 202 AGS N+Y KSGNEQFVTELSKWVFHERGHLKA N+ HHRVGETDEPAIYRI DDLE+SVE Sbjct: 263 AGSPNQYEKSGNEQFVTELSKWVFHERGHLKAGNLVHHRVGETDEPAIYRIKDDLEFSVE 322 Query: 203 IYEWSGSSWEPYVANDVQVQFYMMSPYVLKTMSTDKKGLYHASFKVPDVYGVFQFKVEYQ 382 IYEWSG SWEPYVANDVQVQFYMMSPYVLKT+STDKKGL+H SFKVPDVYGVFQFKVEY+ Sbjct: 323 IYEWSGKSWEPYVANDVQVQFYMMSPYVLKTLSTDKKGLFHTSFKVPDVYGVFQFKVEYE 382 Query: 383 RLGYTSLSLAKQIPVRPFRHNEYERFIPTAFPYYGASFSTMAAFFIFSFVYLYSK 547 +LGYT+LSL+KQIPVRP+RHNEYERFIPTA+PYYGA F+TMA FF+FSFVYLY K Sbjct: 383 KLGYTTLSLSKQIPVRPYRHNEYERFIPTAYPYYGACFTTMAGFFVFSFVYLYHK 437 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,409,151 Number of Sequences: 27288 Number of extensions: 302142 Number of successful extensions: 779 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 779 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1138809344 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18E01.yg.ab1 (596 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g13840.1 expressed protein / ; supported by cDNA: gi_1545... 270 4e-73 >At2g13840.1 expressed protein / ; supported by cDNA: gi_15450376_gb_AY052289.1_ Length = 434 Score = 270 bits (690), Expect = 4e-73 Identities = 127/198 (64%), Positives = 167/198 (84%) Frame = +1 Query: 1 LHVARAMVEAGHVENLKQAFSRYLYDGGPAYSTGSEPDAEEAVRLVCETGGVAVLAHPWA 180 +HVARA++EAG+VENL+QAF++YL+DGGPAY+TG+EP AEEAV+L+C+TGGVAVLAHPWA Sbjct: 209 MHVARALLEAGYVENLRQAFTKYLHDGGPAYATGTEPMAEEAVKLICKTGGVAVLAHPWA 268 Query: 181 LKNPVAIIRRLKEAGLHGLEVYRSDGKLAAFSDLADTYDLLKLGGSDYHARGGSSESALG 360 LKN V IIRRLK+AGLHG+EVYRSDGKL FS+LADTY+LLKLGGSDYH +GG +ES LG Sbjct: 269 LKNHVGIIRRLKDAGLHGVEVYRSDGKLEVFSELADTYNLLKLGGSDYHGKGGRNESELG 328 Query: 361 SVSLPMVAVHEFLKVARPIWCGAIKKTVDQYITEPTESNLEHILRYAKIKVVKGGGVSSI 540 SV+LP+ A+ +FL V RPIWC AIK T+ ++ +P++SNL +ILR+ K +++KG +S Sbjct: 329 SVNLPVTALQDFLNVGRPIWCEAIKATMRAFLDQPSDSNLSNILRFDKARILKG---NSA 385 Query: 541 TTRNVEIIHECLSQWLTN 594 + E++ CL+ WLT+ Sbjct: 386 WSCGKELMDRCLAIWLTS 403 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,521,931 Number of Sequences: 27288 Number of extensions: 264677 Number of successful extensions: 766 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 766 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 930958496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18E18.yg.ab1 (757 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20990.1 MOLYBDOPTERIN BIOSYNTHESIS CNX1 PROTEIN / ; supp... 302 1e-82 >At5g20990.1 MOLYBDOPTERIN BIOSYNTHESIS CNX1 PROTEIN / ; supported by cDNA: gi_1263313_gb_L47323.1_ATHCNX1R Length = 670 Score = 302 bits (774), Expect = 1e-82 Identities = 152/253 (60%), Positives = 190/253 (75%), Gaps = 2/253 (0%) Frame = +3 Query: 3 SNRAMIVAAATQHKCKIVDLGIARDDEDEISAGLDKALAADIDILLTSGGVSMGDRDFVK 182 SNRAM+VAA Q +CK+VDLGI RDD E+ LD+A+++ +DI+LTSGGVSMGDRDFVK Sbjct: 218 SNRAMLVAAVMQQQCKVVDLGIVRDDRKELEKVLDEAVSSGVDIILTSGGVSMGDRDFVK 277 Query: 183 PYFQNRGRVYFDKVTMKPGKPLTFAEIVTQSGEKV--KKVLAFGLPGNPVSCLVCFNLFV 356 P + +G+VYF KV MKPGKPLTFAEI + E + K VLAFGLPGNPVSCLVCFN+FV Sbjct: 278 PLLEEKGKVYFSKVLMKPGKPLTFAEIRAKPTESMLGKTVLAFGLPGNPVSCLVCFNIFV 337 Query: 357 VPSVRNLSGWKNPHLPRVHAYIKHSIKTDPARKEFHRAIIKWENDAGLGFPGFVAESTGH 536 VP++R L+GW +PH RV ++ IK+DP R EFHRAIIKW+++ G G PGFVAESTGH Sbjct: 338 VPTIRQLAGWTSPHPLRVRLRLQEPIKSDPIRPEFHRAIIKWKDNDGSGTPGFVAESTGH 397 Query: 537 QMSSRLLSMKSANALLELPQSGREIPYGTSVSAILISDIVGIALGNDLLSSKPDIATQNT 716 QMSSRLLSM+SANALLELP +G + G+SVSAI++SDI ++ S+P + Sbjct: 398 QMSSRLLSMRSANALLELPATGNVLSAGSSVSAIIVSDISAFSIDKKASLSEPGSIRKEK 457 Query: 717 VPIKLPDTPYKVA 755 ++P YKVA Sbjct: 458 KYDEVPGPEYKVA 470 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,630,345 Number of Sequences: 27288 Number of extensions: 402419 Number of successful extensions: 1113 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1112 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18F15.yg.ab1 (544 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g38900.1 frnE protein - like / frnE protein, Deinococcus r... 244 3e-65 >At5g38900.1 frnE protein - like / frnE protein, Deinococcus radiodurans, PIR:E75491;supported by full-length cDNA: Ceres:10982. Length = 217 Score = 244 bits (622), Expect = 3e-65 Identities = 117/181 (64%), Positives = 137/181 (75%) Frame = +1 Query: 1 KKLIKIDVTSDSVCPWCFVGKKGLDKAVALSKDQYNFEIKWHPFLLDPSAPKEGVNKKDH 180 KKLI+IDV+SDSVCPWCFVGKK LDKA+ SKDQYNFEI+W PF LDPSAPKEGV+KK+ Sbjct: 11 KKLIQIDVSSDSVCPWCFVGKKNLDKAIEASKDQYNFEIRWRPFFLDPSAPKEGVSKKEF 70 Query: 181 YKNKFGSRADQMHARMTQVFKGHXXXXXXXXXXXXXXXXHRLILFAGKQGLDKQHNLVEE 360 Y K+G+R M ARM++VFKG HRLI + GKQ +KQH LVEE Sbjct: 71 YLQKYGNRYQGMFARMSEVFKGLGLEFDTAGLTGNSLDSHRLIHYTGKQAPEKQHTLVEE 130 Query: 361 LMNGYFTQGKFIGDKEFLVESARKVGLEGAAEFLQDPNNGLQEVNEQLGKDAANISGVPH 540 L GYFTQGKFIGD+EFLVE+A KVG+EGA EFL DPNNG+ EV E+L K + NI+GVP+ Sbjct: 131 LFIGYFTQGKFIGDREFLVETANKVGIEGAEEFLSDPNNGVTEVKEELAKYSKNITGVPN 190 Query: 541 Y 543 Y Sbjct: 191 Y 191 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,548,681 Number of Sequences: 27288 Number of extensions: 231449 Number of successful extensions: 565 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 565 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 781156644 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18F22.yg.ab1 (708 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08530.1 NADH dehydrogenase / ;supported by full-length c... 387 e-107 >At5g08530.1 NADH dehydrogenase / ;supported by full-length cDNA: Ceres:38092. Length = 486 Score = 387 bits (993), Expect(2) = e-107 Identities = 182/190 (95%), Positives = 190/190 (99%) Frame = +3 Query: 114 EKTHFGGLKDEDRIFTNLYGIHDPFLKGAMKRGDWHRTKDLVIKGSDWIVNEMKKSGLRG 293 EKTHFGGLKDEDRIFTNLYG+HDPFLKGAMKRGDWHRTKDLV+KG+DWIVNEMKKSGLRG Sbjct: 51 EKTHFGGLKDEDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKSGLRG 110 Query: 294 RGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRNDPHKLLEGCLIAGV 473 RGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMR+DPHKLLEGCLIAGV Sbjct: 111 RGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKDREIMRHDPHKLLEGCLIAGV 170 Query: 474 GMRATAAYIYIRGEYVNERLNLEKARKEAYAAGLLGKNACGSGYDFDVHIHFGAGAYICG 653 GMRA+AAYIYIRGEYVNERLNLEKAR+EAYAAGLLGKNACGSGYDF+V+IHFGAGAYICG Sbjct: 171 GMRASAAYIYIRGEYVNERLNLEKARREAYAAGLLGKNACGSGYDFEVYIHFGAGAYICG 230 Query: 654 EETALLESLE 683 EETALLESLE Sbjct: 231 EETALLESLE 240 Score = 21.2 bits (43), Expect(2) = e-107 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 683 GKQGKPRL 706 GKQGKPRL Sbjct: 241 GKQGKPRL 248 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,599,093 Number of Sequences: 27288 Number of extensions: 278191 Number of successful extensions: 798 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 795 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1236675772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18G01.yg.ab1 (446 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01180.1 hypothetical protein / identical to hyothetical p... 166 5e-47 >At1g01180.1 hypothetical protein / identical to hyothetical protein GB:AAF26464 GI:6715637 from [Arabidopsis thaliana] Length = 478 Score = 166 bits (419), Expect(2) = 5e-47 Identities = 73/94 (77%), Positives = 86/94 (90%) Frame = +3 Query: 90 SIIFLPFSTGSTLERLCEWGVLADLIEVDAGHDFHSAWSDINRAYKLLRPGGVIFGHDYF 269 SI+ +PFSTGS LE+LCEWGV ADL+E+DAGHDF+SAW+DINRA ++LRPGGVIFGHDYF Sbjct: 210 SILPVPFSTGSALEKLCEWGVTADLVEIDAGHDFNSAWADINRAVRILRPGGVIFGHDYF 269 Query: 270 TVADNRGVRRAVNMFARVNGLRVKADGQHWVLDS 371 T ADNRGVRRAVN+FA +N L+VK DGQHWV+DS Sbjct: 270 TAADNRGVRRAVNLFAEINRLKVKTDGQHWVIDS 303 Score = 38.5 bits (88), Expect(2) = 5e-47 Identities = 14/23 (60%), Positives = 21/23 (90%) Frame = +2 Query: 2 QFRDIKMINGDTMLLYQFMQNVV 70 +F+D+ ++NGD +L+YQFMQNVV Sbjct: 181 RFKDMALVNGDVLLMYQFMQNVV 203 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,882,529 Number of Sequences: 27288 Number of extensions: 167402 Number of successful extensions: 574 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 573 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 525519208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18J12.yg.ab1 (731 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g08520.1 Mg-chelatase, putative / similar to Mg-chelatase ... 417 e-117 >At1g08520.1 Mg-chelatase, putative / similar to Mg-chelatase GB:AF014399 GI:2318116 from [Pisum sativum]; supported by cDNA: gi_16649072_gb_AY059906.1_ Length = 471 Score = 417 bits (1073), Expect = e-117 Identities = 219/244 (89%), Positives = 228/244 (92%), Gaps = 1/244 (0%) Frame = +1 Query: 1 RAKNVIFSEDRGRYIKPMLPKGPVKRLAVDATLRAAAPYQRLRREQDIQKTRKVFVEKTD 180 RAKNVIFSEDRGRYIKPMLPKGPVKRLAVDATLRAAAPYQ+LRRE+DI TRKVFVEKTD Sbjct: 197 RAKNVIFSEDRGRYIKPMLPKGPVKRLAVDATLRAAAPYQKLRREKDISGTRKVFVEKTD 256 Query: 181 XXXXXXXXXXGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVAIIPFRGDAA 360 GALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV+IIPFRGDAA Sbjct: 257 MRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVSIIPFRGDAA 316 Query: 361 EVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRIMIVAITDGR 540 EVLLPPSRSI+MAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDVGRIMIVAITDGR Sbjct: 317 EVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDVGRIMIVAITDGR 376 Query: 541 ANISLKRSNDPE-MASDAPRPSSQELKDEILEVAGKIYKAGMSLLVIDTENKFVSTGFAK 717 ANI+LKRS DPE +A DAPRP+S+ELKDEILEVAGKIYKAGMSLLVIDTENKFVSTGFAK Sbjct: 377 ANITLKRSTDPESIAPDAPRPTSKELKDEILEVAGKIYKAGMSLLVIDTENKFVSTGFAK 436 Query: 718 EIAR 729 EIAR Sbjct: 437 EIAR 440 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.134 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,989,866 Number of Sequences: 27288 Number of extensions: 352359 Number of successful extensions: 1003 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 967 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1002 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1294970360 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18M16.yg.ab1 (657 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49990.1 putative protein / putative protein - Drosophila ... 198 2e-51 >At3g49990.1 putative protein / putative protein - Drosophila melanogaster, EMBL:AF132172 Length = 502 Score = 198 bits (503), Expect = 2e-51 Identities = 110/206 (53%), Positives = 137/206 (66%), Gaps = 2/206 (0%) Frame = +2 Query: 2 NSSLPDDVRREILELGFPDDGYNYLSHLREIRVTGGGSSFYQNPKARPDQLPRDVKAYDA 181 +SSLP VR+EILELG+PDDGYNYL HLREI+ TGGGS+FY NPK QLPRDVKAYDA Sbjct: 82 SSSLPAHVRKEILELGYPDDGYNYLEHLREIKNTGGGSNFYVNPKYEVAQLPRDVKAYDA 141 Query: 182 SRIDVS-KANDEDSYKNSIYGVAVKTVPVRIQKAIDPEVAALLDDSDQSRFGSDVEDLEE 358 SR+ +S N+E + +Y VA KTV V++QKAIDPEVAALL++SD S FGSDVEDLEE Sbjct: 142 SRVKISGMVNEEGNDNKLMYSVASKTVNVKVQKAIDPEVAALLENSDGSEFGSDVEDLEE 201 Query: 359 DFVINANLPDESEDVQLDN-KLTSTEKSYANSKEDDYYTKPSQDNFLHNIASSETLVNAK 535 DFV+ ANL + E + N +L + + +E D +P +N Sbjct: 202 DFVVQANLTQKGESSGVSNGELEFSVRREVRERESD---EPVAEN--------------- 243 Query: 536 PRERRPLDEQFDMLELQEYGTDDESE 613 PR R +DE FD LEL EYG+D + + Sbjct: 244 PRVPRQIDELFDQLELNEYGSDSDGD 269 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,160,406 Number of Sequences: 27288 Number of extensions: 239775 Number of successful extensions: 943 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 907 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1097681028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB19A09.yg.ab1 (701 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54520.1 expressed protein / ;supported by full-length cDN... 242 2e-64 >At1g54520.1 expressed protein / ;supported by full-length cDNA: Ceres:13758. Length = 391 Score = 242 bits (617), Expect = 2e-64 Identities = 120/172 (69%), Positives = 139/172 (80%) Frame = +2 Query: 185 VGLLGMGRTLQRDLNRIAEAADTSTPEGLSFVLQETTLALLRHPDYCISGYSSADVKKSV 364 VGLLG+GRTLQ+D NR+AE++DTSTPEGLS+VL E TLALLRHPDYCIS YSS DVK S+ Sbjct: 216 VGLLGLGRTLQQDFNRLAESSDTSTPEGLSYVLTEATLALLRHPDYCISCYSSVDVKPSI 275 Query: 365 EEGEKRFNQLSIEERGKFDEETLVNVNNIRKQSTTSQRSNGFRNEYXXXXXXXXXXXXHK 544 E+GEKRFNQLSIEERGKFDEETLVNVN+I++QS+ ++++GF NEY HK Sbjct: 276 EKGEKRFNQLSIEERGKFDEETLVNVNSIKRQSSKIRKASGFSNEYIVVTILMAAEGIHK 335 Query: 545 LPPINSSAQLKETLQKLASIPSCRIMAVDVLWTPPNENDTLSERELLEDYSL 700 LPPIN + LKE L KL SIP +IMAV+VLWTP NE D LSERELLEDY L Sbjct: 336 LPPINGTTDLKEALLKLGSIPRNKIMAVEVLWTPQNEADALSERELLEDYPL 387 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,793,955 Number of Sequences: 27288 Number of extensions: 277755 Number of successful extensions: 690 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1218881876 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB19B05.yg.ab1 (733 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g15660.1 hypothetical protein / predicted by genemark.hmm 92 4e-19 >At1g15660.1 hypothetical protein / predicted by genemark.hmm Length = 710 Score = 91.7 bits (226), Expect = 4e-19 Identities = 65/233 (27%), Positives = 111/233 (46%), Gaps = 6/233 (2%) Frame = -2 Query: 690 NPQKNRPALARKRAKFSMKPDTSQSSTILEPTFQMDQLHDPADFFAAYEKFEN-----TR 526 N ++ RP L RKR FS+ TSQ + P+F + DFFAAY+KFE Sbjct: 86 NKRERRPGLDRKRKSFSLHLTTSQPPPVA-PSFDPSKYPRSEDFFAAYDKFEPGFETVAN 144 Query: 525 KELKKQRGEDPNE-PRIPTTARQRRPEIPRRKTSYQHHVYSSQPENDVLSSQEALQDTVE 349 +E +KQ G + P + R RRP IP RK ++ DV++ + + ++ Sbjct: 145 REWQKQTGSSVIDIQENPPSRRPRRPGIPGRKRRPFKESFTDSYFTDVINLEASEKEIPI 204 Query: 348 SQPIHDSQHEAVTPNSQPKEKVAGSVTKAEDRDKLFDDLMSSNIADLDGNEALSYLQNRL 169 + A + +E +V +D + + DL++ + +L+G+ A+ L+ RL Sbjct: 205 ASEQSLESATAAHVTTVDREVDDSTVDTDKDLNNVLKDLLACSREELEGDGAIKLLEERL 264 Query: 168 NIKPVSINKLQLPNFHDIPTVNLLSSVNSIKDQNILPDIRALSDNLNEITPAK 10 IK +I K +P F D+ +NL +S ++ ++ L DI+ + N + K Sbjct: 265 QIKSFNIEKFSIPEFQDVRKMNLKASGSNPPNRKSLSDIQNILKGTNRVAVRK 317 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,092,778 Number of Sequences: 27288 Number of extensions: 284182 Number of successful extensions: 1119 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1062 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1113 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1294970360 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB19B07.yg.ab1 (599 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11770.1 NADH dehydrogenase (ubiquinone) / ;supported by ... 259 6e-70 >At5g11770.1 NADH dehydrogenase (ubiquinone) / ;supported by full-length cDNA: Ceres:13161. Length = 218 Score = 259 bits (663), Expect = 6e-70 Identities = 124/142 (87%), Positives = 130/142 (91%), Gaps = 1/142 (0%) Frame = +3 Query: 177 IHTTLPVLADGFSSPAPYSRPGPPATGSPA-GLSKTAEFVISKVDDLMNWARRGSIWPMT 353 +HT+LP L+ +SP Y+RPGPP+T P GLSK AEFVISKVDDLMNWAR GSIWPMT Sbjct: 30 LHTSLPALSPS-TSPTSYTRPGPPSTSPPPPGLSKAAEFVISKVDDLMNWARTGSIWPMT 88 Query: 354 FGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMIVAGTLTNKMAPALRKVYDQMPE 533 FGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMIVAGTLTNKMAPALRKVYDQMPE Sbjct: 89 FGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMIVAGTLTNKMAPALRKVYDQMPE 148 Query: 534 PRWVISMGSCANGGGYYHYSYS 599 PRWVISMGSCANGGGYYHYSYS Sbjct: 149 PRWVISMGSCANGGGYYHYSYS 170 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,899,421 Number of Sequences: 27288 Number of extensions: 290049 Number of successful extensions: 1294 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1287 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 939910020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB19E06.yg.ab1 (659 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g31870.1 unknown protein / 263 6e-71 >At1g31870.1 unknown protein / Length = 561 Score = 263 bits (672), Expect = 6e-71 Identities = 130/205 (63%), Positives = 163/205 (79%), Gaps = 2/205 (0%) Frame = +3 Query: 51 DLSPPMEESDRPKTGLVSGKDIKEEITKAKKEDWLRFQKMDPSISGRNAEGIRRDKKTGA 230 D SPP ++ KTGL+SGKDI E K K+++ LRF+ MD ++G+NAE + RDK TG Sbjct: 335 DSSPPQISKEQRKTGLISGKDIGSEYRKKKEDEKLRFKNMDSELTGQNAEAVFRDKITGK 394 Query: 231 RLTKEQ-IEALQKKD-EKPKEIKLEWGKGLAQKREAEARQKELELEKAKPFARTRDDDDL 404 R++KE+ +++ QKK EKPKEIKLEWGKGLAQKREAEAR +ELELEK KPFARTRDD +L Sbjct: 395 RISKEEYLKSKQKKVIEKPKEIKLEWGKGLAQKREAEARLQELELEKDKPFARTRDDPEL 454 Query: 405 NDIQKNAIRWGDPMAHLVKKKQSEVFLPDIGDNEKMKESGFIVPQQIPNHSWLKRGLDAA 584 + + K +R+GDPMAHLVKK++ E L D+GD+E+MK+SGFI+PQ +P HSWL R L+AA Sbjct: 455 DQMMKERVRFGDPMAHLVKKRKYETTLVDLGDDEEMKKSGFIIPQSVPKHSWLTRRLEAA 514 Query: 585 PNRYGIKPGRHXDGVDRSNGFEKQM 659 NRYGIKPGRH DGVDRSNG EK + Sbjct: 515 SNRYGIKPGRHWDGVDRSNGTEKDL 539 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,373,723 Number of Sequences: 27288 Number of extensions: 237495 Number of successful extensions: 1074 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 975 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1051 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1106605264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB19F10.yg.ab1 (728 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g05990.1 enoyl-ACP reductase (enr-A) / 227 6e-60 >At2g05990.1 enoyl-ACP reductase (enr-A) / Length = 390 Score = 227 bits (578), Expect = 6e-60 Identities = 123/201 (61%), Positives = 146/201 (72%), Gaps = 1/201 (0%) Frame = +3 Query: 129 TNITNMHLAIAKASAFSSHQVSKSSIADFSSGAKGASCAKLRSSCHIASTK-LSSQNVKF 305 T +++ +A + S S ++ K+ + AS KL + +++ L + + Sbjct: 4 TAASSLQIATRRPSMSSPSKILKAGTYIVGANPGNASWDKLSCTRQLSNLGCLRNHSAVP 63 Query: 306 SDSRFERVITKAVSASSDTKPLPGLPVDLRGKRAFIAGIADDNGYGWAIAKSLAAAGAEI 485 + R T+A+S SS+ K GLP+DLRGKRAFIAGIADDNGYGWAIAKSLAAAGAEI Sbjct: 64 TCKRPFSFSTRAMSESSENKAPSGLPIDLRGKRAFIAGIADDNGYGWAIAKSLAAAGAEI 123 Query: 486 LVGTWVPALNIFETSLRRGKFDESRVLPDGSLMEITKVYPLDAVYDTPEDVHEDVKTNKR 665 LVGTWVPALNIFETSLRRGKFD+SRVLPDGSLMEI KVY LDAV+D PEDV EDVKTNKR Sbjct: 124 LVGTWVPALNIFETSLRRGKFDQSRVLPDGSLMEIKKVYALDAVFDNPEDVPEDVKTNKR 183 Query: 666 YAGSSKWTVNEVAESVKEDFG 728 YAGSS WTV E AE VK+DFG Sbjct: 184 YAGSSNWTVQEAAECVKKDFG 204 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,095,234 Number of Sequences: 27288 Number of extensions: 278510 Number of successful extensions: 752 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1286100700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB19J05.yg.ab1 (692 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11240.1 expressed protein / ;supported by full-length cDN... 103 1e-22 >At1g11240.1 expressed protein / ;supported by full-length cDNA: Ceres:111951. Length = 200 Score = 103 bits (256), Expect = 1e-22 Identities = 71/195 (36%), Positives = 88/195 (44%), Gaps = 7/195 (3%) Frame = +1 Query: 34 AHHIKKRALKNKALSISFDEKGLSDFVTGFHKRKKKRRKEAQNQQQXXXXXXXXXXXXXX 213 A HI KRA KNK+L++SFDEK L DFVTGFHKRKKKRRKEAQ QQ+ Sbjct: 19 ARHIGKRARKNKSLTVSFDEKDLKDFVTGFHKRKKKRRKEAQKQQEEAFRRKRIEARKNR 78 Query: 214 XXXXXYVLYGGAAPDPEGESNKXXXXXXXXXXXXXXXXXXXXXXXPTSVSGTKVYDTGNV 393 V G + +GE+ S S T +YDTG + Sbjct: 79 KLEELMVA-GNGEDNEDGEAEDEVDAEDEEAEPDA------------STSATTMYDTGEL 125 Query: 394 KVMVTTSEISREDDFAEVPKLTLGSEXXXXXXXXX-------XXXXXXXERRRSRPKALT 552 KV VTTSEISRE++ + T +E RRRS K + Sbjct: 126 KVTVTTSEISREEEEPIRKEKTQSTESGSTAKASTKQPVPVRKTKPMKQSRRRSTTKTMK 185 Query: 553 KRDKRKGKTKVEKRR 597 KRDK+K ++ R Sbjct: 186 KRDKKKQARGIKTSR 200 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,461,031 Number of Sequences: 27288 Number of extensions: 183293 Number of successful extensions: 578 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 575 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1192191032 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB19P08.yg.ab1 (527 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58220.1 similar to unknown protein (pir||T34863) / ; supp... 135 1e-32 >At5g58220.1 similar to unknown protein (pir||T34863) / ; supported by cDNA: gi_17065389 Length = 324 Score = 135 bits (341), Expect = 1e-32 Identities = 67/108 (62%), Positives = 81/108 (74%) Frame = +2 Query: 17 PVAGIEVQLEMYNAKQPGPVFGESDKDKWILQGSSTTDKDGRSGQLMKIVNDLSPGVYRI 196 P AG+EV LE+++ GP F W G+S TD+DGRSG LM +V+ L+PG YRI Sbjct: 218 PAAGVEVHLEVWSGTT-GPSFVHGGGGVWSSVGTSATDRDGRSGPLMDLVDALNPGTYRI 276 Query: 197 SFNTGKYNPDGFFPFVSIVFKVKESQKMEHFHVPLLLSPFSFSTYRGS 340 SF+T KY+P FFP+VSIVF+V ESQK EHFHVPLLL+PFSFSTYRGS Sbjct: 277 SFDTAKYSPGCFFPYVSIVFQVTESQKWEHFHVPLLLAPFSFSTYRGS 324 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,757,557 Number of Sequences: 27288 Number of extensions: 247742 Number of successful extensions: 633 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 633 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 736262584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB1b06.yg.ab1 (595 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49555.1 phytoene dehydrogenase [phytoene desaturase](PDS)-re... 328 1e-90 >At5g49555.1 phytoene dehydrogenase [phytoene desaturase](PDS)-related / similar to several microbial phytoene dehydrogenase-like proteins; contains PF02032: Phytoene dehydrogenase related enzyme domain Length = 556 Score = 328 bits (841), Expect = 1e-90 Identities = 148/180 (82%), Positives = 166/180 (92%) Frame = +2 Query: 2 PQHMGTIHIGSETIEEIETACQEARNGLPSRRPVIEMTIPSVLDKTISPPGKHVINLFVQ 181 P+H GTIHIG+E+++E+ +AC ++ NGLPSRRPVIEMTIPS LD TISPPGKHVINLF+Q Sbjct: 375 PEHFGTIHIGAESMDEVHSACHDSENGLPSRRPVIEMTIPSTLDNTISPPGKHVINLFIQ 434 Query: 182 FTPYKPNDGSWEDTAYRESFAQRCFNLIDEYAPGFSSSVIGYDMLAPPDLERIIGLTGGN 361 +TPYKP+DGSWED YRE+FAQRCF LIDEYAPGFSSS+I YDML PPDLER IGLTGGN Sbjct: 435 YTPYKPSDGSWEDPTYREAFAQRCFKLIDEYAPGFSSSIISYDMLTPPDLEREIGLTGGN 494 Query: 362 IFHGAMGLDSLFLMRPVKGWSNYRTPLRGLYLCGSGAHPGGGVMGAPGRNAARVVIDDIK 541 IFHGAMGLDSLFLMRPVKGWSNYR+PL+GLYLCGSGAHPGGGVMGAPGRNAA VV+ D+K Sbjct: 495 IFHGAMGLDSLFLMRPVKGWSNYRSPLKGLYLCGSGAHPGGGVMGAPGRNAAHVVLQDLK 554 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,855,513 Number of Sequences: 27288 Number of extensions: 320219 Number of successful extensions: 1010 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 948 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1008 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 922006972 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20A01.yg.ab1 (743 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32770.1 putative protein / predicted protein, Synechocyst... 332 e-103 >At4g32770.1 putative protein / predicted protein, Synechocystis sp., PIR2:S74814; supported by cDNA: gi_14334011_gb_AF302188.1_AF302188 Length = 488 Score = 332 bits (851), Expect(2) = e-103 Identities = 150/195 (76%), Positives = 168/195 (85%) Frame = +1 Query: 73 VNPVYVPTPTNRPLRPPHSGYHFDGTTRKFFEGWYFKVSIPEQRQSFCFMYSVENPAFKK 252 V PVYVPT NR LR PHSGYHFDGT RKFFEGWYF+VSIPE+R+SFCFMYSVENPAF++ Sbjct: 62 VKPVYVPTSPNRELRTPHSGYHFDGTPRKFFEGWYFRVSIPEKRESFCFMYSVENPAFRQ 121 Query: 253 DLNILEQLQHGPRFTGVGAQILGAHDKYICQYSKESHNFWGSRHELMLGNSFSVQTGKQP 432 L+ LE +GPRFTGVGAQILGA+DKY+CQY ++SHNFWG RHEL+LGN+FS G + Sbjct: 122 SLSPLEVALYGPRFTGVGAQILGANDKYLCQYEQDSHNFWGDRHELVLGNTFSAVPGAKA 181 Query: 433 PNSEVPPQVFNQRVIEGFQVTPLWHQGFIRDDGRTSYAETVKTARWEYSTRPVYGWGDVG 612 PN EVPP+ FN+RV EGFQ TP WHQG I DDGRT YAETVK+ARWEYSTRPVYGWGDVG Sbjct: 182 PNKEVPPEEFNRRVSEGFQATPFWHQGHICDDGRTDYAETVKSARWEYSTRPVYGWGDVG 241 Query: 613 SKQKSTAGWLAAFPV 657 +KQKSTAGW AAFPV Sbjct: 242 AKQKSTAGWPAAFPV 256 Score = 62.4 bits (150), Expect(2) = e-103 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 648 FSCIEPHWRICMAGGLSTGWIEWGDERYEFEN 743 F EPHW+ICMAGGLSTGWIEWG ER+EF + Sbjct: 254 FPVFEPHWQICMAGGLSTGWIEWGGERFEFRD 285 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,664,291 Number of Sequences: 27288 Number of extensions: 414544 Number of successful extensions: 1112 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1066 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1112 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1330449000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20F24.yg.ab1 (730 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g38630.1 26S proteasome regulatory subunit S5A (RPN10) / i... 197 4e-51 >At4g38630.1 26S proteasome regulatory subunit S5A (RPN10) / identical to multiubiquitin chain binding protein (MBP1) SP:P55034, GI:1165206; supported by full-length cDNA: Ceres:6757. Length = 386 Score = 197 bits (502), Expect = 4e-51 Identities = 109/216 (50%), Positives = 136/216 (62%), Gaps = 1/216 (0%) Frame = +1 Query: 1 IQVAQLALKHRQNKKQQQRIIVFAGGPVKYDKKVLEMIGKKLKKNSVALDVVNFGE-EDE 177 IQ+AQLALKHRQNK Q+QRIIVFAG P+KY+KK LE++GK+LKKNSV+LD+VNFGE +DE Sbjct: 91 IQIAQLALKHRQNKNQRQRIIVFAGSPIKYEKKALEIVGKRLKKNSVSLDIVNFGEDDDE 150 Query: 178 SKTEKLEALVAAVNNNDSSHIVHVPAGANALSDVLLSTPIFTXXXXXXXXXXXXXXXXXX 357 K +KLEAL+ AVNNND SHIVHVP+GANALSDVLLSTP+FT Sbjct: 151 EKPQKLEALLTAVNNNDGSHIVHVPSGANALSDVLLSTPVFT--GDEGASGYVSAAAAAA 208 Query: 358 XXXXXXXXXXXPNLDPELALALRVSMXXXXXXXXXXXXXXXXXXXXXGKEGESTSQDATM 537 PN+DPELALALRVSM K+G++ S Sbjct: 209 AAGGDFDFGVDPNIDPELALALRVSMEEERARQEAAAKKAADEAGQKDKDGDTASASQ-- 266 Query: 538 LENVGTSVSESENKKDDLMDDENALLQQAPGMSMDD 645 +V+ + +K + MD+++ALL QA MS+ D Sbjct: 267 -----ETVARTTDKNAEPMDEDSALLDQAIAMSVGD 297 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.308 0.126 0.331 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,283,001 Number of Sequences: 27288 Number of extensions: 224776 Number of successful extensions: 710 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 706 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1286100700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20I23.yg.ab1 (715 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15680.1 hypothetical protein / 341 3e-94 >At5g15680.1 hypothetical protein / Length = 2163 Score = 341 bits (874), Expect = 3e-94 Identities = 169/218 (77%), Positives = 190/218 (86%) Frame = +1 Query: 34 ESETTGGKVPAFEGVQPLVLKGLMSTVSHGVSIEVLSQITVHSCDSIFGDPETRLLMHII 213 E + G +P FEGVQPLVLKGLMSTVSH SIEVLS+ITV SCDSIFGD ETRLLMHI Sbjct: 1846 EMPPSSGTLPKFEGVQPLVLKGLMSTVSHEFSIEVLSRITVPSCDSIFGDAETRLLMHIT 1905 Query: 214 GLLPWLCLQLNQDAVAGPASPLLHQYQKACSVSTNLAIWCRAKSLDELATVFMAYSQGGI 393 GLLPWLCLQL QD V A PL QYQKACSV++N+A+WCRAKSLDELATVF+AY++G I Sbjct: 1906 GLLPWLCLQLTQDQVMVSALPLQQQYQKACSVASNIAVWCRAKSLDELATVFVAYARGEI 1965 Query: 394 KTIDNLLASVSPLLCNEWLPKHSALAFGHLLKLLERGPVEYQRVILLLMKALLQHTPTDA 573 K ++NLLA VSPLLCN+W PKHSALAFGHLL+LL++GPV+YQRVILL++KALLQHTP DA Sbjct: 1966 KRVENLLACVSPLLCNKWFPKHSALAFGHLLRLLKKGPVDYQRVILLMLKALLQHTPMDA 2025 Query: 574 AQSPHMYAIVSQLVESTLCXEALSVLEALLQSCSSLTG 687 +QSPHMY IVSQLVESTLC EALSVLEALLQSCS + G Sbjct: 2026 SQSPHMYTIVSQLVESTLCWEALSVLEALLQSCSPVQG 2063 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,005,529 Number of Sequences: 27288 Number of extensions: 340052 Number of successful extensions: 961 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 930 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 960 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1254469668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20J03.yg.ab1 (560 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g54690.1 sugar-phosphate isomerase - like protein / gutq/k... 189 8e-72 >At3g54690.1 sugar-phosphate isomerase - like protein / gutq/kpsf family sugar-p isomerase, Chlamydia pneumoniae, PIR:E72068;supported by full-length cDNA: Ceres:36743. Length = 350 Score = 189 bits (481), Expect(2) = 8e-72 Identities = 95/119 (79%), Positives = 105/119 (87%) Frame = +3 Query: 204 KKQEELPVCRQGDLIMDQLLELTSKGCGRLLVIDDDYHLIGTFTDGDLRRTLKASKEGIF 383 KKQEELPVC++GDLIMDQL+ELTSKGCG LLV+D+ LIGTFTDGDLRRTLKAS E IF Sbjct: 230 KKQEELPVCKEGDLIMDQLVELTSKGCGCLLVVDEHSRLIGTFTDGDLRRTLKASGEAIF 289 Query: 384 KLTVGEMRSRNPRTITA*RMAAEAMQKMEAPPSPVQFLPVINEDNTLIGIATLHGLVSA 560 KL+VGEM +R PRTI MA EAM+KME+PPSPVQFLPV+NEDNTLIGI TLHGLVSA Sbjct: 290 KLSVGEMCNRKPRTIGPETMAVEAMKKMESPPSPVQFLPVVNEDNTLIGIVTLHGLVSA 348 Score = 98.2 bits (243), Expect(2) = 8e-72 Identities = 47/62 (75%), Positives = 56/62 (89%) Frame = +2 Query: 23 RELCPFDLAPTTSTAIQMVFGCTVAIAMMDAKCLTKEGYAANHPAGRIGKSLIFKVNDVI 202 RELCPF+LAP TSTAIQMVFG T+A+A+M A+ L+KE YAANHPAGRIGKSLIFKV DV+ Sbjct: 170 RELCPFNLAPVTSTAIQMVFGDTIAVALMAARNLSKEEYAANHPAGRIGKSLIFKVKDVM 229 Query: 203 EE 208 ++ Sbjct: 230 KK 231 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,880,456 Number of Sequences: 27288 Number of extensions: 290984 Number of successful extensions: 884 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 854 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 883 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 835029516 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20J17.yg.ab1 (757 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g45380.1 urea active transporter-like protein / 314 1e-88 >At5g45380.1 urea active transporter-like protein / Length = 694 Score = 314 bits (804), Expect(2) = 1e-88 Identities = 156/233 (66%), Positives = 181/233 (76%), Gaps = 5/233 (2%) Frame = +2 Query: 2 KQILKVSRTVVFSFGCFMGILAVILNKAGVSLGWMYLAMGVLIGSAVIPIAFLLLWRKAN 181 +QILK+SR V FGCFMGILAV+LNKAGVSLGWMYLAMGVLIGSAVIPIAF+LLW KAN Sbjct: 426 RQILKISRCAVLGFGCFMGILAVVLNKAGVSLGWMYLAMGVLIGSAVIPIAFMLLWSKAN 485 Query: 182 AFGAILGTIVGCVLGIITWLLVTSVEYGRVNLDTTGRNAPMLAGNLVSILTGGAVHAICS 361 AFGAILG GCV GIITWL +YGRV+LD+TG+N PMLAGNLV+ILT Sbjct: 486 AFGAILGATSGCVFGIITWLTTAKTQYGRVDLDSTGKNGPMLAGNLVAILT--------- 536 Query: 362 FLRPQNYDWETTKQITIVE-----KEKSELAVDEFKEEKLISAKKWIVKWGVGFTFVIVV 526 +RPQNYDW TT++I +VE E ++ +E +EEKL AK WIVKWG+ FT +IVV Sbjct: 537 -VRPQNYDWSTTREIKVVEAYASGDEDVDVPAEELREEKLRRAKAWIVKWGLVFTILIVV 595 Query: 527 LWPLFSLPAKEFSKGYFTFWAVVAIAWGTIGSAVIIILPLAESWQTIQSVIDG 685 +WP+ SLPA+ FS+GYF FWA+VAIAWGTIGS VII LPL ESW TI+SV G Sbjct: 596 IWPVLSLPARVFSRGYFWFWAIVAIAWGTIGSIVIIGLPLVESWDTIKSVCMG 648 Score = 30.4 bits (67), Expect(2) = 1e-88 Identities = 11/21 (52%), Positives = 19/21 (90%) Frame = +3 Query: 681 MGMVTNDKLVEKIDELNLKLK 743 MGM TND++++K+D+LN +L+ Sbjct: 647 MGMFTNDRVMKKLDDLNHRLR 667 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,317,172 Number of Sequences: 27288 Number of extensions: 359898 Number of successful extensions: 928 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 902 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 926 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20L24.yg.ab1 (730 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57460.1 unknown protein / 303 5e-83 >At5g57460.1 unknown protein / Length = 646 Score = 303 bits (777), Expect = 5e-83 Identities = 153/238 (64%), Positives = 188/238 (78%), Gaps = 1/238 (0%) Frame = +1 Query: 19 DLVTKKPEMKGPEMYISEVINAEFRESLLARVGLMGTVYLKTLPPKPSNDT-ETESSFKV 195 D + KKPEMKGPEMYISE I EFRESLLARVG+MG +YLKT+PPK S + ETE SF+V Sbjct: 399 DNLVKKPEMKGPEMYISEEIRTEFRESLLARVGVMGVIYLKTMPPKGSGEEKETEFSFRV 458 Query: 196 QNTNGVKRFVMHNSSVSSLGDQMFHVKTAPSDQPIPIMKYSFLPRATPLPLRVRLVKRHS 375 + T VKRF M +S +SSLG+ +FHV+TAPS++PIPI+KYS P+ TPLPLRVR+VKR S Sbjct: 459 EGTTAVKRFAMQSSRISSLGNGLFHVRTAPSEEPIPILKYSLQPKLTPLPLRVRMVKRIS 518 Query: 376 GTLLSVMIQYVSNPDLPAPLTDVTFTLKLPVDPRLLKVSPKAVLNRSERELQWHVDEIPL 555 GTLLS+MIQYVSNPDLP PL +V F LKLPVDP LLKVSPKA+LNR++REL+W + EIPL Sbjct: 519 GTLLSLMIQYVSNPDLPQPLKNVDFILKLPVDPTLLKVSPKAILNRTDRELKWQIPEIPL 578 Query: 556 KGNPVRLRARMPVDTSEDDGGDELEVVGFVKFSYQGTKSXVGDFAASCFRG*TDFYEV 729 G+P RLRARMP+D+ D+ +E +++ +VKFS QG S G + G TDF+EV Sbjct: 579 NGSPGRLRARMPIDS--DNSEEEPDIICYVKFSVQGNTSLSGISLRAAAEGNTDFFEV 634 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,759,108 Number of Sequences: 27288 Number of extensions: 313603 Number of successful extensions: 874 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 856 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 872 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1286100700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20M17.yg.ab1 (471 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20890.1 expressed protein / ;supported by full-length cD... 110 5e-25 >At2g20890.1 expressed protein / ;supported by full-length cDNA: Ceres:34875. Length = 300 Score = 110 bits (274), Expect = 5e-25 Identities = 60/112 (53%), Positives = 69/112 (61%) Frame = +2 Query: 2 ECEDILKDIAERAXXXXXXXXXXXXAVGLFRFLELANATEPTILEKLCAALNINKKSVDR 181 + E +LKDIA RA AVGLFR LELA+AT+PT+L+KLCA+LNINKKSVDR Sbjct: 179 DIEAVLKDIAGRAGSKEGFSYSRFFAVGLFRLLELASATDPTVLDKLCASLNINKKSVDR 238 Query: 182 DLDVYRNLLSKLVQAXXXXXXXXXXXXXXXXXXXXPQKANEAVKNFLAENLY 337 DLDVYRNLLSKLVQA QKANE + L + LY Sbjct: 239 DLDVYRNLLSKLVQAKELLKEYVEREKKKQGERAQSQKANETISKCLGDTLY 290 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,860,840 Number of Sequences: 27288 Number of extensions: 139234 Number of successful extensions: 433 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 433 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 587170220 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20O21.yg.ab1 (439 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g44920.1 expressed protein / ; supported by cDNA: gi_13878... 128 1e-30 >At1g44920.1 expressed protein / ; supported by cDNA: gi_13878106_gb_AF370316.1_AF370316 Length = 258 Score = 128 bits (322), Expect = 1e-30 Identities = 59/93 (63%), Positives = 74/93 (79%) Frame = +1 Query: 1 RGLNGKTNAITAAVKSWALGIPLGIIIRATSIGHIPPTRFIAVTMGSTALLLIGWRALLS 180 RG+ GK+ A+ AA KSW +G PLGIIIR+ S GHIP F+ VTMGSTA+LLIGWRALL Sbjct: 166 RGMKGKSKAVVAAAKSWIVGTPLGIIIRSASSGHIPAYSFVLVTMGSTAVLLIGWRALLF 225 Query: 181 NILAEDKNKKNDVYKRGNPFELFELLTSLVRRW 279 ++L + KK+D Y++G+ FELFELLTSL+RRW Sbjct: 226 SVLPTESKKKDDTYRKGSAFELFELLTSLIRRW 258 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,011,952 Number of Sequences: 27288 Number of extensions: 178693 Number of successful extensions: 504 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 492 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 498337180 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20P14.yg.ab1 (712 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g28320.1 unknown protein / ; supported by cDNA: gi_18086452 252 1e-67 >At1g28320.1 unknown protein / ; supported by cDNA: gi_18086452 Length = 709 Score = 252 bits (644), Expect = 1e-67 Identities = 134/262 (51%), Positives = 158/262 (60%), Gaps = 45/262 (17%) Frame = +1 Query: 58 VELAMSSICLITINDGVWASGVLLNNHGLILTNAHLLEPWRFKKT-------------AP 198 +E AM S+CLIT+NDGVWASG++LN HGLILTNAHLLEPWR+ K A Sbjct: 358 IEKAMESVCLITVNDGVWASGIILNEHGLILTNAHLLEPWRYGKGGVYGEGFKPYVLGAE 417 Query: 199 SHKTVSNIFFTPSNDTAAFESKRNHQS--------------------IRVRVDYLERWIW 318 + + F+ + T ++ RNH S IRVR+ +L+ W W Sbjct: 418 EFSSTGSKFWEQKSQTLPRKAPRNHYSSVGENIREYKHNFLQTGHRDIRVRLCHLDSWTW 477 Query: 319 CDASVVYVSKGPLDIAVLQLEFVPDKLVPIVMDFTCPSPGSKVYVTGHGLFGPRCDFLPS 498 C A+VVY+ K LDIA+LQLE+VP KL PI +F+ P G+ +V GHGLFGPRC PS Sbjct: 478 CPANVVYICKEQLDIALLQLEYVPGKLQPITANFSSPPLGTTAHVVGHGLFGPRCGLSPS 537 Query: 499 SCXXXXX------------XXXXXXXEAPAMIETTAAVHPGGSGGAVLNSDGHMISLVTS 642 C E PAM+ETTAAVHPGGSGGAVLNS GHMI LVTS Sbjct: 538 ICSGVVAKVVHAKRRLNTQSISQEVAEFPAMLETTAAVHPGGSGGAVLNSSGHMIGLVTS 597 Query: 643 NARHGGGTVIPHLNFSIPCAAL 708 NARHG GTVIPHLNFSIPCA L Sbjct: 598 NARHGAGTVIPHLNFSIPCAVL 619 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,813,158 Number of Sequences: 27288 Number of extensions: 338434 Number of successful extensions: 1097 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1093 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1245572720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB21C14.yg.ab1 (392 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g30540.1 expressed protein / almost identical to hypotheti... 141 3e-42 >At1g30540.1 expressed protein / almost identical to hypothetical protein GB:AAF19757 GI:6634777 from [Arabidopsis thaliana];supported by full-length cDNA: Ceres:103989. Length = 351 Score = 141 bits (356), Expect(2) = 3e-42 Identities = 64/88 (72%), Positives = 76/88 (85%) Frame = +1 Query: 43 LKAMFPNDVKCFIHNDAVAAMASGTMGKLHGCVLIAGTGTIAYGYTEDGREAHASGAGPV 222 ++ MFP+ VK ++ NDA+ A+ASGTMGKLHGCVLIAGTG IAYG+ EDG+EA ASG GP+ Sbjct: 126 IRDMFPSHVKVYVQNDAIVALASGTMGKLHGCVLIAGTGCIAYGFDEDGKEARASGGGPI 185 Query: 223 LRDWGSGYAIAAMALTSVIRAYDGRGPQ 306 L DWGSGY IAA ALT+VIRA+DGRGPQ Sbjct: 186 LGDWGSGYGIAAQALTAVIRAHDGRGPQ 213 Score = 46.2 bits (108), Expect(2) = 3e-42 Identities = 22/29 (75%), Positives = 24/29 (81%) Frame = +2 Query: 305 KTTLTSRILHELELSSPNELIGWTYADPS 391 +T LTS IL L LSSP+ELIGWTYADPS Sbjct: 213 QTMLTSTILKALGLSSPDELIGWTYADPS 241 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,052,504 Number of Sequences: 27288 Number of extensions: 198970 Number of successful extensions: 608 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 590 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 608 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 382840584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB21F22.yg.ab1 (274 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59490.1 putative protein / 110 2e-25 >At3g59490.1 putative protein / Length = 281 Score = 110 bits (274), Expect = 2e-25 Identities = 51/90 (56%), Positives = 73/90 (80%) Frame = +2 Query: 2 MRPVIMIDYGGKMPELRDRLCAFLKFSQEESSIFENLRVMVIEDMIYLICVRELAELIKL 181 MRPV+MIDYGGKMPEL++RL + L+ +E +F++L+VMVIEDMIYLI VR L + + Sbjct: 81 MRPVVMIDYGGKMPELQNRLLSLLELIREGLPVFKDLKVMVIEDMIYLINVRSLPKFVSS 140 Query: 182 TINKELELYFVDLEQDPPKMVTEVQQISVG 271 +++ E EL+F+DLEQDPPKMVT+ ++ ++G Sbjct: 141 SLDSEPELFFIDLEQDPPKMVTQSKESNLG 170 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,218,365 Number of Sequences: 27288 Number of extensions: 80639 Number of successful extensions: 199 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 199 length of database: 11,516,596 effective HSP length: 66 effective length of database: 9,715,588 effective search space used: 233174112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB21I12.yg.ab1 (481 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46060.1 hypothetical protein / predicted by genscan; supp... 120 3e-28 >At2g46060.1 hypothetical protein / predicted by genscan; supported by cDNA: gi_18087618 Length = 766 Score = 120 bits (301), Expect = 3e-28 Identities = 57/95 (60%), Positives = 71/95 (74%) Frame = +1 Query: 4 TRSSNIVLVIAIGAAGLLIGFLIEFFRHYRRFSFSAELLLNMLHRWQTVKDWFHNLIKTI 183 TR+SNI++V+AIG+ GLLIGFL+EF YR + SA LNML R + VK+WF NLIKT+ Sbjct: 667 TRASNIIIVLAIGSLGLLIGFLVEFVTKYRSYCGSAGFSLNMLDRPRAVKEWFSNLIKTL 726 Query: 184 VKRFRWFFVVAGFGALAMAAISWNLESTESYWFWH 288 KRFRW FV AG A MAAIS+ +E++ SYW WH Sbjct: 727 KKRFRWGFVAAGLVAFTMAAISFKVETSSSYWMWH 761 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,078,313 Number of Sequences: 27288 Number of extensions: 200239 Number of successful extensions: 562 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 562 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 614270384 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB21M05.yg.ab1 (606 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g56730.1 zinc protease PQQL-like protein / 80 9e-21 >At5g56730.1 zinc protease PQQL-like protein / Length = 956 Score = 79.7 bits (195), Expect(2) = 9e-21 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 197 MSEIKSAYLERDQVQSISLCEEYLHHFLRKVPVVGIEYEAQLQKTILP 340 MSEI+SAYLERDQVQS SL +EY+ HFL K PV+GIEYEAQLQKT+LP Sbjct: 367 MSEIESAYLERDQVQSTSLRDEYIQHFLHKEPVIGIEYEAQLQKTLLP 414 Score = 37.4 bits (85), Expect(2) = 9e-21 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +3 Query: 135 IARVRLHGFSEREISVARA 191 +ARVRLHGFSEREISV RA Sbjct: 346 VARVRLHGFSEREISVVRA 364 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,320,667 Number of Sequences: 27288 Number of extensions: 220070 Number of successful extensions: 573 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 572 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 957813068 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB22K18.yg.ab1 (312 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g15240.1 expressed protein / ;supported by full-length cD... 127 1e-37 >At2g15240.1 expressed protein / ;supported by full-length cDNA: Ceres:120231. Length = 252 Score = 127 bits (319), Expect(2) = 1e-37 Identities = 56/87 (64%), Positives = 68/87 (77%) Frame = +2 Query: 50 FFPLFIVLYVIHFFISPLLVAHGFVPLLLSNLIFMAAASHYHYLNFLGYEVLPFLEKTAF 229 FFP+F++LYV+H+F+SPLL+AHGF+PLLLSNL+FM AS+YHYLNFLGY+VLPFLE+T F Sbjct: 158 FFPMFVLLYVVHYFLSPLLIAHGFIPLLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTF 217 Query: 230 FLYXXXXXXXXXXXXXXSGFTPSRYLM 310 FLY SGF PSRY M Sbjct: 218 FLYPIGVVIVLSPILILSGFNPSRYFM 244 Score = 44.7 bits (104), Expect(2) = 1e-37 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +1 Query: 4 QRVEWLYAFDVHCNSFFPV 60 QRVEWLY FDVHCNSFFP+ Sbjct: 143 QRVEWLYTFDVHCNSFFPM 161 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,098,727 Number of Sequences: 27288 Number of extensions: 139231 Number of successful extensions: 381 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 372 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 381 length of database: 11,516,596 effective HSP length: 79 effective length of database: 9,360,844 effective search space used: 224660256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB22O21.yg.ab1 (683 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48020.1 expressed protein / ;supported by full-length cD... 341 2e-94 >At5g48020.1 expressed protein / ;supported by full-length cDNA: Ceres:40096. Length = 355 Score = 341 bits (874), Expect = 2e-94 Identities = 156/226 (69%), Positives = 186/226 (82%) Frame = +2 Query: 5 DLKWRYMWRIGPRPSVTRFQDLNSDHIVPEGFPDWEETMNSWGYKLLSXXXXXXXXXXXG 184 D KWRYMWR+GPRPS TRF++LNS+ +VPEGFP WEE M+SWGYK++S G Sbjct: 120 DHKWRYMWRVGPRPSNTRFKELNSEPVVPEGFPGWEEVMDSWGYKMISAVEVVAEMAAIG 179 Query: 185 FGLPKDAFTNLMKNGPHLLSPTGGDLGSHGKEGTVFAGYHYDLNFLTIHYRSKFPGLYIW 364 FGLPKDAFT+LMK GPHLL+PTG DL + +EGT+FAGYHYDLNFLTIH RS+FPGLYIW Sbjct: 180 FGLPKDAFTSLMKQGPHLLAPTGSDLNCYNEEGTIFAGYHYDLNFLTIHGRSRFPGLYIW 239 Query: 365 LRNGEKVEVKVPEGCLLIQTGKQLEWVTAGECMAGLHEVVVTKRTIEAIKEAEKANRSLW 544 LRNGEKV VKVP GCLLIQ GKQ+EW+TAGEC+AG+HEVVVT +T +AI A++ NRSLW Sbjct: 240 LRNGEKVAVKVPVGCLLIQAGKQIEWLTAGECIAGMHEVVVTSKTKDAITLAKEQNRSLW 299 Query: 545 RISSTLFSSVASDAVMKPLGHFAKSPHAHEYPPVHAGEYYPKELVV 682 R+SSTLF+ +ASDA +KPLGHFA+S A +YP + AGEY +EL V Sbjct: 300 RVSSTLFAHIASDAELKPLGHFAESSLASKYPAIPAGEYVEQELSV 345 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,707,329 Number of Sequences: 27288 Number of extensions: 301605 Number of successful extensions: 848 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 826 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 847 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1165500188 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB23B20.yg.ab1 (659 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08740.1 Expressed protein / ; supported by cDNA: gi_15912... 118 3e-27 At2g20800.1 putative NADH-ubiquinone oxireductase / 55 4e-08 >At5g08740.1 Expressed protein / ; supported by cDNA: gi_15912292_gb_AY056424.1_ Length = 257 Score = 118 bits (295), Expect = 3e-27 Identities = 56/91 (61%), Positives = 77/91 (84%) Frame = +1 Query: 385 VLSLGAEPKLDIIPGAVEYALPFSTLDDALKVNDKLTKLERENFGKANPIRVVVVGLGYS 564 VL+LGAE KLD++PGA+E A PF TL+DA++VN+KL+KLER+NF + I+V VVG GY+ Sbjct: 27 VLALGAESKLDVVPGAMELAFPFYTLEDAIRVNEKLSKLERKNFKDGSAIKVAVVGCGYA 86 Query: 565 GVELAATVSERLEGKGVVQAISVDSSILPTA 657 GVELAAT+SERL+ +G+VQ+I+V +IL +A Sbjct: 87 GVELAATISERLQDRGIVQSINVSKNILTSA 117 >At2g20800.1 putative NADH-ubiquinone oxireductase / Length = 582 Score = 54.7 bits (130), Expect = 4e-08 Identities = 50/203 (24%), Positives = 89/203 (43%), Gaps = 13/203 (6%) Frame = +1 Query: 31 KRPRVCILGGGFGGLYTALRLESLTWPEDKKPQVILVDQSERFVFKPMLYELLTGEVDAW 210 ++ +V +LG G+ G L++ + V +V F+F P+L + G V+A Sbjct: 62 RKKKVVVLGSGWSGY------SFLSYLNNPNYDVQVVSPRNFFLFTPLLPSVTNGTVEAR 115 Query: 211 EIAPRFSDLLVNTGVQFLKDK-VKVLSPCDHVGINGPNVSGCGGTVQLESGLAIEYDWSV 387 I L+ G ++ + + VK+ + + S GT + + ++YD + Sbjct: 116 SIVEPIRGLMRKKGFEYKEAECVKIDASNKKIHCRSKEGSSLKGTTEFD----MDYDILI 171 Query: 388 LSLGAEPKLDIIPGAVEYALPFSTLDDALKVN------------DKLTKLERENFGKANP 531 L++GA+P PG E+A +DAL + LT+ ER+ Sbjct: 172 LAVGAKPNTFNTPGVEEHAYFLKEAEDALNIRHSVIDCFERASLPNLTEEERKKI----- 226 Query: 532 IRVVVVGLGYSGVELAATVSERL 600 + VVVG G +GVE +A + + L Sbjct: 227 LHFVVVGGGPTGVEFSAELHDFL 249 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.139 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,081,349 Number of Sequences: 27288 Number of extensions: 340881 Number of successful extensions: 1306 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1297 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1106605264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB23C03.yg.ab1 (763 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g21350.1 hypothetical protein / predicted by genemark.hmm 215 2e-56 >At1g21350.1 hypothetical protein / predicted by genemark.hmm Length = 199 Score = 215 bits (547), Expect = 2e-56 Identities = 123/232 (53%), Positives = 143/232 (61%), Gaps = 5/232 (2%) Frame = +2 Query: 35 TMASVTSSAFLLPSVSHNKCWSSALRR-----NPKKLIVRAARTESKGVSLGSRAPHFEL 199 T +V+S F S S ++ S LRR +P++L+VRAARTES GV LG+RAP+FE Sbjct: 22 TALAVSSRRF--SSFSPSRLDFSNLRRRVNAPSPRRLVVRAARTESAGVKLGARAPNFE- 78 Query: 200 EEPLSGNMWKLDDFESYPALLVMFICNHCPFVKHLKKDIVKLTNLYMKKGLGVVAISSNS 379 KGL VVAISSNS Sbjct: 79 ------------------------------------------------KGLAVVAISSNS 90 Query: 380 IVTHPQDGPVFMAEDARTFNYPFPYLYDPSQDVARAYGAVCTPEFYLFKKDGRRPFELVY 559 +VTHPQDGP FMAEDA+ F YPFPYLYD SQ+VAR +GAVCTPEF+L+KKDGRRPFELVY Sbjct: 91 VVTHPQDGPEFMAEDAKVFKYPFPYLYDESQEVAREFGAVCTPEFFLYKKDGRRPFELVY 150 Query: 560 HGQFDDSRPSNNVTVTGRDLSLAIDCVLSGQPVPPNHKPSVGCSI*WHADGK 715 HGQFDDSRPS+N VTGRDLSLAID LS QP+P N KPS+ WH + K Sbjct: 151 HGQFDDSRPSSNSPVTGRDLSLAIDLSLSCQPIPSNQKPSIK----WHPETK 198 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,033,949 Number of Sequences: 27288 Number of extensions: 412865 Number of successful extensions: 1030 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 991 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1030 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1383666960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB23C08.yg.ab1 (736 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g09860.1 expressed protein / ; supported by cDNA: gi_1598... 215 2e-56 >At5g09860.1 expressed protein / ; supported by cDNA: gi_15983383_gb_AF424566.1_AF424566 Length = 599 Score = 215 bits (548), Expect = 2e-56 Identities = 110/185 (59%), Positives = 142/185 (76%), Gaps = 4/185 (2%) Frame = +1 Query: 1 EQNPDALTDPKRVRTPAVREHWKKLADDMDPEAGIGAEYSHKNNRVYCWKGLRFSARQDL 180 +QNP+ALTD +RVRTP + ++WK LA+DMDP AGI EY HKNNRVYCWKGLRF+ARQDL Sbjct: 411 DQNPNALTDSQRVRTPDIADYWKPLAEDMDPSAGIEDEYHHKNNRVYCWKGLRFTARQDL 470 Query: 181 EGFSRFTDHGVEGVVPLELLPPDVRAKYQSKPNDKSKRAKKEETKTVANQAEENQI--AT 354 EGFSRFT+ G+EGVVP+ELLPP+VR+KYQ+KPN+K+KRAKKEETK +++ E NQI + Sbjct: 471 EGFSRFTEMGIEGVVPVELLPPEVRSKYQAKPNEKAKRAKKEETKGGSHETEGNQIGVSN 530 Query: 355 READGEGNRPDIDLSATPMDTADAASISPEEQQK-QTPDTDGGQEPGQIDEPD-PEPGMI 528 EA+ EG R D + T A A + +PEEQQ+ DT+ GQE GQI++ + E G++ Sbjct: 531 SEAEAEGGRGDAE---TMESDAIADTPTPEEQQRLGGSDTENGQEAGQIEDGETEEAGLM 587 Query: 529 DAETD 543 D + D Sbjct: 588 DTDLD 592 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,206,618 Number of Sequences: 27288 Number of extensions: 316055 Number of successful extensions: 1267 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1255 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB23D04.yg.ab1 (701 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g04790.1 hypothetical protein / predicted by genefinder 137 4e-33 >At2g04790.1 hypothetical protein / predicted by genefinder Length = 145 Score = 137 bits (346), Expect = 4e-33 Identities = 73/133 (54%), Positives = 95/133 (70%), Gaps = 1/133 (0%) Frame = +2 Query: 29 GSEVFVAAVPLTAAKGPPQLVMSAAYSLSLSWDLQHFMVLSTLPTLPSQVLVFDFQPQDP 208 G ++VAAVPL AA GPPQL+MS AYSL++S +LQHFMVL P+ P + +P++P Sbjct: 16 GDTIYVAAVPLKAAAGPPQLIMSMAYSLNIS-NLQHFMVLIK-PSSPIRQ-----EPRNP 68 Query: 209 ENVYAALAALSGRKIPGVLLTRKMKKLPNMRCWKVG-SCNVDVEDVIHGFNSSWDTDLIV 385 E++ AA++ LSG IPGV+L R++K +P RCW VG S D ++ FN SW+TDL V Sbjct: 69 ESIEAAISLLSGNLIPGVVLQRRLKNVPRQRCWMVGPSKGNDAMEMAMEFNKSWETDLRV 128 Query: 386 GQHDCRHYTNGLV 424 G HDCRHYTNGLV Sbjct: 129 GFHDCRHYTNGLV 141 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,546,496 Number of Sequences: 27288 Number of extensions: 349428 Number of successful extensions: 873 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 871 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1218881876 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB23D17.yg.ab1 (709 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56510.1 putative protein / TATA-binding protein-binding p... 253 9e-68 >At3g56510.1 putative protein / TATA-binding protein-binding protein, ABT1 - Mus musculus, EMBL:AB021860 Length = 266 Score = 253 bits (645), Expect = 9e-68 Identities = 128/210 (60%), Positives = 158/210 (74%), Gaps = 9/210 (4%) Frame = +3 Query: 3 PPRMDPLKLRHILSQYGDIERIWLTPE---------DPAALVHRKKAGGFRGQGFTEGWV 155 PP MD ++LRHIL+QYG++ RI+L PE D A VHRK+AGGFRGQ F+EGWV Sbjct: 58 PPHMDHVRLRHILAQYGELGRIYLAPEADTFVYCYSDSEAQVHRKRAGGFRGQRFSEGWV 117 Query: 156 EFTNKNVAKRVASTLNGEQIGGKKKSSFYYDLWNIKYLSKFKWDHLTEEIAYKNATREQK 335 EF K+VAKRVA LNGEQIGGKKKSS YYD+WNIKYL+KFKWD LTEEIAYK+A REQK Sbjct: 118 EFAKKSVAKRVADMLNGEQIGGKKKSSVYYDIWNIKYLTKFKWDDLTEEIAYKSAIREQK 177 Query: 336 LALELSAAKKERDFYLAKVDQSRALSSIDERLKKKRKIQQANGTSEVQGDHQQAAKVIRQ 515 L + LSAAK+E+DFYL+K+++SRA++ ID R++KKRKIQ+ +G S + + I Q Sbjct: 178 LNMVLSAAKREKDFYLSKIEKSRAMTEIDARMEKKRKIQEESG-SNAEAAPVFPPRAIFQ 236 Query: 516 FPQTKPVRDGGEKQKPGLSKDLLAGVFGGS 605 F Q K + + + KPGLS D LA VFGGS Sbjct: 237 FRQKKSIENETSQSKPGLSTDFLASVFGGS 266 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,264,442 Number of Sequences: 27288 Number of extensions: 293525 Number of successful extensions: 941 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 938 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1236675772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB23J15.yg.ab1 (618 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09180.1 expressed protein / ; supported by full-length cD... 172 1e-51 >At3g09180.1 expressed protein / ; supported by full-length cDNA: Ceres: 119803. Length = 402 Score = 172 bits (435), Expect(2) = 1e-51 Identities = 92/178 (51%), Positives = 121/178 (67%), Gaps = 10/178 (5%) Frame = +1 Query: 4 KKQRGTHTSTQH--EEFSDLKTMSDVLTELEKEIPEVKTSTYQRLEWSKRASLLPNDTFD 177 KK R +H ++ EE D KT+ D+ + LEK +P VK STY RL W KRA+ LP D Sbjct: 175 KKHRASHLLLENGREEPVDYKTLPDIQSRLEKLVPSVKVSTYGRLNWLKRANSLPGSGSD 234 Query: 178 ESPKDHNN-FQSSRNIIS-------DQIGVIELLIPSVFRAVISLYPTGSLLPDAVAFFS 333 + + FQSS + S D+I VIEL PS+FRA++SL P GS+ PDAVAFFS Sbjct: 235 DPTEASKPIFQSSSKLRSGLQTEVVDKIAVIELSFPSLFRAIVSLSPAGSVDPDAVAFFS 294 Query: 334 PDEGGSYVHARGVSAFNVFRNITEHAAMAPQHFIGVNAETALYKLLHWICSYQTLFTK 507 PDEGGSY+HARG S ++V+++ITEHAA A Q+F+G TALY LL WICS++++F+K Sbjct: 295 PDEGGSYLHARGFSVYHVYKHITEHAATALQYFLGFGTGTALYSLLLWICSFESVFSK 352 Score = 48.9 bits (115), Expect(2) = 1e-51 Identities = 20/35 (57%), Positives = 28/35 (79%) Frame = +2 Query: 506 KSCRKCGKLLSMDKESALLLPPVQRAYRNFSVSKN 610 K C KCG+LL+MDK+SAL+LPP+ RAY+ ++ N Sbjct: 352 KPCTKCGRLLAMDKKSALILPPLHRAYQELPLALN 386 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,832,403 Number of Sequences: 27288 Number of extensions: 257390 Number of successful extensions: 770 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 769 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 981665960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB23L02.yg.ab1 (656 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21320.1 hypothetical protein / 218 2e-62 >At4g21320.1 hypothetical protein / Length = 320 Score = 218 bits (554), Expect(2) = 2e-62 Identities = 115/174 (66%), Positives = 132/174 (75%), Gaps = 32/174 (18%) Frame = +2 Query: 74 LRYIRLIKSHGLKAKPQFAVKFNKADIPPTRARAYGAYVVPTPRTSERVEDVDLLIRKAE 253 LRY+RLIK+ GL+AKP FAVKFNK+DIP R RA+G+YVVP PR+SE VED+DLLIRKAE Sbjct: 131 LRYVRLIKNGGLRAKPMFAVKFNKSDIPG-RNRAFGSYVVPEPRSSEFVEDIDLLIRKAE 189 Query: 254 RCLEAGADMIVIDAEDVCKYADSVRADIIAKVIGRLGIEKTMFEASNAKTSEWFIKQYGP 433 RCLEAGAD I+IDA+DVCKYADS+RADIIAKVIGRLGIEKTMFEAS+AK EWFIK+YGP Sbjct: 190 RCLEAGADTIMIDADDVCKYADSLRADIIAKVIGRLGIEKTMFEASDAKLVEWFIKRYGP 249 Query: 434 N--------------------------------VNLFVDHSQVLDLECLRGRNL 499 N VNL+VDHSQ++DLECLRGR+L Sbjct: 250 NVFADTLVLSIIFNLLFEWSPSQDSYLFVLVFQVNLYVDHSQIMDLECLRGRHL 303 Score = 39.3 bits (90), Expect(2) = 2e-62 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = +1 Query: 7 KQLGFDTVELNTGSLELPEETLV 75 KQLGFDT+ELN LE+PEETL+ Sbjct: 109 KQLGFDTIELNANLLEVPEETLL 131 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,199,674 Number of Sequences: 27288 Number of extensions: 265270 Number of successful extensions: 756 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 754 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1097681028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB24O22.yg.ab1 (681 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26970.1 hypothetical protein / predicted by grail; suppor... 211 3e-55 >At2g26970.1 hypothetical protein / predicted by grail; supported by cDNA: gi_17381149 Length = 222 Score = 211 bits (537), Expect = 3e-55 Identities = 104/174 (59%), Positives = 132/174 (75%) Frame = +3 Query: 159 MDHLSNTFSLLEMDVEDDRIETTSSANDPEKPNGDAKKETDSHKNVLEGDYRLPLVWIDL 338 M+ LSN FS+L ED + ++SS K+E + ++ +GDY+ PLVWIDL Sbjct: 1 MNKLSNAFSVLAFADEDAPMASSSSTG---------KQEESVNGSLEDGDYKQPLVWIDL 51 Query: 339 EMTGLNIEVDRILEIACIITDGKLNKSIEGPDLVIHQPKKCLDEMGEWCTEHHAASGLTE 518 EMTGLN+EVDRILEIACIIT+G L +S+EGPDLV+ Q K CLD+M +WC HH ASGLT+ Sbjct: 52 EMTGLNVEVDRILEIACIITNGDLTQSVEGPDLVVRQTKDCLDKMDDWCQTHHGASGLTK 111 Query: 519 KVIQSTISAKEAEQRAVEFVKKHVGTYTPLLAGNSAYVEFMFLKKYMPELASLF 680 KV+ S I+ +EAEQ+ +EFVKKHVG+ PLLAGNS YV+F+FLKKYMPELA+LF Sbjct: 112 KVLLSAITEREAEQKVIEFVKKHVGSGNPLLAGNSVYVDFLFLKKYMPELAALF 165 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,004,583 Number of Sequences: 27288 Number of extensions: 319827 Number of successful extensions: 916 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 887 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 916 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1156603240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB25E24.yg.ab1 (747 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g45900.1 ubiquitin activating enzyme E1-like protein / ; ... 182 7e-87 >At5g45900.1 ubiquitin activating enzyme E1-like protein / ; supported by cDNA: gi_14334507_gb_AY034945.1_ Length = 697 Score = 182 bits (461), Expect(2) = 7e-87 Identities = 91/132 (68%), Positives = 108/132 (80%) Frame = +3 Query: 336 FLLTDTRESRWLPTLLCANANKLTITAALGFDSFMVMRHGAGPLSAADESKTEPDSSLSA 515 FLLTDTRESRWLP+LLCANANK+ I AALGFDS+MVMRHGAGP +SLS Sbjct: 472 FLLTDTRESRWLPSLLCANANKIAINAALGFDSYMVMRHGAGP------------TSLSD 519 Query: 516 DVEKMSLSHSDSKPRLGCYFCNDVVAPVDSTTNRTLDQQCTVTRPGLAPIASALAVELFV 695 D++ + ++ ++++ RLGCYFCNDVVAP DS T+RTLDQQCTVTRPGLAPIA ALAVEL V Sbjct: 520 DMQNLDINKTNTQ-RLGCYFCNDVVAPQDSMTDRTLDQQCTVTRPGLAPIAGALAVELLV 578 Query: 696 GILHHPLGISAE 731 G+L HPLGI+A+ Sbjct: 579 GVLQHPLGINAK 590 Score = 156 bits (395), Expect(2) = 7e-87 Identities = 76/108 (70%), Positives = 90/108 (82%), Gaps = 1/108 (0%) Frame = +1 Query: 19 AGTLGCQVARMLMAWGVRKITLVDNGKVAMSNPLRQSLYTFDDSV-KGDKKAVAAAESLR 195 AGTLGCQVAR LM WG+R IT VD GKVAMSNP+RQSLY F+D + +G+ KAVAA +SL+ Sbjct: 365 AGTLGCQVARTLMGWGIRNITFVDYGKVAMSNPVRQSLYNFEDCLGRGEFKAVAAVKSLK 424 Query: 196 KIFPAVEAEGIVMAIPMPGHPVPSKDERGVLDDCTRLRELIESHDAVF 339 +IFPA+E G+VMAIPMPGHP+ S++E VL DC RL ELIESHDAVF Sbjct: 425 QIFPAMETSGVVMAIPMPGHPISSQEEDSVLGDCKRLSELIESHDAVF 472 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,973,626 Number of Sequences: 27288 Number of extensions: 334624 Number of successful extensions: 1099 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1096 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB27E16.yg.ab1 (569 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g12370.1 expressed protein / ; supported by cDNA: gi_14334... 43 4e-11 >At1g12370.1 expressed protein / ; supported by cDNA: gi_14334575_gb_AY034961.1_ Length = 490 Score = 42.7 bits (99), Expect(2) = 4e-11 Identities = 23/60 (38%), Positives = 33/60 (54%) Frame = +1 Query: 238 YVGCMWTIWCLYLHQGMDNRHPCLGRHHTRITPACERKFDVDGYIRICENLITTSPDTRR 417 YVGCMW+I C QG R P G+ C+RKF+VD YI ++L++ + R+ Sbjct: 416 YVGCMWSI-CGVHDQGWKER-PVFGKIRYMNYAGCKRKFNVDSYISYVKSLVSVTKKKRK 473 Score = 41.6 bits (96), Expect(2) = 4e-11 Identities = 19/46 (41%), Positives = 30/46 (64%) Frame = +2 Query: 86 MAHYGKMHAFMRPYCSSYILQWTSSPQQALEYTLLFS*QWIIIDGQ 223 M + GKMH FMR Y + IL+WT P++AL ++ + ++ IDG+ Sbjct: 367 MVYQGKMHGFMRMYWAKKILEWTKGPEEALSISIYLNNKY-EIDGR 411 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,412,005 Number of Sequences: 27288 Number of extensions: 311448 Number of successful extensions: 828 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 826 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 850394780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB27G09.yg.ab1 (731 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56940.1 leucine zipper-containing protein AT103 / ; suppo... 414 e-116 >At3g56940.1 leucine zipper-containing protein AT103 / ; supported by cDNA: gi_1033194_gb_U38232.1_ATU38232 Length = 409 Score = 414 bits (1063), Expect = e-116 Identities = 195/229 (85%), Positives = 208/229 (90%) Frame = +1 Query: 1 FLNKGLSDFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLKANPQY 180 FLNKGLSDFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLK NP++ Sbjct: 181 FLNKGLSDFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLKENPEF 240 Query: 181 QCYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDWKAKLWARFFCLSVYVTMYLNDTQ 360 QCYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDW+AKLW+RFFCLSVYVTMYLND Q Sbjct: 241 QCYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDWQAKLWSRFFCLSVYVTMYLNDCQ 300 Query: 361 RTAFYEGIGLDTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRKLDRMADLNSKIIAIG 540 RT FYEGIGL+TKEFDMHVIIETNRTTARIFPAVLDVENPEFKRKLDRM K++AIG Sbjct: 301 RTNFYEGIGLNTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRKLDRMVVSYEKLLAIG 360 Query: 541 ETDDIPLVKNLKRVPHIAGLVSELLAAYLMKPIESGSVDIAELDPQLGY 687 ETDD +K LKR+P + L SE+LAAYLM P+ESGSVD AE +P L Y Sbjct: 361 ETDDASFIKTLKRIPLVTSLASEILAAYLMPPVESGSVDFAEFEPNLVY 409 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,323,906 Number of Sequences: 27288 Number of extensions: 376556 Number of successful extensions: 1237 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1175 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1233 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1294970360 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB27I07.yg.ab1 (610 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g12590.1 putative protein / predicted protein, Saccaromyce... 302 8e-83 >At4g12590.1 putative protein / predicted protein, Saccaromyces cerevisiae;supported by full-length cDNA: Ceres:33190. Length = 246 Score = 302 bits (774), Expect = 8e-83 Identities = 149/176 (84%), Positives = 161/176 (90%) Frame = +3 Query: 81 MAEELVLDTAIRDWVLIPLSVVMVLIGILRYFVSKLMRTSQLPDSKIIKEGQVIIXXXXX 260 MAE+LVLDTAIRDWVLIPLSVVMVLIGILRYFVSKLMR++ PD+K++KEGQV+I Sbjct: 1 MAEDLVLDTAIRDWVLIPLSVVMVLIGILRYFVSKLMRSTPTPDAKMVKEGQVVIRARNL 60 Query: 261 XXXXXFIPVKAFRARKVYYTNEENGLLHVPKGQAQNPQAQMFSDPNMAMDMMKKNLSMII 440 FIP K+FRAR+ Y++NEENGLLHVPKG+AQNPQA MFSDPNMAMDMMKKNLSMII Sbjct: 61 KVGANFIPPKSFRARRFYFSNEENGLLHVPKGEAQNPQAAMFSDPNMAMDMMKKNLSMII 120 Query: 441 PQTLTFAWVNFFFSGFVAAKIPFPLTQRFRSMLQNGIDLSTVDVSYVSSRSWYFLN 608 PQTLTFAWVNFFFSGFVAAKIPFPLTQRFRSMLQNGIDLSTVDVSYVSSRSWYFLN Sbjct: 121 PQTLTFAWVNFFFSGFVAAKIPFPLTQRFRSMLQNGIDLSTVDVSYVSSRSWYFLN 176 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,810,267 Number of Sequences: 27288 Number of extensions: 273827 Number of successful extensions: 746 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 966764592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB27I24.yg.ab1 (734 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g09830.1 putative phosphoribosylglycinamide synthetase / I... 401 e-112 >At1g09830.1 putative phosphoribosylglycinamide synthetase / Identical to A. thaliana PUR2 (gb|X74766). ESTs gb|ATTS3927,gb|N96446 come from this gene; supported by cDNA: gi_15292772_gb_AY050820.1_ Length = 532 Score = 401 bits (1030), Expect = e-112 Identities = 196/243 (80%), Positives = 220/243 (89%) Frame = +1 Query: 4 FGKAGSSIIVEEFLEGEEASFFAIVDGENALPLESAQDHKRVGDGDTGPNTGGMGAYCLA 183 FG AG ++VEEFLEGEEASFFA+VDGENA+PLESAQDHKRVGDGDTGPNTGGMGAY A Sbjct: 272 FGSAGCQVVVEEFLEGEEASFFALVDGENAIPLESAQDHKRVGDGDTGPNTGGMGAYSPA 331 Query: 184 PVLTQELQSLVMSSIILPTVTGMAKEGCKFVGVLYAGLMIEKKSGLPKLIEYNVRFGDPE 363 PVLT+ELQ VM SII PTV GMA+EGCKFVGVL+AGLMIEKKSGLPKLIE+NVRFGDPE Sbjct: 332 PVLTKELQDFVMESIIHPTVKGMAEEGCKFVGVLFAGLMIEKKSGLPKLIEFNVRFGDPE 391 Query: 364 CQVLMVRLESDLAQVLLAACKGELNTVSLEWAPGSAMVVVMASNGYPGSYVKGTKIQNLE 543 CQVLM+RLESDLA+VLLAACKGEL+ VSL+W+ SAMVVVMASNGYPGSY KG+ I+NLE Sbjct: 392 CQVLMMRLESDLAKVLLAACKGELSGVSLDWSKDSAMVVVMASNGYPGSYEKGSIIKNLE 451 Query: 544 EAEAAAPGVKIFHAGTAVDADGDYVANGGRVLGVTAKGKDLEEARDRAYRAVEEIKWDGG 723 EAE APGVK+FHAGT +D++G+ VA GGRVLGVTAKGKDLEEAR+RAY AV++I W GG Sbjct: 452 EAERVAPGVKVFHAGTGLDSEGNVVATGGRVLGVTAKGKDLEEARERAYSAVQQINWPGG 511 Query: 724 FYR 732 F+R Sbjct: 512 FFR 514 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.315 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,060,859 Number of Sequences: 27288 Number of extensions: 367809 Number of successful extensions: 940 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 865 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 930 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB27K17.yg.ab1 (755 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g25770.1 putative protein / predicted protein, Oryza sativa 162 1e-40 >At5g25770.1 putative protein / predicted protein, Oryza sativa Length = 318 Score = 162 bits (411), Expect = 1e-40 Identities = 72/105 (68%), Positives = 88/105 (83%) Frame = +2 Query: 434 QGHLPVLILSMKESTRSKRPATVFLHSTNKCKEWVRPLLEAYASRGYIAVAIDSRYHGER 613 QG LP+LILS+KE + KRPA VF+H TN KEW+RP LEAYASRGY+A+ +DSRYHGER Sbjct: 16 QGKLPLLILSLKERSEEKRPAIVFMHGTNTNKEWLRPWLEAYASRGYVAIGLDSRYHGER 75 Query: 614 AKNQTTYEDVLVSSWKNGDTMPFIFDTAWDLVKVADYLTARDDIE 748 A +T Y D L+SSW+NG+TMPFIFDT WDL+K+A+YLT RDDI+ Sbjct: 76 ADCKTAYRDALISSWRNGNTMPFIFDTVWDLIKLAEYLTQRDDID 120 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,292,099 Number of Sequences: 27288 Number of extensions: 343962 Number of successful extensions: 1151 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1052 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1146 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB27L12.yg.ab1 (747 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06350.1 dehydroquinate dehydratase/shikimate dehydrogenase, ... 169 2e-42 >At3g06350.1 dehydroquinate dehydratase/shikimate dehydrogenase, putative / similar to dehydroquinate dehydratase/shikimate dehydrogenase [Nicotiana tabacum][GI:535771], dehydroquinate dehydratase/shikimate:NADP oxidoreductase [Lycopersicon esculentum][GI:3169883] Length = 603 Score = 169 bits (427), Expect = 2e-42 Identities = 89/186 (47%), Positives = 119/186 (63%) Frame = +1 Query: 1 KLVGYNTDCDACITAIEDALQERQSSKGEVQNGSSPISXXXXXXXXXXXXXXXXXXXXKS 180 KL+GYNTDC I+AIED L+ V + SSP++ K Sbjct: 416 KLLGYNTDCIGSISAIEDGLRS-SGDPSSVPSSSSPLASKTVVVIGAGGAGKALAYGAKE 474 Query: 181 KGARVVIFNRNFERAESLARAVSGEALPIEQLDTYCPQNGMILANCSAIGMEPDVHLTPV 360 KGA+VVI NR +ERA LA A+ G+AL + LD Y P++GM+LAN +++GM+P+V TP+ Sbjct: 475 KGAKVVIANRTYERALELAEAIGGKALSLTDLDNYHPEDGMVLANTTSMGMQPNVEETPI 534 Query: 361 SKENLRSYDLVFDAVYTPRNTRLLQEAAEVGVTVVSGVEMFVRQALGQFKLFTNGLAPED 540 SK+ L+ Y LVFDAVYTPR TRLL+EA E G VSG EMFVRQA QF++FT AP++ Sbjct: 535 SKDALKHYALVFDAVYTPRITRLLREAEESGAITVSGSEMFVRQAYEQFEIFTGLPAPKE 594 Query: 541 FMRKVV 558 +++ Sbjct: 595 LYWQIM 600 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,191,544 Number of Sequences: 27288 Number of extensions: 351105 Number of successful extensions: 894 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 869 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 893 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB28D24.yg.ab1 (732 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g58610.1 ketol-acid reductoisomerase / ; supported by cDN... 456 e-129 >At3g58610.1 ketol-acid reductoisomerase / ; supported by cDNA: gi_13265432_gb_AF324671.2_AF324671 Length = 591 Score = 456 bits (1174), Expect = e-129 Identities = 226/244 (92%), Positives = 234/244 (95%) Frame = +1 Query: 1 INASFAVHQDVDGRATDVALGWSVALGSPFTFATTLEQEYKSDIFGERGILLGAVHGIVE 180 INASFAVHQDVDGRA DVALGWSVALGSPFTFATTLEQEY+SDIFGERGILLGAVHGIVE Sbjct: 267 INASFAVHQDVDGRAADVALGWSVALGSPFTFATTLEQEYRSDIFGERGILLGAVHGIVE 326 Query: 181 SLFRRYTEQGMTEDLAYKNTVECITGVISKTISTKGMKAVYESLSEEGKKDFLIAYSASY 360 SLFRRYTE GM+EDLAYKNTVECITG IS+TIST+GM AVY SLSEEGKKDF AYSAS+ Sbjct: 327 SLFRRYTENGMSEDLAYKNTVECITGTISRTISTQGMLAVYNSLSEEGKKDFETAYSASF 386 Query: 361 YPCMEILYECYEDVASGSEIRSVVLAGRRFYEKEGLPAFPMGKIDQTRMWKVGERVRATR 540 YPCMEILYECYEDV SGSEIRSVVLAGRRFYEKEGLPAFPMG IDQTRMWKVGERVR +R Sbjct: 387 YPCMEILYECYEDVQSGSEIRSVVLAGRRFYEKEGLPAFPMGNIDQTRMWKVGERVRKSR 446 Query: 541 PAGDLGPLYPFTAGVYVALMMAQIEVLRKKGHSYSEIINESLIESVDSLNPFMHARGVSF 720 PAGDLGPLYPFTAGVYVALMMAQIE+LRKKGHSYSEIINES+IESVDSLNPFMHARGVSF Sbjct: 447 PAGDLGPLYPFTAGVYVALMMAQIEILRKKGHSYSEIINESVIESVDSLNPFMHARGVSF 506 Query: 721 MVDN 732 MVDN Sbjct: 507 MVDN 510 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,658,922 Number of Sequences: 27288 Number of extensions: 371996 Number of successful extensions: 933 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 915 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1294970360 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB28F06.yg.ab1 (723 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g41020.1 unknown protein / 118 4e-27 At2g41030.1 unknown protein / 83 7e-22 >At2g41020.1 unknown protein / Length = 325 Score = 118 bits (295), Expect = 4e-27 Identities = 51/116 (43%), Positives = 67/116 (56%) Frame = +2 Query: 8 FYYNEKSGISQWEKPVGPSMNSQPQSSSALLEDWQEVLDETSGCKYYYNSKTNVSQWEHP 187 +YYN+ +G QWE+PV S + E+W E DE SG KY+YN++T+VSQWE P Sbjct: 210 YYYNQHTGTCQWERPVELSYATSSAPPVLSKEEWIETFDEASGHKYFYNTRTHVSQWEPP 269 Query: 188 XXXXXXXXXXXXNVDSRDVSNPKSSDHSLELKKCSGCGGWGLDLVQSWGYCCHCTR 355 N ++ +N K +L +CSGCGGWG+ LVQ WGYC HCTR Sbjct: 270 ASLQKPAATNSNNAVTQSTANGKGEHPPSQLPRCSGCGGWGVGLVQRWGYCVHCTR 325 >At2g41030.1 unknown protein / Length = 132 Score = 82.8 bits (203), Expect(2) = 7e-22 Identities = 37/39 (94%), Positives = 38/39 (96%) Frame = +3 Query: 480 RKRAHTEDDELDPMDPSSYSDAPRGGWVVGLKGVQPRAA 596 +KRAH EDDELDPMDPSSYSDAPRGGWVVGLKGVQPRAA Sbjct: 7 KKRAHAEDDELDPMDPSSYSDAPRGGWVVGLKGVQPRAA 45 Score = 38.5 bits (88), Expect(2) = 7e-22 Identities = 16/24 (66%), Positives = 19/24 (78%) Frame = +2 Query: 623 FNHGPYPSPGAVLRENAEIASQRR 694 F PYPSPGAVLR NAE+AS ++ Sbjct: 85 FQQRPYPSPGAVLRRNAEVASSQK 108 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,385,987 Number of Sequences: 27288 Number of extensions: 353214 Number of successful extensions: 1053 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 997 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1047 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1268361380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB28H24.yg.ab1 (724 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60990.1 hypothetical protein / predicted by genscan+, sim... 330 6e-91 At1g11860.1 aminomethyltransferase-like precursor protein / v... 47 8e-06 >At1g60990.1 hypothetical protein / predicted by genscan+, similar to aminomethyltransferase GB:CAA20175 from [Streptomyces coelicolor A3(2)] Length = 436 Score = 330 bits (845), Expect = 6e-91 Identities = 168/251 (66%), Positives = 195/251 (76%), Gaps = 13/251 (5%) Frame = +1 Query: 4 KVSEDWVIETFNNDEEALDAVDSGTVVVDLSHYGRIRVSGEDRIKFLHNQSTANFEALSE 183 KVSED V+E+F+ND+EALDA D+G VVVDLSH+GRIRVSG+DR FLHNQ+TANFE+L E Sbjct: 80 KVSEDGVVESFDNDDEALDAFDNGVVVVDLSHFGRIRVSGDDRAHFLHNQTTANFESLYE 139 Query: 184 GGGCDTVFVTPTARTIDLAQAWIMKTAVTLVVSPATSKSISEMLNKYIFFGDNVEIQDIS 363 G GCDTVFVTPTARTID+A AWIMK A+ L VSP T +SI EMLNKYIFF D VEI+DI+ Sbjct: 140 GQGCDTVFVTPTARTIDIAHAWIMKNAILLTVSPTTCQSIIEMLNKYIFFADKVEIKDIT 199 Query: 364 DKTCLFALAGPKSN-------------QVMMDLNLGDLIGQPYGSHKRYNAYMQVGGNPV 504 +TCLFALAGPKSN Q+M LNLGDLIGQPYG H+ Y+ G P+ Sbjct: 200 KQTCLFALAGPKSNQLHYSYATVKNMKQIMSKLNLGDLIGQPYGRHQHYS----FDGMPI 255 Query: 505 TVAVGSVISEEGFSLLMSPSAAGLIWKTILSHGATPMGSNALEIYRIRQGRPAPGSELTD 684 TV VGS+IS+EGF++LMSP A +WKT+L+ GA PMGS A E RI QGRPAP EL+ Sbjct: 256 TVGVGSLISDEGFTMLMSPGGAVSVWKTLLAEGAIPMGSVAWEKLRITQGRPAPERELSK 315 Query: 685 EFNVLEAGLWN 717 EFNVLEAGLWN Sbjct: 316 EFNVLEAGLWN 326 >At1g11860.1 aminomethyltransferase-like precursor protein / very strong similarity to aminomethyltransferase precursor gb|U79769 from Mesembryanthemum crystallinum. ESTs gb|T43167, gb|T21076, gb|H36999, gb|T22773, gb|N38038, gb|T13742, gb|Z26545, gb|T20753 and gb|W43123 come from this gene Length = 408 Score = 47.4 bits (111), Expect = 8e-06 Identities = 55/218 (25%), Positives = 91/218 (41%), Gaps = 10/218 (4%) Frame = +1 Query: 88 DLSHYGRIRVSGEDRIKFLHNQSTANFEALSEGGGCDTVFVTPTARTIDLAQAWIMKTA- 264 D++H + + G+D + FL A+ L+ G G TVF ID + I K Sbjct: 83 DVAHMCGLSLKGKDCVPFLETLVVADVAGLAPGTGSLTVFTNEKGGAID--DSVITKVTD 140 Query: 265 --VTLVVSPATSKS----ISEMLNKYIFFGDNVEIQDISDKTCLFALAGPKSNQVMMDLN 426 + LVV+ I E + + G +V I D+ L AL GP + V+ L Sbjct: 141 EHIYLVVNAGCRDKDLAHIEEHMKAFKSKGGDVS-WHIHDERSLLALQGPLAAPVLQHLT 199 Query: 427 LGDLIGQPYGSHKRYNAYMQVGGNPVTVAVGSVISEEGFSLLMSPSAAGLIWKTIL--SH 600 DL +G+ + + + G+ + E+GF + + A + K IL S Sbjct: 200 KEDLSKLYFGNFQ----ILDINGSTCFLTRTGYTGEDGFEISVPDEHAVDLAKAILEKSE 255 Query: 601 GATPM-GSNALEIYRIRQGRPAPGSELTDEFNVLEAGL 711 G + G A + R+ G G+++ + +EAGL Sbjct: 256 GKVRLTGLGARDSLRLEAGLCLYGNDMEQHISPVEAGL 293 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.133 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,975,587 Number of Sequences: 27288 Number of extensions: 308382 Number of successful extensions: 897 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 872 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 895 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1268361380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB28I02.yg.ab1 (449 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62010.1 putative protein / paladin - Mus musculus, EMBL:M... 67 5e-12 >At3g62010.1 putative protein / paladin - Mus musculus, EMBL:MMPAL Length = 1232 Score = 66.6 bits (161), Expect = 5e-12 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = -2 Query: 373 VIQRCAGAGHLRDDILFYSKELEKFEGNDDEHKAYIMDMGIKALR 239 +++ CAGAGHLR+DI++YSKEL K DE+++YIMDMG+KALR Sbjct: 1167 IVELCAGAGHLREDIVYYSKELNKLPITKDENRSYIMDMGVKALR 1211 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,059,256 Number of Sequences: 27288 Number of extensions: 176358 Number of successful extensions: 442 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 441 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 534579884 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB28K23.yg.ab1 (761 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61450.1 putative protein / ATP GTP nucleotide-binding pro... 307 5e-84 >At5g61450.1 putative protein / ATP GTP nucleotide-binding protein, Leishmania infantum, EMBL:LIIMNBA; supported by cDNA: gi_14423543_gb_AF387009.1_AF387009 Length = 447 Score = 307 bits (786), Expect = 5e-84 Identities = 160/254 (62%), Positives = 192/254 (74%), Gaps = 1/254 (0%) Frame = +3 Query: 3 YGQEYINRYKMMTRFHHQRVPLVILVCGTACVGKSTIATQLAQRLNLPNVLQTDMVYELL 182 YG+EYINRY MMT+FHHQRVPLVILVCGTACVGKSTIATQLAQRLNLPNVLQTDMVYELL Sbjct: 127 YGEEYINRYNMMTKFHHQRVPLVILVCGTACVGKSTIATQLAQRLNLPNVLQTDMVYELL 186 Query: 183 RTSTDAPLTSSPIWARDFSSSEELITEFCRECRIVRKGLAGDLKKAMKDGKPIIIEGMHV 362 RT+TDAPLTS+P+W R+F SSEELITEFCRECRIVRKGL GDLKKAMKDGKPIIIEG H+ Sbjct: 187 RTATDAPLTSTPVWTREFGSSEELITEFCRECRIVRKGLGGDLKKAMKDGKPIIIEGRHL 246 Query: 363 DPSIYLMDEENKSPHNVPANPQESKADENDMTNVEN-NASTIGAQSEDIHPNAENAKTEA 539 DPSIYLM++ENK+P N P D+T+ +N AS+ + D ++ EA Sbjct: 247 DPSIYLMNDENKTPSNDPEKSSSETNSSKDLTSDKNPEASSSNTKETDNSAVKPHSHEEA 306 Query: 540 ISTQELDKISDDLKSVHIVDHAAGSQNDTTKDQVADKKPTLXREKSGVTEPVIIPIVLKM 719 +++ E + +S+ + I A S++ K + AD + KSG EP++I IVLKM Sbjct: 307 VASVEANNLSEKVTQCTI--DAESSKDAEKKSKSADGS---GKTKSG-PEPIVISIVLKM 360 Query: 720 ADFDHKALLEEWIS 761 ++FDHKALLEEWIS Sbjct: 361 SEFDHKALLEEWIS 374 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,690,832 Number of Sequences: 27288 Number of extensions: 363365 Number of successful extensions: 1287 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1284 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1383666960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB29A20.yg.ab1 (559 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56900.1 putative protein / unnamed ORF - Homo sapiens, EM... 228 2e-60 >At3g56900.1 putative protein / unnamed ORF - Homo sapiens, EMBL:AK000833 Length = 440 Score = 228 bits (581), Expect = 2e-60 Identities = 103/148 (69%), Positives = 126/148 (84%) Frame = +2 Query: 14 GRCTGAAWDPDGRMILVAFSESLTLGSIHFATKPPSLDAHLLPVELPELNSLTNSGGIDK 193 G TGA WDP+GR IL++FS+S TLGS+HF++KPPSLDAHLLPVELPE+ SLT GI+K Sbjct: 291 GSVTGAIWDPEGRFILISFSKSSTLGSVHFSSKPPSLDAHLLPVELPEIASLTGCEGIEK 350 Query: 194 MAWDASGERLAVSYKDGNELYNGLIAIYDVKRATLITPSFIGFIRGPGDDIKPLTFSFHD 373 +AWDASGERLAVSYK G+E Y GLIAIYD +R +++ S +GFIRGPG++ K L+FSFHD Sbjct: 351 IAWDASGERLAVSYKGGDENYKGLIAIYDTRRTPIVSASLVGFIRGPGENPKALSFSFHD 410 Query: 374 KYKQGPLLSVCWSSGICITYPLVIRSHL 457 K+KQGPLLSVCWS+G C TYPL+ RSH+ Sbjct: 411 KFKQGPLLSVCWSTGFCCTYPLIFRSHV 438 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,985,768 Number of Sequences: 27288 Number of extensions: 251421 Number of successful extensions: 641 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 641 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 826050704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB29B16.yg.ab1 (707 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g17690.1 expressed protein / ; supported by cDNA: gi_15810... 241 4e-64 >At1g17690.1 expressed protein / ; supported by cDNA: gi_15810522_gb_AY056300.1_ Length = 754 Score = 241 bits (614), Expect = 4e-64 Identities = 119/196 (60%), Positives = 144/196 (72%), Gaps = 3/196 (1%) Frame = +1 Query: 127 SEGSSSFSAHLDYELSKEEIENLPTKKMKYKHRLEA---ANCKWAATRELNLEDSYSKSP 297 S S+FS HL ++LS EE+E LP K K+K A NCKW T E L+ S +P Sbjct: 175 SSSISAFSEHLSHKLSSEEVETLPKGKWKFKWESPAFDMPNCKWKGTSENFLDGIQSDAP 234 Query: 298 YGLNMKLYDHWLNSYTASGGQDLHSSRQRSFFSLCNSYRDILHHNKKPFYLKGREEDSNI 477 YGL KLY+HWL Y GG+DL SS++R FFS+CNSY DILH NKKPFY G +EDS+ Sbjct: 235 YGLKPKLYNHWLQLYKKCGGKDLDSSKRRKFFSICNSYLDILHSNKKPFYHCGSDEDSSA 294 Query: 478 MDAYLLHSLNHIFKTRDLVTKNDKTMAKQKESKGEEVLNSEKFVDQGFTRPKVLIILPYR 657 MDAYL+HSLNHIFKTRDLV KN+ +AK +E+ EE+L+ + F+DQGFTRPKVLI+LP R Sbjct: 295 MDAYLMHSLNHIFKTRDLVKKNESKIAKHRETSEEEILSDDGFLDQGFTRPKVLILLPLR 354 Query: 658 SIAFRVINRLIQLTPE 705 SIAFRV+ RLIQLTPE Sbjct: 355 SIAFRVVKRLIQLTPE 370 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,853,532 Number of Sequences: 27288 Number of extensions: 267592 Number of successful extensions: 804 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 802 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1236675772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB29E04.yg.ab1 (591 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g07020.1 expressed protein / ; supported by full-length c... 139 8e-34 >At5g07020.1 expressed protein / ; supported by full-length cDNA: Ceres: 17482. Length = 235 Score = 139 bits (351), Expect = 8e-34 Identities = 76/143 (53%), Positives = 89/143 (62%), Gaps = 8/143 (5%) Frame = +2 Query: 14 VAGEKTKVAGTFPPRR-RDWSGYVEKDTAGQTNIYSVEPAVYVAEXXXXXXXXXXXXXXX 190 +AGEKTKV GTFPPR+ R W+GYVEKDTAGQTN+YS+EPAVYVAE Sbjct: 65 LAGEKTKVVGTFPPRKPRGWTGYVEKDTAGQTNVYSIEPAVYVAESAISSGTAGSSADGA 124 Query: 191 ENTAGLVGFGXXXXXXXXXXXXXQVGKN-PPQIQTLDYSGPSLSYYITKFKPAEIVQISV 367 ENTA +V QVGK+ P + + +DYSGPSLSYYI KFKP+EIVQ S Sbjct: 125 ENTAAIVAGIALIAVAAASSILLQVGKDAPTRPKAVDYSGPSLSYYINKFKPSEIVQPST 184 Query: 368 PTAPEP------ETSTPQVESVA 418 P+ E ETS P+ SVA Sbjct: 185 PSVTEAPPVAELETSLPETPSVA 207 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,545,024 Number of Sequences: 27288 Number of extensions: 215056 Number of successful extensions: 656 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 913055448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB29N04.yg.ab1 (579 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22435.1 Expressed protein / ; supported by cDNA: gi_15081... 133 7e-32 At3g22430.1 hypothetical protein / predicted by genmark 52 2e-07 >At3g22435.1 Expressed protein / ; supported by cDNA: gi_15081712_gb_AY048249.1_ Length = 208 Score = 133 bits (334), Expect = 7e-32 Identities = 62/97 (63%), Positives = 74/97 (75%) Frame = +3 Query: 288 MHTYNPETSTSDQVPNHLGLHKALCILMGWNYLMPPDNSKVYQRLSADEIAANLDDLIMW 467 MHTY + S+S +HLGLHKALC+LMGWN+ PDNSK YQ L ADE A N LI+W Sbjct: 1 MHTYCSDDSSSRV--HHLGLHKALCVLMGWNFSKAPDNSKAYQNLPADEAAINQAQLIIW 58 Query: 468 PPHVIIRNTSTGKGKDGRMEGLGNXAMDMKLRDLGFT 578 PPHVI++NTSTGKGK+GRMEG GN MD ++R+LG T Sbjct: 59 PPHVIVQNTSTGKGKEGRMEGFGNKTMDNRIRELGLT 95 >At3g22430.1 hypothetical protein / predicted by genmark Length = 342 Score = 52.0 bits (123), Expect = 2e-07 Identities = 22/44 (50%), Positives = 31/44 (70%) Frame = +3 Query: 120 EVDQEKVKSSFLNFVRAITENANQKNKYLADGKQGALQCLACGR 251 +VDQ +K SFL FV+ + E+ +K YL +G++G LQCL CGR Sbjct: 247 QVDQVALKKSFLGFVKRVFEDPMEKKNYLENGRKGRLQCLVCGR 290 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,080,029 Number of Sequences: 27288 Number of extensions: 263827 Number of successful extensions: 754 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 740 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 754 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 877249352 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB29P09.yg.ab1 (631 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05320.1 unknown protein / 282 1e-76 >At3g05320.1 unknown protein / Length = 445 Score = 282 bits (721), Expect = 1e-76 Identities = 138/211 (65%), Positives = 169/211 (79%), Gaps = 7/211 (3%) Frame = -3 Query: 620 KDAFARAC*PARMXNRSLLMPSLSASLFYKEIDQLEPISFDKVFNFERFNSLCDGFVRVS 441 K AFARAC ARM NR+LLMPSLSASLFYKE+D+L PI FDKVF FERFNSLC GFVR+S Sbjct: 83 KIAFARACLTARMMNRTLLMPSLSASLFYKEVDKLRPIPFDKVFQFERFNSLCSGFVRLS 142 Query: 440 RYSDVGNRSNVIEVQKGSGRRWTLERDLDQLKEFSKRD-YDAYETIRVVGKNPFLWHDHW 264 R+SDV NR+ V +++KGSGRRWT+ERDL+ LK+ ++ + D +E IR++GKNPFLWHDHW Sbjct: 143 RFSDVKNRAQVFDLEKGSGRRWTVERDLEHLKQSARNESIDEFEVIRLIGKNPFLWHDHW 202 Query: 263 PVSDYAKVFECLVLVDEISKEANEVVAKIREFGSEVKNASSSCQT------PYVAIHMRI 102 PV DYAKVFEC+V+VDEIS+EA++VV KIRE G E + A + +T P+VA+HMRI Sbjct: 203 PVEDYAKVFECMVVVDEISREADKVVMKIREAG-EAERAKLASKTEILGPVPFVAVHMRI 261 Query: 101 EKDWMIHCKNRERRSNLTNICSSKEEITTRV 9 E DWMIHCK E+R ++ ICSSK EI RV Sbjct: 262 EIDWMIHCKKLEQRKKISEICSSKREILDRV 292 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,803,732 Number of Sequences: 27288 Number of extensions: 233094 Number of successful extensions: 789 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 786 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1017362904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB29P21.yg.ab1 (607 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66840.1 unknown protein / 82 2e-16 >At5g66840.1 unknown protein / Length = 551 Score = 82.4 bits (202), Expect = 2e-16 Identities = 44/82 (53%), Positives = 57/82 (68%), Gaps = 4/82 (4%) Frame = +1 Query: 1 RIVNESY-SASTEHTFSVEVLWSKWFKKLDPLSILLVKGRNLYQFGTFRQAWESEAERSE 177 ++V ESY +A +HTF++EVLW + +KL PL LLVKGRNLY+ T RQ W +E +R + Sbjct: 182 QVVKESYGTAKQQHTFTIEVLWCEGTQKLPPLYPLLVKGRNLYRLMTLRQRWPNEEDRVK 241 Query: 178 VLKEKHERGKEAR---RKRKWK 234 VL EKH RG AR R+RK K Sbjct: 242 VLNEKHNRGAAARKVMRERKIK 263 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.311 0.129 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,490,558 Number of Sequences: 27288 Number of extensions: 224291 Number of successful extensions: 568 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 567 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 957813068 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB2e06.yg.ab1 (735 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55960.1 putative protein / similar to unknown protein (pi... 259 1e-69 >At5g55960.1 putative protein / similar to unknown protein (pir||T23656); supported by cDNA: gi_16648986_gb_AY059863.1_ Length = 648 Score = 259 bits (661), Expect = 1e-69 Identities = 134/186 (72%), Positives = 152/186 (81%) Frame = +2 Query: 2 VFIWVLYSLITSGSGGVTEQVMCMLPISRSARARCVDVLDKAISGVLLATVEIAFFQGCL 181 +FIWVLY LITS SGGVTEQVM MLPI+ SAR RCV+VLD AISGVLLAT EIAFFQGCL Sbjct: 461 IFIWVLYILITSESGGVTEQVMNMLPINASARNRCVEVLDLAISGVLLATAEIAFFQGCL 520 Query: 182 TWLLFRLFDIHFLYMSTGLAXXXXXXXXXXXXXXXXXVAVELVLEGQYVVAVCLSIIHFV 361 TWLLFRL++IHFLYMST LA A++LVLEG+Y+VAV LS+ H V Sbjct: 521 TWLLFRLYNIHFLYMSTVLAFISALLPIFPYWFATIPAALQLVLEGRYIVAVILSVTHLV 580 Query: 362 LIEYGTTEIQEDIPGNSAYLTGLSIIGGVALFPSAVEGAIMGPLITTVVIALKNLYVEFV 541 L+EYG +EIQ+DIPG++AYLTGLSIIGGV LFPSA+EGAIMGPLITTVVIALK+LY EFV Sbjct: 581 LMEYGASEIQDDIPGSNAYLTGLSIIGGVTLFPSALEGAIMGPLITTVVIALKDLYAEFV 640 Query: 542 LDEQDK 559 L+E K Sbjct: 641 LNEPKK 646 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,250,979 Number of Sequences: 27288 Number of extensions: 276379 Number of successful extensions: 741 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 720 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 740 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB2e11.yg.ab1 (799 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20420.1 succinyl-CoA ligase beta subunit / ;supported by... 459 e-130 >At2g20420.1 succinyl-CoA ligase beta subunit / ;supported by full-length cDNA: Ceres:36904. Length = 421 Score = 459 bits (1182), Expect = e-130 Identities = 229/261 (87%), Positives = 247/261 (93%) Frame = +2 Query: 17 VAGKMLGQTLVTKQTGPQGKVVSKVYLCEKVSLVNEMYFAITLDRTTAGPLIIACREGGT 196 +AGKMLGQ LVTKQTGPQGKVVSKVYLCEK+SLVNEMYF+I LDR +AGPLIIAC++GGT Sbjct: 106 IAGKMLGQVLVTKQTGPQGKVVSKVYLCEKLSLVNEMYFSIILDRKSAGPLIIACKKGGT 165 Query: 197 SIEDLAEKYPDMIIKVPIDVFKGITDEDAAKVVEGLAPKVADKQASIEQVKKLYNLFRES 376 SIEDLAEK+PDMIIKVPIDVF GITDEDAAKVV+GLAPK AD++ SIEQVKKLY LFR++ Sbjct: 166 SIEDLAEKFPDMIIKVPIDVFAGITDEDAAKVVDGLAPKAADRKDSIEQVKKLYELFRKT 225 Query: 377 DCTQLEINPIAETSDNKLIAADAKLNFDDNAAYRQKEIFALRDPTQEDPREVAAAKADLN 556 DCT LEINP+AETS N+L+AADAKLNFDDNAA+RQKE+FA+RDPTQEDPREVAAAK DLN Sbjct: 226 DCTMLEINPLAETSTNQLVAADAKLNFDDNAAFRQKEVFAMRDPTQEDPREVAAAKVDLN 285 Query: 557 YIGLDGEIGCMVNGAGLAMATMDIIKLHGGTPANFLDVGGNASEGQVVEAFKILTSDDKV 736 YIGLDGEIGCMVNGAGLAMATMDIIKLHGGTPANFLDVGGNASE QVVEAFKILTSDDKV Sbjct: 286 YIGLDGEIGCMVNGAGLAMATMDIIKLHGGTPANFLDVGGNASEHQVVEAFKILTSDDKV 345 Query: 737 KANFVNIFGWIMKCDVIASGI 799 KA VNIFG IMKCDVIASGI Sbjct: 346 KAILVNIFGGIMKCDVIASGI 366 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,636,808 Number of Sequences: 27288 Number of extensions: 362314 Number of successful extensions: 1187 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1186 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1476676124 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB30A07.yg.ab1 (739 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67630.1 putative DNA polymerase alpha subunit / similar t... 272 4e-76 >At1g67630.1 putative DNA polymerase alpha subunit / similar to DNA polymerase alpha 70 KD subunit (DNA polymerase subunit B) GB:P33611 [Mus musculus] Length = 620 Score = 272 bits (696), Expect(2) = 4e-76 Identities = 135/227 (59%), Positives = 178/227 (77%), Gaps = 2/227 (0%) Frame = +3 Query: 3 CRYMYDRIEDKFSYLEDRIMKYSEALVASQLYDELVDPSVASQKTIFSVGMICCEEEGRL 182 CR+MYDR ED+FS LE RI+++++A AS LY+E VDP+VASQ++IF+VGMICC+ EG L Sbjct: 207 CRFMYDRTEDRFSALEYRIVRHADAFAASGLYEEQVDPAVASQRSIFAVGMICCDGEGHL 266 Query: 183 KEKPIMLQSSVEHSGGQRVRLELQKLEQFSIFPGQVVGVEGHNPSGHCLIATKIVDYVPL 362 +K I+LQSS E + GQRV ++L++L+QFSIFPGQVVG+EG NPSGH L A+K++D VPL Sbjct: 267 NDKSILLQSSAERTSGQRVPVDLKRLDQFSIFPGQVVGIEGQNPSGHYLTASKLLDSVPL 326 Query: 363 SVPDDT-FRETKRQAVDQDNQX-XXXXXXXXXXXXIIASGPFTTTDNLFFEPLSDLLTYA 536 ++ D KRQ +DQ+ IIASGPFTT+DNL FEPL++LL YA Sbjct: 327 TLTVDVDLPPAKRQILDQEVLVPAEESCQKSEVSFIIASGPFTTSDNLLFEPLNELLAYA 386 Query: 537 RRKQPQLLVLLGPFIDSEHPEIKKGALNKTYDELFRLDVLXRLQDYV 677 +RK PQLLVLLGPF+DSEHPEIKKGA++ T++E+F+++VL +LQDYV Sbjct: 387 KRKPPQLLVLLGPFVDSEHPEIKKGAVDATFNEIFQVEVLRKLQDYV 433 Score = 30.4 bits (67), Expect(2) = 4e-76 Identities = 12/17 (70%), Positives = 15/17 (87%) Frame = +2 Query: 689 GSAARVILVPSVRDAHH 739 GS RV+LVPS+RDA+H Sbjct: 437 GSEVRVVLVPSIRDANH 453 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,081,784 Number of Sequences: 27288 Number of extensions: 305925 Number of successful extensions: 896 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 884 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 895 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1312709680 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB30C12.yg.ab1 (546 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g15380.1 expressed protein / ; supported by cDNA: gi_15028... 50 7e-07 >At3g15380.1 expressed protein / ; supported by cDNA: gi_15028188_gb_AY045917.1_ Length = 700 Score = 50.1 bits (118), Expect = 7e-07 Identities = 18/26 (69%), Positives = 24/26 (92%) Frame = +2 Query: 242 DTHKYKSSHNKITSPLFPVLACWGLG 319 D+H+Y++SHNK++SPL PVLACW LG Sbjct: 618 DSHRYRASHNKVSSPLLPVLACWALG 643 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,219,365 Number of Sequences: 27288 Number of extensions: 223423 Number of successful extensions: 510 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 510 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 790135456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB30F19.yg.ab1 (598 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g02560.1 unknown protein / ; supported by cDNA: gi_20466781 285 1e-77 >At2g02560.1 unknown protein / ; supported by cDNA: gi_20466781 Length = 1219 Score = 285 bits (730), Expect = 1e-77 Identities = 143/193 (74%), Positives = 158/193 (81%) Frame = +1 Query: 1 CLGKIALIKPSKLVPALKERTTSPXXXXXXXXXXXXKYSIVERPEKIDSVLYPEISSFLM 180 CLGK+ALI+P KLVPAL+ RTTSP KYS+VERPEK+D +++P+ISSFLM Sbjct: 954 CLGKMALIEPEKLVPALQVRTTSPAAFTRATVVTAVKYSVVERPEKLDEIIFPQISSFLM 1013 Query: 181 LIKDQDRHVRRAAVLALSTAGHNKPNLIKGXXXXXXXXXYDQTVIKKELIRTVDLGPFKH 360 LIKD DRHVRRAAV ALST H KPNLIKG YDQTVIKKELIRTVDLGPFKH Sbjct: 1014 LIKDGDRHVRRAAVSALSTFAHYKPNLIKGLLPELLPLLYDQTVIKKELIRTVDLGPFKH 1073 Query: 361 TVDDGLELRKAAFECVDTLLDNCLDQLNPSSFIVPYLKSGLDDHYDVKMPCHPILSKLAD 540 VDDGLELRKAAFECV TL+D+CLDQ+NPSSFIVP+LKSGL+DHYD+KM CH ILS LAD Sbjct: 1074 VVDDGLELRKAAFECVFTLVDSCLDQVNPSSFIVPFLKSGLEDHYDLKMLCHLILSLLAD 1133 Query: 541 KCPSAVLTVLDSL 579 KCPSAVL VLDSL Sbjct: 1134 KCPSAVLAVLDSL 1146 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,523,796 Number of Sequences: 27288 Number of extensions: 220820 Number of successful extensions: 546 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 930958496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB30F23.yg.ab1 (458 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g21865.1 unknown protein / supported by full-length cDNA: ... 114 3e-26 >At3g21865.1 unknown protein / supported by full-length cDNA: Ceres:250935. Length = 100 Score = 114 bits (284), Expect = 3e-26 Identities = 54/76 (71%), Positives = 66/76 (86%), Gaps = 1/76 (1%) Frame = +1 Query: 1 VFTFGGLVKDNVLFCTTENGRMSFARQLEPDWHIDSDPEITSQLARFIRHQLHIST-KTE 177 VFT GGLVKD VLFC+TE GR SF RQLEPDWHID++PEI++QLARFI++QLH++T K E Sbjct: 22 VFTSGGLVKDKVLFCSTEIGRTSFVRQLEPDWHIDTNPEISTQLARFIKYQLHVATVKPE 81 Query: 178 RIASNVYSSSSLEQFF 225 R A NV++S S+EQFF Sbjct: 82 RTAPNVFTSQSIEQFF 97 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,976,602 Number of Sequences: 27288 Number of extensions: 197842 Number of successful extensions: 480 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 472 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 479 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 561761912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB30K21.yg.ab1 (741 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74260.1 putative phosphoribosylformylglycinamidine synthase ... 419 e-119 >At1g74260.1 putative phosphoribosylformylglycinamidine synthase / similar to GB:KIAA0361 from [Homo sapiens] Length = 1387 Score = 419 bits (1077), Expect(2) = e-119 Identities = 201/228 (88%), Positives = 213/228 (93%) Frame = +2 Query: 2 RGSFVVASTAGYCVGNLNIEGSYAPWEDASFEYPSHLASPLQILVDASNGASDYGNKFGE 181 RGSFVVAST+GYCVGNLN+EGSYAPWED+SF+YPS+LASPLQIL+DASNGASDYGNKFGE Sbjct: 404 RGSFVVASTSGYCVGNLNMEGSYAPWEDSSFQYPSNLASPLQILIDASNGASDYGNKFGE 463 Query: 182 PLIQGYTRTFGMRLPSGERREWLKPIMFSAGIGQIDHTHITKGEPEIGMLVVKIGGPAYR 361 P+IQGYTRTFGMRLPSG+RREWLKPIMFSAGIGQIDHTHITKGEPE+GMLVVKIGGPAYR Sbjct: 464 PMIQGYTRTFGMRLPSGDRREWLKPIMFSAGIGQIDHTHITKGEPEVGMLVVKIGGPAYR 523 Query: 362 IXXXXXXXXXXXXXQNDAELDFNAVQRGDAEMAQKLYRVVRACIEMGENNPIISIHDQGA 541 I QNDAELDFNAVQRGDAEM+QKLYRVVRACIEMGE NPIISIHDQGA Sbjct: 524 IGMGGGAASSMVSGQNDAELDFNAVQRGDAEMSQKLYRVVRACIEMGEKNPIISIHDQGA 583 Query: 542 GGNCNVVKEIIYPEGATIDIRAIVVGDHTMSVLEIWGAEYQEQDAILV 685 GGNCNVVKEIIYP+GA IDIRA+VVGDHTMSVLEIWGAEYQEQDAILV Sbjct: 584 GGNCNVVKEIIYPQGAEIDIRAVVVGDHTMSVLEIWGAEYQEQDAILV 631 Score = 27.3 bits (59), Expect(2) = e-119 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = +1 Query: 694 SRSLLESVCKRERVSV 741 SR +L+S+CKRER+S+ Sbjct: 635 SREILQSICKRERLSM 650 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,236,289 Number of Sequences: 27288 Number of extensions: 350378 Number of successful extensions: 973 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 940 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 972 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1321579340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB30L19.yg.ab1 (726 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61820.1 putative protein / MtN19, Medicago truncatula, EM... 282 1e-76 >At5g61820.1 putative protein / MtN19, Medicago truncatula, EMBL:MTY15367; supported by cDNA: gi_17529155 Length = 475 Score = 282 bits (722), Expect = 1e-76 Identities = 139/243 (57%), Positives = 169/243 (69%), Gaps = 9/243 (3%) Frame = +1 Query: 1 NAGLCDH-GRSQFFGMGSETRKTPTYVPDPYGIEVGNPLNVPAGYEEKWMFDIHAIDTRG 177 N GLC FFG+GSETR+T TYVPDPY IE+GNP P GYE KW+ +IHAIDTRG Sbjct: 137 NGGLCRSLTLRHFFGLGSETRETSTYVPDPYAIEIGNPEETPDGYEFKWLLNIHAIDTRG 196 Query: 178 AVDAIGCNECRCDLYNVTKDKDGLPLRPNYVGGLHCCYDGTQCKVKNGFKSVE--RNVYF 351 D GC EC CDLYNVT D+ G +RP Y GGL+CCYD TQC+VK+GF + E R +Y Sbjct: 197 VEDKKGCIECLCDLYNVTIDEYGRAIRPGYKGGLYCCYDKTQCRVKSGFDNGEKTRTLYL 256 Query: 352 KYTVKWVDWSDSVVPVKVFIFDVTDTWQ----DTGIHNCLFEYDVEKSATN--NYTNVRK 513 KYTV+WVDW SV+P KV+IFDVTD+W+ D+ H C EY+V+ TN +V+K Sbjct: 257 KYTVRWVDWDSSVLPAKVYIFDVTDSWERSKGDSQEHICHVEYEVKPCKTNGDGCVDVKK 316 Query: 514 SSVSFPTAGDVIYGFAQQYIGGIGSALYGEDGSVICASKPIYGKGIDIGDEAGYIVGMST 693 S+ P G ++YG A Q+ GGIG ALY E+G ICAS P YG G + G+EAGYIVGMS+ Sbjct: 317 KSLVMPFDGYIVYGVAHQHAGGIGGALYRENGEGICASMPKYGNGDEPGNEAGYIVGMSS 376 Query: 694 LYP 702 YP Sbjct: 377 CYP 379 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,832,532 Number of Sequences: 27288 Number of extensions: 378810 Number of successful extensions: 1036 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1002 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1034 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1277231040 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB30M05.yg.ab1 (571 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03510.1 expressed protein / ;supported by full-length cD... 307 2e-84 >At2g03510.1 expressed protein / ;supported by full-length cDNA: Ceres:41585. Length = 356 Score = 307 bits (787), Expect = 2e-84 Identities = 147/181 (81%), Positives = 164/181 (90%) Frame = +1 Query: 28 GGALQKTTTTPGFHLKLPLITHYEPVQVTLQTDTVRDIPCGTKGGVMINFDRIEVVNRLK 207 GGAL T PGFHLKLP IT+YEPVQVTLQTD VRDIPCGTKGGV+I F++IEVVNRL+ Sbjct: 61 GGALLNIITEPGFHLKLPFITNYEPVQVTLQTDQVRDIPCGTKGGVLITFEKIEVVNRLR 120 Query: 208 KESVYDTLLNYGVEYDHTWIYDKIHHEINQFCSAHSLQDVYIDMFDQIDETMKDALQADC 387 K+ VYDTLLNYGV YD+TWIYDKIHHEINQFCS+HSLQ VYID+FDQIDE MKDALQADC Sbjct: 121 KDFVYDTLLNYGVNYDNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDERMKDALQADC 180 Query: 388 TRYAPGIEIISVRVTKPSIPESATRNFEQMEDERTKVLVSVEKQRVAEKDAETLKKIAIT 567 TRYAPGIEI+SVRVTKP IPES RNFEQME+ERTKVL+++EKQRVAEK+AET K +AI+ Sbjct: 181 TRYAPGIEILSVRVTKPKIPESVRRNFEQMEEERTKVLIAIEKQRVAEKEAETKKIMAIS 240 Query: 568 E 570 E Sbjct: 241 E 241 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,527,851 Number of Sequences: 27288 Number of extensions: 282870 Number of successful extensions: 782 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 850394780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB30N01.yg.ab1 (667 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g55270.1 phosphatase - like protein / DUAL SPECIFICITY PRO... 64 7e-11 >At3g55270.1 phosphatase - like protein / DUAL SPECIFICITY PROTEIN PHOSPHATASE 5, Rattus norwegicus, SWISSPROT:DUS5_RAT; supported by cDNA: gi_15450857_gb_AY054509.1_ Length = 534 Score = 63.9 bits (154), Expect = 7e-11 Identities = 33/81 (40%), Positives = 46/81 (56%) Frame = +1 Query: 1 GEELSEFWNALGNDQDREHNMVTRGIVGQRKVVDYDIDFEVFDKAVNSGVVPPLSISGNV 180 G+E +W+A + V + G RKV Y++DFE+F KA+ G VP L+ S N Sbjct: 132 GDEPVYYWDAFASILPMIGGSVIKVQPGDRKVDAYNLDFEIFQKAIEGGFVPTLASSNNE 191 Query: 181 SETCLPARRSGWEILRRKFAT 243 ET LPAR + W L+ KFA+ Sbjct: 192 HETHLPARENSWSSLKCKFAS 212 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.311 0.131 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,241,662 Number of Sequences: 27288 Number of extensions: 265565 Number of successful extensions: 850 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1112118500 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB31A14.yg.ab1 (670 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g12930.1 expressed protein / ;supported by full-length cDN... 245 1e-65 >At3g12930.1 expressed protein / ;supported by full-length cDNA: Ceres:39638. Length = 238 Score = 245 bits (626), Expect = 1e-65 Identities = 115/156 (73%), Positives = 136/156 (86%) Frame = +3 Query: 96 ANASQDTDDMYDDLFKKYGKVVYKSSDQKSPTAEVDDDAECLSFAVALAKIASDVKAADI 275 +N S+DTD+M+DDLF KYGKVV++S+D KSPTAEVDDDAE L+FAV LAK+ASDVKA DI Sbjct: 80 SNVSEDTDEMFDDLFNKYGKVVFRSTDVKSPTAEVDDDAESLAFAVELAKVASDVKAGDI 139 Query: 276 KLLFVKPLVYWTKFFLITTAFSRPQIDAIRNRINDLAEKQYGKFATGDTKANSWTLLDFG 455 K+LFVKPLVYWT+FF+I TAFSRPQIDAI +R+ DLAEK+YGK A GD K NSWTLLDFG Sbjct: 140 KVLFVKPLVYWTRFFIIATAFSRPQIDAIGSRMRDLAEKKYGKVANGDVKPNSWTLLDFG 199 Query: 456 DVVVHIFLPEQREIYNLEEFYANATPIELPFENEQR 563 DVV+H+FLP QR YNLE+FY NA IELPFE++ + Sbjct: 200 DVVIHLFLPPQRTFYNLEDFYGNAMQIELPFEDQSQ 235 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,286,909 Number of Sequences: 27288 Number of extensions: 334381 Number of successful extensions: 955 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 954 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB32A10.yg.ab1 (509 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05930.1 expressed protein / ;supported by full-length cD... 152 9e-38 >At5g05930.1 expressed protein / ;supported by full-length cDNA: Ceres:118390. Length = 274 Score = 152 bits (384), Expect = 9e-38 Identities = 75/115 (65%), Positives = 92/115 (79%) Frame = +1 Query: 1 IDIECRSIKEDELAVLILSGKCLVIALVDQYILSRPWTEDVYVPDIYSSSSGYTGHYIVI 180 I I+CRS+ E++ L+LSG + IALVDQ LS+ W E+V V ++SS+S YTGHY+VI Sbjct: 159 IIIQCRSVSIHEISCLLLSGNYIAIALVDQDKLSKSWLEEVLVSGLHSSNSCYTGHYVVI 218 Query: 181 CGYDALTDEFEIRDPASSRIRETISSRCLEKARKSFGTDEDILLIHLENTDN*NG 345 CGYDA+ DEFEIRDPASS+I E ISS+CLE ARKSFGTDED+LLI+LEN N NG Sbjct: 219 CGYDAVRDEFEIRDPASSKIHERISSKCLENARKSFGTDEDLLLINLENMRNQNG 273 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,638,924 Number of Sequences: 27288 Number of extensions: 188606 Number of successful extensions: 555 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 554 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 693469700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB32B20.yg.ab1 (430 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25660.1 unknown protein / 187 2e-48 >At2g25660.1 unknown protein / Length = 2136 Score = 187 bits (474), Expect = 2e-48 Identities = 97/142 (68%), Positives = 113/142 (79%) Frame = +2 Query: 5 QPSGKEAEVVVKKGTGHLNSKPKLVIRLTDLKLVLGPELRIVYPLILNFAVSGELELNGV 184 Q +GK V +K + KP + IRL+D+KLVLGPELRI+YPLILNFAVSGELEL+G+ Sbjct: 1851 QSTGKSNSV--EKEIEEVKMKPNMDIRLSDMKLVLGPELRIMYPLILNFAVSGELELDGM 1908 Query: 185 AHPKLLKPKGVLMSENGDVNLVATQVRLKREHLNTAKFEADYGLDPMLDLPLVGSEWQFR 364 AHPK +KPKGVL ENGDVNLVATQVRLKREHLN AKFE ++GLDP+LDL LVGSEWQFR Sbjct: 1909 AHPKFIKPKGVLTFENGDVNLVATQVRLKREHLNVAKFEPEHGLDPLLDLALVGSEWQFR 1968 Query: 365 IPSPATKRQARLDVTSPRPAEQ 430 + S A+ Q +L VTS R EQ Sbjct: 1969 VQSRASNWQDKLVVTSTRSVEQ 1990 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,097,359 Number of Sequences: 27288 Number of extensions: 181845 Number of successful extensions: 500 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 500 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 481662092 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB32E05.yg.ab1 (752 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58450.1 putative protein / predicted proteins from D.mela... 108 4e-24 >At5g58450.1 putative protein / predicted proteins from D.melanogaster, C.elegans and S.pombe Length = 1035 Score = 108 bits (269), Expect = 4e-24 Identities = 51/86 (59%), Positives = 67/86 (77%), Gaps = 4/86 (4%) Frame = +2 Query: 95 DLNYSEDY----EVSVTYCYILIQPASSVDMATGCCEYACGKFPNNLELMMGLFSCYVRG 262 +L Y +D +++++ I++Q +D+AT C +ACGK+PNNLELMMGLF+CYVR Sbjct: 137 ELLYKDDLALMDDLTLSTLQIVLQRLDHLDLATSCYAHACGKYPNNLELMMGLFNCYVRE 196 Query: 263 YSFVKQQQIAIKMYKVAGEEKFLLWA 340 YSFVKQQQ AIKMYK+AGEE+FLLWA Sbjct: 197 YSFVKQQQTAIKMYKLAGEERFLLWA 222 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,109,308 Number of Sequences: 27288 Number of extensions: 355998 Number of successful extensions: 805 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1357057980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB32I08.yg.ab1 (576 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55940.1 expressed protein / ;supported by full-length cD... 184 4e-47 >At5g55940.1 expressed protein / ;supported by full-length cDNA: Ceres:33108. Length = 208 Score = 184 bits (466), Expect = 4e-47 Identities = 94/165 (56%), Positives = 121/165 (72%), Gaps = 3/165 (1%) Frame = +1 Query: 88 MNNSNGGDCRYVIDQNAYIKLVLHALKHKTSAVNGVLLGRLSGE---VVEIADSVPLFHS 258 M + G+ +Y I QNAYIKLVLH+L+HKT+AVNGVL+GR+S + VVEI+DSVPLFHS Sbjct: 1 MGMGSNGELKYEISQNAYIKLVLHSLRHKTAAVNGVLVGRISPKDDGVVEISDSVPLFHS 60 Query: 259 SQIGLLPPLEIALITIEEYYSSQGLSIVGYFHANERFDDLELGTVARNIADHVYRYFPQX 438 + + LLPPLEI+LI IEE+Y +QGLSIVGYFHANERFDD+EL VA+NI DH+ RYFPQ Sbjct: 61 N-LALLPPLEISLIMIEEHYVAQGLSIVGYFHANERFDDVELCGVAKNIGDHISRYFPQA 119 Query: 439 XXXXXXXXXXXXXRNNKDMGPVMQLYTRDSSKSWKHVESNGNKRV 573 K+ PVMQL +D+SK+W+ V ++G ++ Sbjct: 120 PILLLNNKKLEALSKGKERSPVMQLCVKDASKNWRVVGADGGSKL 164 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,392,904 Number of Sequences: 27288 Number of extensions: 183591 Number of successful extensions: 421 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 419 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 868297828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB33D05.yg.ab1 (521 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g73990.1 SppA protease IV (SppA) / similar to protease IV ... 119 7e-28 >At1g73990.1 SppA protease IV (SppA) / similar to protease IV GB:AAA57008 from [Escherichia coli]; supported by cDNA: gi_6690269_gb_AF114385.1_AF114385 Length = 388 Score = 119 bits (299), Expect = 7e-28 Identities = 63/102 (61%), Positives = 75/102 (72%) Frame = +3 Query: 3 LVDAIGGFSRAVAIAKHKANIPQDKQVTLVELSRSSPSLPEILXXXXXXXXXXDMTLKQL 182 L+DA+GG SRA+AIAK KANIP +K+VTLVELSR S SLP+IL D TLK L Sbjct: 286 LIDAVGGLSRAIAIAKQKANIPLNKKVTLVELSRPSTSLPDILSGIGSSVIGVDRTLKGL 345 Query: 183 MDGLASSDGVQARMDGIMFQRSEGSSFANPIFNLLKDYLSSL 308 +D L ++GVQARMDGIMFQ+ S A PI ++LKDYLSSL Sbjct: 346 LDELTITEGVQARMDGIMFQQLGRDSLATPIIDMLKDYLSSL 387 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,221,238 Number of Sequences: 27288 Number of extensions: 235042 Number of successful extensions: 551 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 729494100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB33F07.yg.ab1 (387 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26230.1 putative uricase subunit / similar to nodulin-35... 138 2e-38 >At2g26230.1 putative uricase subunit / similar to nodulin-35; identical to GB:Y11120;supported by full-length cDNA: Ceres:38538. Length = 309 Score = 138 bits (347), Expect(2) = 2e-38 Identities = 65/102 (63%), Positives = 78/102 (75%) Frame = +2 Query: 2 TMKNTVYVKAKECKEQVSVEEFAIILAKHFTSFYPQVTTAIVKIVEKPWERISMNGQPHD 181 T+KNTVYVKAKEC +++SVEEFAI++ KHF SFYPQV TAIV I+EKPWER+S++G+PH Sbjct: 65 TIKNTVYVKAKECGDRLSVEEFAILIGKHFCSFYPQVFTAIVNIIEKPWERVSIDGKPHL 124 Query: 182 HGFKLGSEKHTTEVIVQKNXXXXXXXXXXXXXXXKTTQSGFE 307 HGFKLGSE HTTE V+K+ KTTQSGFE Sbjct: 125 HGFKLGSENHTTEARVEKSGALNLTSGIGGLALLKTTQSGFE 166 Score = 36.6 bits (83), Expect(2) = 2e-38 Identities = 16/24 (66%), Positives = 20/24 (82%) Frame = +3 Query: 315 IPDHNTILPDTPERMLATQVSASW 386 + D TILP+T ERMLAT+V+ASW Sbjct: 169 VRDKYTILPETRERMLATEVNASW 192 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,964,917 Number of Sequences: 27288 Number of extensions: 184435 Number of successful extensions: 495 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 495 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 364610080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB33J14.yg.ab1 (237 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02690.1 expressed protein / ;supported by full-length cD... 137 1e-33 >At3g02690.1 expressed protein / ;supported by full-length cDNA: Ceres:35050. Length = 417 Score = 137 bits (344), Expect = 1e-33 Identities = 60/78 (76%), Positives = 69/78 (87%) Frame = +3 Query: 3 GSGEWWMLLAAQSMAVGTVMVRWVSKYSDPVMATGWHMVLGGIPLAALSYLVHDPALNGG 182 GSGEWWMLLAAQSMA+GTVMVRWVSKYSDP+MATGWHMV+GG+PL A+S + HDP NG Sbjct: 271 GSGEWWMLLAAQSMAIGTVMVRWVSKYSDPIMATGWHMVIGGLPLLAISVINHDPVFNGS 330 Query: 183 LSELTANDVFALLYTSVF 236 L +L+ NDV ALLYTS+F Sbjct: 331 LQDLSTNDVIALLYTSIF 348 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,033,417 Number of Sequences: 27288 Number of extensions: 128916 Number of successful extensions: 313 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 310 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 313 length of database: 11,516,596 effective HSP length: 54 effective length of database: 10,043,044 effective search space used: 241033056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB33M23.yg.ab1 (774 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g15980.1 expressed protein / ;supported by full-length cDN... 323 7e-91 >At1g15980.1 expressed protein / ;supported by full-length cDNA: Ceres:122986. Length = 461 Score = 323 bits (827), Expect(2) = 7e-91 Identities = 159/242 (65%), Positives = 189/242 (77%) Frame = +2 Query: 2 VQVDVLSSARGKQAYEMNKNVRWADVIXXXXXXXXXXXXXXFLGLIKNRYYDMMLSTKLA 181 VQVD+L++ RGKQ YE+NKNVRWA+V +GL+K RYYDM+LSTKLA Sbjct: 146 VQVDILTTERGKQTYELNKNVRWANVYDPDDHWPEPAEYTDMIGLLKGRYYDMVLSTKLA 205 Query: 182 GIGHASFLFLSMATERASYIYPNVNSAGAGLLLSETFTPDRLNLSEGGYHMYKQMTDWLA 361 G+GHA+FLF++ A +R SYIYPNVNSAGAGL+LSETFT + NLSE GY MY QM DWL Sbjct: 206 GLGHAAFLFMTTARDRVSYIYPNVNSAGAGLMLSETFTAENTNLSELGYSMYTQMEDWLG 265 Query: 362 RPGRGVPRQEIPPLKVSIPRKVKEVVAEKYKNAGVEKGKYVVIHGIQSDSKASMQSRGDT 541 RP R VPR + PL+VSI RKVKEVVA KY+NAG GK++VIHGI+SDSKASMQS+GD Sbjct: 266 RPFRSVPRTPLLPLRVSISRKVKEVVAAKYRNAGAVTGKFIVIHGIESDSKASMQSKGDA 325 Query: 542 DSLLPLXLWAEITNSIRGVKPLYVIPHXEEREDVGEIVGDDTHILFITTPGQLAALINDS 721 DSLL L WA+I +RG KP++VIPH +ERE+V + VGDDT I+FITTPGQLAALINDS Sbjct: 326 DSLLSLEKWAKIIKGVRGFKPVFVIPHEKERENVEDFVGDDTSIVFITTPGQLAALINDS 385 Query: 722 VG 727 G Sbjct: 386 AG 387 Score = 29.3 bits (64), Expect(2) = 7e-91 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +3 Query: 726 GVISTNTAAVQLARAR 773 GVI+TNTAA+QLA AR Sbjct: 387 GVIATNTAAIQLANAR 402 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,575,496 Number of Sequences: 27288 Number of extensions: 318987 Number of successful extensions: 848 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 847 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB34A12.yg.ab1 (420 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72020.1 expressed protein / ; supported by full-length cD... 110 2e-25 >At1g72020.1 expressed protein / ; supported by full-length cDNA: Ceres: 2031. Length = 97 Score = 110 bits (276), Expect = 2e-25 Identities = 55/72 (76%), Positives = 62/72 (85%), Gaps = 2/72 (2%) Frame = +3 Query: 75 RGFHSTGAKRM--GGHGGHDEPAYLHSKHMYNLDRMKNQKLTMTLGVFTAFSIGVGVPIY 248 R FHSTG K+M GGHGG+DE YLH+KHMYNLDRMK Q L M+LGVFTAFSIGVGVPI+ Sbjct: 27 RSFHSTGVKKMSGGGHGGYDE-YYLHAKHMYNLDRMKYQALKMSLGVFTAFSIGVGVPIF 85 Query: 249 AVIFQQKKTASG 284 AV+FQQ+KT SG Sbjct: 86 AVVFQQRKTQSG 97 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,471,455 Number of Sequences: 27288 Number of extensions: 163328 Number of successful extensions: 496 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 494 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 454398200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB34K10.yg.ab1 (468 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g21760.1 F-box protein family / Contains PF|00646 F-box do... 136 6e-33 >At1g21760.1 F-box protein family / Contains PF|00646 F-box domain. ESTs gb|Z37267, gb|R90412, gb|Z37268 and gb|T88189 come from this gene;supported by full-length cDNA: Ceres:11543. Length = 328 Score = 136 bits (342), Expect = 6e-33 Identities = 61/88 (69%), Positives = 73/88 (82%) Frame = -1 Query: 264 RLRGTTAGANTRMDLLSIVTSGVQESEVPGPDGDILGVVEGWQDDDTHNPEVPAISHTRG 85 RLRGT GAN RMDLLS+VTSGV + E+ + DILG+VEGW+DD+THNP++PA+SH RG Sbjct: 239 RLRGTAIGANNRMDLLSLVTSGVNDEEISSTEEDILGLVEGWEDDETHNPDIPAVSHKRG 298 Query: 84 LTPIVFVPFEEADTSVLNLPVERMDYYV 1 +T VFVPFEE D SVLNLP E+MDYYV Sbjct: 299 MTAFVFVPFEEVDESVLNLPPEKMDYYV 326 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,249,577 Number of Sequences: 27288 Number of extensions: 219741 Number of successful extensions: 542 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 542 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 578136832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB34M20.yg.ab1 (594 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72560.1 putative exportin, tRNA (nuclear export receptor for... 293 5e-80 >At1g72560.1 putative exportin, tRNA (nuclear export receptor for tRNAs) / similar to exportin, tRNA (nuclear export receptor for tRNAs) GB:6005954 [Homo sapiens] Length = 993 Score = 293 bits (750), Expect = 5e-80 Identities = 144/185 (77%), Positives = 168/185 (89%) Frame = +2 Query: 2 FSERLVTASRPAIGLMFKQTLDVLLQILIIFPKVETLRSKVTAFIHRMVETLGSSVFPYL 181 F+ERLVTASRP IGLMFKQTLDVLL++LI FPKVE LRSKVT+FIHRMV+TLGS+VFPYL Sbjct: 671 FNERLVTASRPGIGLMFKQTLDVLLRVLIEFPKVEPLRSKVTSFIHRMVDTLGSAVFPYL 730 Query: 182 PKALEQLLAESEPKELVGFLVLLNQLICKFNTSVQDILENVYPVIGGRIFSILPRDTIPS 361 PKALEQLLA+SEPKE+VGF+VLLNQLICKFN+++ DILE VYPV+ RIF+++PRD +PS Sbjct: 731 PKALEQLLADSEPKEMVGFMVLLNQLICKFNSALHDILEEVYPVVAVRIFNVIPRDGLPS 790 Query: 362 GPGSNTEEIRELQELQRTFYTFLHVMATHDLSSVFLSPKSQGYLDSMMQLLLFTSCNHKD 541 PG+ TEE+REL ELQR YTFLHV+ATHDLSSVFL+PKS+ YLD MMQL+L TSCNHKD Sbjct: 791 RPGAVTEEMRELIELQRMLYTFLHVIATHDLSSVFLTPKSRAYLDPMMQLVLNTSCNHKD 850 Query: 542 LVVRK 556 + VRK Sbjct: 851 ITVRK 855 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,672,769 Number of Sequences: 27288 Number of extensions: 281235 Number of successful extensions: 688 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 687 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 922006972 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB35B01.yg.ab1 (631 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11790.1 expressed protein / supported by full-length cDNA... 125 2e-29 >At4g11790.1 expressed protein / supported by full-length cDNA: Ceres:151415. Length = 443 Score = 125 bits (314), Expect = 2e-29 Identities = 77/149 (51%), Positives = 88/149 (58%), Gaps = 14/149 (9%) Frame = +1 Query: 22 QRAESSRQHVRALNTQFASWVQSQLQNHPDELWEDGVRDYLTHASNILEKFSDVVNWLKS 201 QRAE +R+HVRALN QF SWVQ QL+NHPDELWEDG+ DY+THASNILEKF DVV+WLK Sbjct: 50 QRAELARKHVRALNNQFVSWVQLQLKNHPDELWEDGMNDYITHASNILEKFKDVVSWLKE 109 Query: 202 NSTKSEKLSEPGSHVAQKKLVTDNKGI------TNVPLQEKTSNAPLSGPAS---MFATS 354 N K E LS P S A+ KLV + K N+P S S + S Sbjct: 110 NKGKGENLS-PESRGAENKLVAEVKNTNVKSFSNNIPFASNNQPGIFSNNQSSDFSSSQS 168 Query: 355 GFVSS----WSPRPLG-NSQSTQSSFSFG 426 GF SS +S P G S S SFS G Sbjct: 169 GFFSSQSGAFSSSPSGLISNSQTGSFSSG 197 Score = 77.4 bits (189), Expect(2) = 7e-18 Identities = 53/123 (43%), Positives = 71/123 (57%), Gaps = 6/123 (4%) Frame = +1 Query: 226 SEPGSHVAQKKLVTDNK---GITNVPLQEKTSNAP--LSGPASMFATSGFVSSWSPRPLG 390 S+PG+ + +T N ++ + S+ P LSG + +G +SS +P Sbjct: 221 SQPGTFSSSHSGITSNSQTGSFSSGQFGQTKSSQPSLLSG-----SQAGAISS--NQPSF 273 Query: 391 NSQSTQSSFSFGVQS-SIGVKPDASKDADGDDEAEQPSSPSVKKTEEIGISVVHEVKCKI 567 ++QS F+ V SI K D S DADG DE QPSSPSVKKTEE GI+VVHEVKCK+ Sbjct: 274 QFSNSQSPFTSAVPPVSIPAKQDHSDDADGGDEQSQPSSPSVKKTEEKGITVVHEVKCKL 333 Query: 568 YIK 576 Y+K Sbjct: 334 YVK 336 Score = 30.0 bits (66), Expect(2) = 7e-18 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 588 WKDRGTGQLTIKCK 629 WKD+GTG L IKCK Sbjct: 345 WKDKGTGNLYIKCK 358 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.310 0.126 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,015,049 Number of Sequences: 27288 Number of extensions: 298343 Number of successful extensions: 754 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 753 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1017362904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB35B19.yg.ab1 (611 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g03360.1 hypothetical protein / Similar to hypothetical pr... 306 3e-84 >At1g03360.1 hypothetical protein / Similar to hypothetical protein SPAC2F7.14c gi|1052797 from Schizosaccharomyces pombe cosmid gb|Z50142 Length = 322 Score = 306 bits (784), Expect(2) = 3e-84 Identities = 144/187 (77%), Positives = 169/187 (90%) Frame = -3 Query: 576 NQEDGVLKGHGTTDLDGEVVATVCGVIERVNKLVYVRTLRARYKPEVGDIIVGRVLEVAP 397 N +D LKGHGT+++DGE++ATVCGV+ERV+KLVYVRTLRARYKPEVGDI+VGRV+EVA Sbjct: 47 NHDDAFLKGHGTSEVDGELLATVCGVVERVDKLVYVRTLRARYKPEVGDIVVGRVIEVAQ 106 Query: 396 KRWRLEINFSQDAVLMLSSMNLPDGIQRRRTAVDELNMRSIFEENDVVSAEVRDFMRDGS 217 KRWR+E+NF+QD VLMLSSMN+PDGIQRRRT+VDELNMR+IF E+DVV AEVR+F DGS Sbjct: 107 KRWRVELNFNQDGVLMLSSMNMPDGIQRRRTSVDELNMRNIFVEHDVVCAEVRNFQHDGS 166 Query: 216 LQLQARSQKYGKLERGQLLTISPYLVKRRKQHFHHLEKYGIDLILGCNGFIWVGEHVEVK 37 LQLQARSQKYGKLE+GQLL + PYLVKR K HFH++E GIDLI+GCNGFIWVGEHVEV+ Sbjct: 167 LQLQARSQKYGKLEKGQLLKVDPYLVKRSKHHFHYVESLGIDLIIGCNGFIWVGEHVEVR 226 Query: 36 DDMVEDE 16 D M D+ Sbjct: 227 DPMAIDD 233 Score = 23.1 bits (48), Expect(2) = 3e-84 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 611 NASVTVADSIPVTKKTAF 558 +ASV V DSIPV AF Sbjct: 35 DASVIVTDSIPVNHDDAF 52 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,556,776 Number of Sequences: 27288 Number of extensions: 287986 Number of successful extensions: 808 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 781 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 808 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 963817488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB35F11.yg.ab1 (728 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39680.1 hypothetical protein / 153 1e-37 >At4g39680.1 hypothetical protein / Length = 633 Score = 153 bits (386), Expect = 1e-37 Identities = 118/285 (41%), Positives = 147/285 (51%), Gaps = 43/285 (15%) Frame = +2 Query: 2 KSDSISIDTMSGTEKIELKDNVIAADGEGRVELDVKPEMSFGKVVSDDGKTESVVVNAVV 181 KSD IS D++S EKIELKDN IA + ++E +V VV ES ++ Sbjct: 226 KSDCISTDSVSNNEKIELKDNKIADNV--KLEQNVNKFQEPSTVVG-----ESHPMDVEE 278 Query: 182 PTDKK------DVSIAESGDV---------GSPEKLNLDRSSGDDSMEEDALESKQIESV 316 P ++K D S A + D+ G EKLNLDRSSGD+SME++ E+KQ ES+ Sbjct: 279 PLEQKTSVGGGDDSNAANADMIKENNIIDAGDSEKLNLDRSSGDESMEDEP-ETKQSESI 337 Query: 317 DVMVEDSPAAKITECTKENS----------------DPAVRPIKRKL--HDQEAATNSEV 442 D +AKI +KE S P V KRKL +DQEA N+E Sbjct: 338 ---TSDDKSAKIEMLSKEESRADMDAGKGKSPENKSHPLVASDKRKLPANDQEAVGNNEP 394 Query: 443 VKRQRMLXXX----------XXXXXXXXXXXPMRHRFLKSDSSVSHEEPKERVVXXXXXX 592 KR+R ++ F +SDSSVS + PKERVV Sbjct: 395 AKRRRWNSNSIKVPEAQITNSATPTTTPRSTGLKRDFSRSDSSVSEDGPKERVVPPSPKE 454 Query: 593 XXXXLRIDRFLRPFTLEAVQELLGQTGTVVSFWMDRIKTH*YVTY 727 LRIDRFLRPFTL+AVQELLG+TG V SFWMD IKTH YV+Y Sbjct: 455 PTNSLRIDRFLRPFTLKAVQELLGKTGNVTSFWMDHIKTHCYVSY 499 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,786,965 Number of Sequences: 27288 Number of extensions: 248263 Number of successful extensions: 937 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 887 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 930 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1286100700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB35F18.yg.ab1 (765 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49510.1 von Hippel-Lindau binding protein (VHL binding prote... 282 1e-76 >At5g49510.1 von Hippel-Lindau binding protein (VHL binding protein; VBP) like / ; supported by cDNA: gi_13878182_gb_AF370354.1_AF370354 Length = 195 Score = 282 bits (722), Expect = 1e-76 Identities = 142/170 (83%), Positives = 156/170 (91%) Frame = +3 Query: 21 RGIPAASFVKDVQAYLNQLGLDVNNTLAFLQERLQQYKVVEMKLLAQQRDLQAKIPDIEK 200 RGIPAA F++DV+ YL+Q GLD N+ LAF QERLQQYKVVEMKLLAQQRDLQAKIPDIEK Sbjct: 17 RGIPAAKFIQDVETYLSQSGLDPNSALAFHQERLQQYKVVEMKLLAQQRDLQAKIPDIEK 76 Query: 201 CLDVVATLQAKKDSDEALLTDFEVSEGIYARARIENADSVCLWLGANVMLEYSCEEATTL 380 CL+VVATL+AKK + EALL DFEVSEGIY+RA IE+ DSVCLWLGANVMLEYSCEEA+ L Sbjct: 77 CLEVVATLEAKKGTGEALLADFEVSEGIYSRACIEDTDSVCLWLGANVMLEYSCEEASAL 136 Query: 381 LQNNLENAKASLEVLVADLQFLRDQVTITQVTIARVYNWDVHQRRVKSTS 530 L+NNLENAKASLEVLVADLQFLRDQVT+TQVTIARVYNWDVHQRRVK + Sbjct: 137 LKNNLENAKASLEVLVADLQFLRDQVTVTQVTIARVYNWDVHQRRVKQVT 186 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,509,529 Number of Sequences: 27288 Number of extensions: 306989 Number of successful extensions: 800 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 800 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1392536620 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB36A15.yg.ab1 (489 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15530.1 pyruvate,orthophosphate dikinase / 261 1e-70 >At4g15530.1 pyruvate,orthophosphate dikinase / Length = 960 Score = 261 bits (668), Expect = 1e-70 Identities = 134/178 (75%), Positives = 144/178 (80%), Gaps = 15/178 (8%) Frame = -1 Query: 489 VILGKQQLPPPAMSPDLEIFMSWADQVRRLKVMANADTPNDALTARNNGAQGIXLCRTEH 310 VILGKQ L PPA+SPDLE FMSWAD +RRLKVMANADTP DA+ AR NGAQGI LCRTEH Sbjct: 576 VILGKQALAPPALSPDLETFMSWADAIRRLKVMANADTPEDAIAARKNGAQGIGLCRTEH 635 Query: 309 MF---------------FXSDERIKAVRKMIMXVTLEQRKAALDLLLPYQRSDFEGIFRA 175 M F +RIKAVRKMIM VT EQRKA+LD+LLPYQRSDFEGIFRA Sbjct: 636 MIVCIQMFNVVFGLVFKFFGADRIKAVRKMIMAVTTEQRKASLDILLPYQRSDFEGIFRA 695 Query: 174 MDGLPVTIRLLDPPLHEFLPEGDLDHIVSELTVDTGMTEDEIYSRIEKLSEVNPMLGF 1 MDGLPVTIRLLDPPLHEFLPEGDLD+IV EL +TG+ EDE+ SRIEKLSEVNPMLGF Sbjct: 696 MDGLPVTIRLLDPPLHEFLPEGDLDNIVHELAEETGVKEDEVLSRIEKLSEVNPMLGF 753 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,028,866 Number of Sequences: 27288 Number of extensions: 195410 Number of successful extensions: 532 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 531 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 630427000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB36O01.yg.ab1 (414 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25910.1 expressed protein / ;supported by full-length cD... 156 4e-39 >At2g25910.1 expressed protein / ;supported by full-length cDNA: Ceres:26655. Length = 341 Score = 156 bits (394), Expect = 4e-39 Identities = 75/100 (75%), Positives = 82/100 (82%) Frame = +3 Query: 114 LHDCKRDSEALYFQFNIKLHNVFDTQIAYSLIEEQEGGTKVPDDYISFVGLLADPRYFGI 293 +HDCKRDSEALYFQF I+LHNV DTQIAYSLIEEQEG + DDYISFV LLADPRY GI Sbjct: 113 IHDCKRDSEALYFQFGIRLHNVVDTQIAYSLIEEQEGRRRPLDDYISFVSLLADPRYCGI 172 Query: 294 SYLEKHEATVLLTXDPNFWKYRPLSELMVRAATDDVRLLL 413 SY EK E VL+ DP FW YRP++ELM+RAA DDVR LL Sbjct: 173 SYEEKEEVRVLMRQDPKFWTYRPMTELMIRAAADDVRFLL 212 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,210,530 Number of Sequences: 27288 Number of extensions: 130889 Number of successful extensions: 428 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 407 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 436222272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB37A23.yg.ab1 (697 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11480.1 expressed protein / contains similarity to eukary... 99 2e-21 >At1g11480.1 expressed protein / contains similarity to eukaryotic initiation factor 4B GI:6739515 from [Triticum aestivum]; supported by cDNA: gi_14335083_gb_AY037221.1_ Length = 578 Score = 99.4 bits (246), Expect = 2e-21 Identities = 75/181 (41%), Positives = 101/181 (55%), Gaps = 9/181 (4%) Frame = +3 Query: 3 LVLKERGVDDVAATQDMIQSPNRMK-KDITRAENPPMNPTVTSRQNGKSEPFDHHRTGKT 179 LVLKERG+D+ + Q +RM K I R V+S ++ ++ FD + G+ Sbjct: 405 LVLKERGIDE-PEHHKLDQPTDRMVLKPIERVPEHASQRPVSSPRDMRTRKFDQ-KDGRN 462 Query: 180 IDRREAEKSDAQRRSNWRNDNRKSSRDLEQQQE--RPPSPETWRKPV----DPEPSAGPR 341 + + +S+ QRR NWR + KS+R +Q QE R PSPETWRKPV D G R Sbjct: 463 VS--DIARSETQRR-NWRENENKSARQQQQTQEKTRHPSPETWRKPVPQKLDSPNGTGIR 519 Query: 342 YGKAASAVELAQAFSKSVSDPK--VVAIDRFSSQRGLPGQAQIPFSRLTSQPATRSHING 515 +GKAASA+ELAQA+S SDPK + + + F+ R Q Q PFSRL T ING Sbjct: 520 HGKAASALELAQAYS-PFSDPKSGIGSSNSFNKSRNNQTQQQ-PFSRLVGSTTTGRQING 577 Query: 516 H 518 + Sbjct: 578 Y 578 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,584,806 Number of Sequences: 27288 Number of extensions: 336775 Number of successful extensions: 1145 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1069 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1135 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1201087980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB37B02.yg.ab1 (545 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g36310.1 expressed protein / similar to Yml014wp GB:NP_013... 96 2e-20 >At1g36310.1 expressed protein / similar to Yml014wp GB:NP_013698 from [Saccharomyces cerevisiae];supported by full-length cDNA: Ceres:34418. Length = 404 Score = 95.5 bits (236), Expect = 2e-20 Identities = 40/71 (56%), Positives = 52/71 (72%) Frame = +3 Query: 3 PLHXXXXXXXXXXXXXNGLARKDDSKGAIVYDRYYHVFGQGELESLVSGMKNAVIVDQFY 182 P H +GLA+KDD KGA+VY+RYYHVF +GELE L SG+ NA+IVD+F+ Sbjct: 328 PYHRAEVSGASASALASGLAKKDDRKGAVVYNRYYHVFSEGELERLASGVGNAMIVDRFF 387 Query: 183 DKSNWCVILEK 215 DKSNWC++L+K Sbjct: 388 DKSNWCIVLQK 398 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,413,776 Number of Sequences: 27288 Number of extensions: 230347 Number of successful extensions: 575 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 575 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 790135456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB37M18.yg.ab1 (714 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03450.1 putative protein / 194 3e-50 At5g03750.1 hypothetical protein / 54 6e-08 >At5g03450.1 putative protein / Length = 614 Score = 194 bits (494), Expect = 3e-50 Identities = 103/232 (44%), Positives = 148/232 (63%), Gaps = 4/232 (1%) Frame = +1 Query: 25 AFTLQREFQVDGGRYFDIDASGQLMIVARRQNGTGGTSILSKISLLAPNEREDIHLPAYT 204 +F Q + ++GGR FDID Q+++ ARR +G GGT +L+++SL +P E +DI LP T Sbjct: 259 SFRHQGDLLINGGRIFDIDGGRQILLYARRLSGVGGTFVLTQMSLHSPCEIDDILLPRTT 318 Query: 205 KAVRALCVRPCTR-LALVASLGKKLSIVSTESNNTVVTYDLPASAWSCSWDVDSPYHVYT 381 +A++ L + P LA+ SLGKKLS++S ES+NTV++YDLPA+ WSCSWD+ S +H+Y Sbjct: 319 RAIKDLHLSPHNNGLAVFGSLGKKLSVISLESHNTVLSYDLPAAPWSCSWDLKSSHHIYA 378 Query: 382 GLQNGMVMSFDTRQTKEPLETRIGLSCNPVHTL--ISVAPDXXXXXXXXXXXXQIGICEW 555 GLQNGMV+ FD RQT P + GL+ NPVHT+ +S IG+C+W Sbjct: 379 GLQNGMVLIFDMRQTTGPFASMTGLTTNPVHTVHHLSGNSTPTSDVRTLLSASSIGLCQW 438 Query: 556 NIGSSEERPYLIPESKNEGQACISLAH-SGGDDSVASFRPKIETSTQITVSQ 708 NI SE P L+ E+ N G CIS ++ + VAS+RP++ +S +Q Sbjct: 439 NISGSEGSPSLVSETGNPG-VCISSSYCPRSNHIVASYRPRVGSSDDTVPTQ 489 >At5g03750.1 hypothetical protein / Length = 169 Score = 54.3 bits (129), Expect = 6e-08 Identities = 23/45 (51%), Positives = 33/45 (73%) Frame = +1 Query: 340 SCSWDVDSPYHVYTGLQNGMVMSFDTRQTKEPLETRIGLSCNPVH 474 SCSWD+++ ++VY GLQNGMV+ FD RQ + PL + ++ N VH Sbjct: 41 SCSWDLNNYHNVYAGLQNGMVLVFDMRQNRGPLVSLADVTSNSVH 85 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.132 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,044,607 Number of Sequences: 27288 Number of extensions: 349564 Number of successful extensions: 860 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 858 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1254469668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB37P15.yg.ab1 (660 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g48210.1 putative protein / ;supported by full-length cDN... 139 2e-33 >At3g48210.1 putative protein / ;supported by full-length cDNA: Ceres:38202. Length = 315 Score = 139 bits (349), Expect = 2e-33 Identities = 75/187 (40%), Positives = 115/187 (61%), Gaps = 4/187 (2%) Frame = +3 Query: 6 EDGLVKAIAVKTRQEAKKMAIADSISAVKARNEELHKIVVDQRTRKEEYAQIISRQSEAL 185 ED LVK +AVKTR+EA++M I DSISA ++R E L + + Q+++K++ +IIS+Q +AL Sbjct: 75 EDELVKVLAVKTRKEARQMGIRDSISATQSRIEVLRRNLQLQKSKKDDSVRIISQQLQAL 134 Query: 186 KECEEKHNQDXXXXXXXXXXXSWYNKVLGFRIERGRGIKFIFTHINMKKPDEEYFFTIRL 365 + ++ + SWYN LGF +E G G+KF FT+I+ K+P E+ FT+ Sbjct: 135 SKSKDNAGKVTEDKADIHEAISWYNHALGFHVEAGHGVKFTFTNIDAKRPTREFSFTVHY 194 Query: 366 ENDSYCLLECHPHVTEVNKLVNDLNITNGLYNFVRVMRTKFQEVSAGGNLHEIASH---- 533 ND Y LL+ + +N++V +LN TN L+ FVR+MR +F + L E+ +H Sbjct: 195 GNDIYTLLDSDLQLDYINEMVQELNKTNDLFRFVRLMREQFLK----STLSELPTHSGQL 250 Query: 534 PQETTMI 554 QET+ I Sbjct: 251 QQETSAI 257 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,310,601 Number of Sequences: 27288 Number of extensions: 229196 Number of successful extensions: 638 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 638 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1106605264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB38B13.yg.ab1 (567 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g73090.1 expressed protein / ;supported by full-length cDN... 178 1e-45 >At1g73090.1 expressed protein / ;supported by full-length cDNA: Ceres:1321. Length = 306 Score = 178 bits (452), Expect = 1e-45 Identities = 81/127 (63%), Positives = 101/127 (78%) Frame = +1 Query: 1 INYFKTALFCCVDGQTFGRVIDASVFRGSSRAFAPLYFTVREVNEVMSTEEPCDMAYEFG 180 IN+FK ALF +GQ +GRV V + AF+PLYF V E EVM+TEEPCD+A +FG Sbjct: 179 INFFKMALFRSYNGQIYGRVCGGPVVSTLANAFSPLYFEVTEAMEVMATEEPCDVACKFG 238 Query: 181 DGLLDLQEYPQGFPKPGKHPSPFNDAVVIYVRNVGPGVMVGQAWQEGEDLNQVPKKLCSE 360 DGLL +++YPQGFP+P KHP PFND+VVIY+R++GPGV VGQAWQEG +L QVP++LCS+ Sbjct: 239 DGLLAIEDYPQGFPRPAKHPYPFNDSVVIYIRHIGPGVCVGQAWQEGRELQQVPQRLCSD 298 Query: 361 ILMVKDY 381 ILMVK Y Sbjct: 299 ILMVKQY 305 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,298,254 Number of Sequences: 27288 Number of extensions: 274997 Number of successful extensions: 720 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 720 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 841443256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB38D16.yg.ab1 (695 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g29630.1 putative thiamin biosynthesis protein / ; suppor... 476 e-135 >At2g29630.1 putative thiamin biosynthesis protein / ; supported by cDNA: gi_20260179 Length = 644 Score = 476 bits (1225), Expect = e-135 Identities = 225/231 (97%), Positives = 229/231 (98%) Frame = +2 Query: 2 RHIHETREWILRNSAVPVGTVPIYQALEKVNGIAENLTWEVFRETLIEQAEQGVDYFTIH 181 RHIHETREWILRNSAVPVGTVPIYQALEKV+GIAENL WEVFRETLIEQAEQGVDYFTIH Sbjct: 263 RHIHETREWILRNSAVPVGTVPIYQALEKVDGIAENLNWEVFRETLIEQAEQGVDYFTIH 322 Query: 182 AGVLLRYIPLTAKRMTGIVSRGGSIHAKWCLAYHKENFTYEHWDDILDICNQYDIALSIG 361 AGVLLRYIPLTAKR+TGIVSRGGSIHAKWCLAYHKENF YEHWDDILDICNQYD+ALSIG Sbjct: 323 AGVLLRYIPLTAKRLTGIVSRGGSIHAKWCLAYHKENFAYEHWDDILDICNQYDVALSIG 382 Query: 362 DGLRPGSIYDANDTAQFAELLTQGELTRRAWEKDVQVMNEGPGHIPMHKIPENMQKQLEW 541 DGLRPGSIYDANDTAQFAELLTQGELTRRAWEKDVQVMNEGPGH+PMHKIPENMQKQLEW Sbjct: 383 DGLRPGSIYDANDTAQFAELLTQGELTRRAWEKDVQVMNEGPGHVPMHKIPENMQKQLEW 442 Query: 542 CNEAPFYTLGPLTTDIAPGYDHITSAIGAANIGALGTALLCYVTPKEHLGL 694 CNEAPFYTLGPLTTDIAPGYDHITSAIGAANIGALGTALLCYVTPKEHLGL Sbjct: 443 CNEAPFYTLGPLTTDIAPGYDHITSAIGAANIGALGTALLCYVTPKEHLGL 493 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,732,935 Number of Sequences: 27288 Number of extensions: 350474 Number of successful extensions: 913 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 885 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 913 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1201087980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB38P14.yg.ab1 (751 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g04620.1 unknown protein / 462 e-131 >At1g04620.1 unknown protein / Length = 360 Score = 462 bits (1189), Expect = e-131 Identities = 218/250 (87%), Positives = 238/250 (95%) Frame = +1 Query: 1 RQRSKPIPPGGTYPAKDHCSKCGLCDTYYVAHVKNACAFLGDGMSRVQGLEPVVHGRPRN 180 R++S+PIPPGGTYPAKDHCS+CGLCDTYY+AHVK ACAFLGDGMSR++ LEPVVHGR R Sbjct: 56 REKSRPIPPGGTYPAKDHCSQCGLCDTYYIAHVKEACAFLGDGMSRIESLEPVVHGRGRK 115 Query: 181 PDSLDETYFGVHQELLYARKIHPLPGAQWTGIVTTIAIEMLKSGMVEAVVCVQSDPDDRL 360 DSL +TYFGVHQE LYARK+ P+ GAQWTGIVTTIAIEMLKS MVEAVVCVQSDP+DRL Sbjct: 116 ADSLQDTYFGVHQEQLYARKLKPVEGAQWTGIVTTIAIEMLKSNMVEAVVCVQSDPEDRL 175 Query: 361 SPRPVLARTPEEVLAAKGVKPTLSPNLNTLALVEAAGVKRLLFCGVGCQVQALRSVEQYL 540 SPRPVLARTPEEVLAA+GVKPTLSPNLNTL L+EA+GVKRLLFCGVGCQVQALRSVEQ+L Sbjct: 176 SPRPVLARTPEEVLAARGVKPTLSPNLNTLELIEASGVKRLLFCGVGCQVQALRSVEQHL 235 Query: 541 NLDKLYVLGTNCVDNGTRDGLDKFLRAASEDPETVVHYEFMQDYKVHLKHLDGHIEEVPY 720 NL+KLYVLGTNCVDNGTRDGLDKFL+AAS++PETV+HYEFMQDYKV LKHLDGHIEEVPY Sbjct: 236 NLEKLYVLGTNCVDNGTRDGLDKFLKAASKEPETVLHYEFMQDYKVQLKHLDGHIEEVPY 295 Query: 721 FSLPANDLVD 750 FSLPANDLVD Sbjct: 296 FSLPANDLVD 305 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,963,075 Number of Sequences: 27288 Number of extensions: 373114 Number of successful extensions: 925 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 925 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB39A01.yg.ab1 (668 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03820.1 putative nonsense-mediated mRNA decay protein / ... 369 e-103 >At2g03820.1 putative nonsense-mediated mRNA decay protein / ; supported by cDNA: gi_15810402_gb_AY056240.1_ Length = 516 Score = 369 bits (948), Expect = e-103 Identities = 172/215 (80%), Positives = 194/215 (90%) Frame = +3 Query: 21 AGMFTVQQTVGSVLCCKCGILMAPNAANMCVKCLRSEVDITEGLQKHVIIIHCPECDCYL 200 +GMF VQQT+GSVLCCKCG+ MAPNAANMCV CLRSEVDITEGLQK + I +CPEC CYL Sbjct: 7 SGMFNVQQTIGSVLCCKCGVPMAPNAANMCVNCLRSEVDITEGLQKSIQIFYCPECTCYL 66 Query: 201 QPPRTWLKAQVESKELLTFCVKRLKNLNKVRLIHAEFIWTEPHSKRIKVKLRVQKEVLNG 380 QPP+TW+K Q ESKELLTFC+KRLKNLNKV+L +AEF+WTEPHSKRIKVKL VQ EVLNG Sbjct: 67 QPPKTWIKCQWESKELLTFCIKRLKNLNKVKLKNAEFVWTEPHSKRIKVKLTVQAEVLNG 126 Query: 381 AVLEQAYMVEYVVHDQMCESCSRVQANPDQWVAAVQLRQHVSHRRTFFYLEQLILKHDAA 560 AVLEQ+Y VEY V D +CESCSR QANPDQWVA++QLRQHVSHRRTFFYLEQLIL+HDAA Sbjct: 127 AVLEQSYPVEYTVRDNLCESCSRFQANPDQWVASIQLRQHVSHRRTFFYLEQLILRHDAA 186 Query: 561 VRAIRIKQMDRGIDFFFANRSHAVKFVEFIQKVVP 665 RAIRI+Q+D+GIDFFF N+SHA FVEF++KVVP Sbjct: 187 SRAIRIQQVDQGIDFFFGNKSHANSFVEFLRKVVP 221 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,762,116 Number of Sequences: 27288 Number of extensions: 281208 Number of successful extensions: 836 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 836 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB39D10.yg.ab1 (732 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g21350.1 hypothetical protein / contains similarity to RNA... 279 1e-75 >At3g21350.1 hypothetical protein / contains similarity to RNA polymerase transcriptional regulation mediator GB:AAC26869 from [Homo sapiens]; supported by cDNA: gi_20258922 Length = 257 Score = 279 bits (714), Expect = 1e-75 Identities = 142/224 (63%), Positives = 166/224 (73%), Gaps = 5/224 (2%) Frame = +1 Query: 49 ICFRDQLWLNTYPLDRNLVFDYFALSPFYDYTCNNEQLRMRSIHPLDISHLSKMTGIEFM 228 I FRDQLW+N+YPLDRN +FDYFALSPFYD TCNNE LR RSIHPLD+SHLSKMTG+E+M Sbjct: 36 ISFRDQLWINSYPLDRNYIFDYFALSPFYDTTCNNEILRRRSIHPLDLSHLSKMTGLEYM 95 Query: 229 VSEVMEPHLFVMRKQKRDGPEKVTPMLTYYVLDGSIYQAPQLCNVFSARVGRALYYISKA 408 +++ EP+LFV RKQKRDGPEKVTPMLTYY+LDGSIYQAPQLC+VF+ARV R +Y ISKA Sbjct: 96 LTDATEPNLFVFRKQKRDGPEKVTPMLTYYILDGSIYQAPQLCSVFAARVSRTIYNISKA 155 Query: 409 FTTAASKLEKVGYVDTEDDSTSHEPKAAKETIDFKEVKRVDHTLASLQRKLX-----XXX 573 FT AASKLE + VDTE+ + E K A ET+D KE+KRVD L SL RKL Sbjct: 156 FTDAASKLETIRQVDTENQNEPAESKPASETVDLKEMKRVDVILTSLYRKLAPPPPPPPF 215 Query: 574 XXXXXXXXXXXXSTAEGEQGPETEQADPSVDPILDQGPAKRLKY 705 G QG E++ P VDPI+DQGPAKR+K+ Sbjct: 216 PEGYVSQEALGEKEELGTQGGESQ--PPQVDPIIDQGPAKRMKF 257 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,447,136 Number of Sequences: 27288 Number of extensions: 278529 Number of successful extensions: 740 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 739 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1294970360 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB39G16.yg.ab1 (541 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63220.1 putative protein / similar to unknown protein (re... 147 3e-36 >At5g63220.1 putative protein / similar to unknown protein (ref|NP_057033.1) Length = 316 Score = 147 bits (372), Expect = 3e-36 Identities = 69/108 (63%), Positives = 93/108 (85%) Frame = +1 Query: 7 MAVARAVLMYLSVGNLRDANNIMDGIEKLAEVKGLEFPDSELMRFINYLLQTLMRDALPL 186 +A+ARAVLMYLS+GN++DAN +MD I+K AE K E +S+L++FI+YLL+TL RDALPL Sbjct: 208 LAIARAVLMYLSMGNMKDANFMMDEIKKQAETKNPELSESDLIQFISYLLETLQRDALPL 267 Query: 187 FNTLKQKFSSSIERDPMFNELLEDIGEKFYGVRRKNPLQGMFGELFKM 330 FN L+ K+ SSI+RD + NELL++I E+FYGV+RKNPLQGMFG++FK+ Sbjct: 268 FNMLRVKYKSSIDRDQLLNELLDEIAERFYGVQRKNPLQGMFGDIFKV 315 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,233,580 Number of Sequences: 27288 Number of extensions: 196123 Number of successful extensions: 437 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 437 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 772177832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB39I14.yg.ab1 (683 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g03560.1 putative calcium channel / ; supported by cDNA: g... 228 2e-60 >At4g03560.1 putative calcium channel / ; supported by cDNA: gi_13786068_gb_AF360372.1_AF360372 Length = 733 Score = 228 bits (582), Expect = 2e-60 Identities = 110/191 (57%), Positives = 134/191 (69%), Gaps = 2/191 (1%) Frame = +2 Query: 32 TFISNGEWXXXXXXXXXXXXXXXXMHVQRYRAFVATFLTLIPSLMPYLGTVFCVMCIYCT 211 TF SNGEW M+VQRYRAF+ATF+TLIPSLMPYLGT+FCV+CIYC+ Sbjct: 522 TFFSNGEWIRYLLLARMLRLIRLLMNVQRYRAFIATFITLIPSLMPYLGTIFCVLCIYCS 581 Query: 212 LGIQIFGGIVNAGNPDLPATDLADSDYLLFNFNDFPNGMVTLFNLLVMGNWQIWMQDYVA 391 +G+Q+FGG+VNAGN L T+LA+ DYLLFNFND+PNGMVTLFNLLVMGNWQ+WM+ Y Sbjct: 582 IGVQVFGGLVNAGNKKLFETELAEDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWMESYKD 641 Query: 392 LTGTSWTYAYFVSFYLITVLFLLNLIVXXXXXXXXXXXXXXXXXXXXGKKIGVR--GRRN 565 LTGT W+ YFVSFY+IT+L LLNL+V G+ + RR+ Sbjct: 642 LTGTWWSITYFVSFYVITILLLLNLVVAFVLEAFFTELDLEEEEKCQGQDSQEKRNRRRS 701 Query: 566 MGTKTRSQRVD 598 G+K+RSQRVD Sbjct: 702 AGSKSRSQRVD 712 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,332,391 Number of Sequences: 27288 Number of extensions: 263726 Number of successful extensions: 601 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 600 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1165500188 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB39J02.yg.ab1 (637 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g04390.1 hypothetical protein / predicted by genscan 199 1e-51 >At1g04390.1 hypothetical protein / predicted by genscan Length = 849 Score = 199 bits (506), Expect = 1e-51 Identities = 91/212 (42%), Positives = 138/212 (64%), Gaps = 1/212 (0%) Frame = +1 Query: 4 ALLKLLEYVYSGHLTATDDLVKRLKTLAKHCNLQPLLQTLCRNRPKWRTPFPTFDLTSAL 183 AL+KLLE+ YSG++ +K+LK LAKHC + LLQ LCR RPKW + P D+ AL Sbjct: 588 ALVKLLEFAYSGYVEVESTTLKKLKPLAKHCKAKVLLQMLCRRRPKWGSSIPEIDIPLAL 647 Query: 184 GPNGFCFSDIVLEAKGNAFENWKCESCALSQPHLHAHKAILCASSDHMRALLCSGMQESQ 363 P FSD++L K + C C+L+ PH H+H+ IL + +++RAL SGMQES Sbjct: 648 TPKLIHFSDVILVPKETNVACFNCRMCSLTSPHAHSHRVILSSGCEYLRALFRSGMQESH 707 Query: 364 SETIKIDLGWNALVRLVNWLYSGKLVPKPKYSCLWNNLDEQGKLEQVTPYVELYCLSDSW 543 + + + + W L +LV+W YS +L PKP C WNN+D + KL+++ YVE+Y LS+ W Sbjct: 708 LDRLNVPVSWLGLTKLVSWFYSDEL-PKPPSGCKWNNMDTEAKLDELQAYVEIYSLSEWW 766 Query: 544 LLEDLHKECSKVIVNCLDSV-NMAVKLIQIGA 636 ++E+L +C+ VI++CL+S +++K I++ A Sbjct: 767 IMEELQNDCAHVILSCLESARELSIKTIELAA 798 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,604,555 Number of Sequences: 27288 Number of extensions: 255702 Number of successful extensions: 916 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 913 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB39J24.yg.ab1 (715 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58020.1 putative protein / protein x 0001, Homo sapiens, ... 254 4e-68 >At5g58020.1 putative protein / protein x 0001, Homo sapiens, EMBL:AF117231 Length = 354 Score = 254 bits (648), Expect = 4e-68 Identities = 119/170 (70%), Positives = 142/170 (83%), Gaps = 3/170 (1%) Frame = +2 Query: 2 AESRDCYLNMYADKKPDKVDPNEQRLSKWLNCALSNEPLKRPIVVDYLGNVFNKQALVEA 181 AESRDCYLNMYA+KKPDKVDPNEQRLSKWLNCALSNEPL P V+D LGN+FNK+ LV A Sbjct: 93 AESRDCYLNMYAEKKPDKVDPNEQRLSKWLNCALSNEPLAEPCVIDLLGNLFNKEVLVHA 152 Query: 182 LLKKNVPKAFGYIKGLKDMISVELESIPGTEGADSD---VKFQCPVTGLEFNGKYKFYAL 352 LL K +PK F YIKGLKDM++++L + G++G+ D +FQCPV+GLEFNGKYKF+AL Sbjct: 153 LLSKRLPKQFSYIKGLKDMVNIKLTPVAGSDGSSQDTTSAQFQCPVSGLEFNGKYKFFAL 212 Query: 353 KSCGHVLSAKALKEIKSSSCHVCRKEFAEADKIVINGNEEEVIALREKME 502 + CGHV+SAKALKE+KSSSC VC + ++DKIVING EEEV LRE+ME Sbjct: 213 RGCGHVMSAKALKEVKSSSCLVCHADVKDSDKIVINGTEEEVDLLRERME 262 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,679,902 Number of Sequences: 27288 Number of extensions: 223669 Number of successful extensions: 933 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 861 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 928 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1254469668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB39O14.yg.ab1 (625 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g28460.1 unknown protein / ; supported by cDNA: gi_18389225 200 4e-52 >At3g28460.1 unknown protein / ; supported by cDNA: gi_18389225 Length = 314 Score = 200 bits (509), Expect = 4e-52 Identities = 98/140 (70%), Positives = 114/140 (81%), Gaps = 5/140 (3%) Frame = +1 Query: 1 GLMACSRGCSEAHFVEMDPWVVSDVLRPNLEWTGFLDNSVIHTVRVETFLERT-----KG 165 G+ A SRGCSEAHFVEMDPWVVS+VL+PNLE TGF+D SVIHT RVE FLER K Sbjct: 175 GIEAISRGCSEAHFVEMDPWVVSNVLQPNLEHTGFVDASVIHTARVENFLERADKLVGKD 234 Query: 166 DPFDYISVTPPYMLVDYEILMKQISESAVIGDDSFIVVEYPFRTDMHETCGCLVKLADRR 345 FDYISVTPPYM VDYE+LM QI++S IG+++FI+VEYP RT M ++CGCL K+ DRR Sbjct: 235 GVFDYISVTPPYMEVDYEVLMDQIAKSPAIGENTFILVEYPSRTTMLDSCGCLEKMTDRR 294 Query: 346 FGRTNLAIYGPKWAQKKGRS 405 FGRT+LAIYGPKWAQK +S Sbjct: 295 FGRTHLAIYGPKWAQKPRKS 314 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,839,281 Number of Sequences: 27288 Number of extensions: 299081 Number of successful extensions: 740 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 738 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 999514432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB3d07.yg.ab1 (649 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g22940.1 phosphomethylpyrimidine kinase / probable thiamin... 272 2e-77 >At1g22940.1 phosphomethylpyrimidine kinase / probable thiamin biosynthetic enzyme, location of EST gb|AA395737, gb|T21651 Length = 525 Score = 272 bits (695), Expect(2) = 2e-77 Identities = 137/191 (71%), Positives = 150/191 (77%), Gaps = 1/191 (0%) Frame = +1 Query: 4 QGPFDHMFXXXXXXXXXX-XXFEPSDLFLYAVTDSGMNKKWGHSITDAVKVFIEGGATIV 180 QGPFDH F F P DLFLYAVTDS MNKKW SI DA+K IEGGATI+ Sbjct: 293 QGPFDHFFGLKKDPQSSRCSIFNPDDLFLYAVTDSRMNKKWNRSIVDALKAAIEGGATII 352 Query: 181 QLREKDAETGEFLEAAKSCLEICRAHNIPLLINDRVDIALACDADGVHVGQSDMPVNTVR 360 QLR FLE AK+C++ICR+H + LLINDR+DIALACDADGVHVGQSDMPV+ VR Sbjct: 353 QLR-----FDHFLEEAKACIDICRSHGVSLLINDRIDIALACDADGVHVGQSDMPVDLVR 407 Query: 361 ALLGPEKIIGVSCKTPEHALKAWADGADYIGSGGVFPTNTKANNRTIGLDGLKTVCLALK 540 +LLGP+KIIGVSCKTPE A +AW DGADYIGSGGVFPTNTKANNRTIGLDGLK VC A K Sbjct: 408 SLLGPDKIIGVSCKTPEQAHQAWKDGADYIGSGGVFPTNTKANNRTIGLDGLKEVCEASK 467 Query: 541 LPVVAIGGINL 573 LPVVAIGGI + Sbjct: 468 LPVVAIGGIGI 478 Score = 35.0 bits (79), Expect(2) = 2e-77 Identities = 17/24 (70%), Positives = 20/24 (82%) Frame = +3 Query: 576 NARSVMELGVVNLEGVAVVSALFD 647 NA SVM++ NL+GVAVVSALFD Sbjct: 480 NAGSVMQIDAPNLKGVAVVSALFD 503 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,024,188 Number of Sequences: 27288 Number of extensions: 347749 Number of successful extensions: 801 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 798 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1070908320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB41H12.yg.ab1 (692 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g50380.1 putative protein / hypothetical protein KIAA0453 ... 262 1e-70 >At3g50380.1 putative protein / hypothetical protein KIAA0453 (fragment), Homo sapiens, PIR:T00067 Length = 3071 Score = 262 bits (669), Expect = 1e-70 Identities = 137/232 (59%), Positives = 171/232 (73%), Gaps = 13/232 (5%) Frame = +2 Query: 20 VAGGFQQGILKLAMEPSVLGSAFTEGGPDRKIKLDRNPGVDELYIEGYLQAMLDTMYKHE 199 + GF GILKLAMEPSV+G+A EGGPDR IKLDRNPG+DELYIEGYLQAMLDTMY+ E Sbjct: 2837 LVSGFHHGILKLAMEPSVIGTALMEGGPDRTIKLDRNPGIDELYIEGYLQAMLDTMYRQE 2896 Query: 200 YLRVRVIDDQVVLKNMPPNSVLIDEIMDHVKGFLVSKGLLTGE-TSSYSLRHLRVQNEWR 376 YLRV+VIDDQV LKN+PP++ LIDE++D VK FL S+GLL G+ +SS R L EW+ Sbjct: 2897 YLRVKVIDDQVFLKNLPPSNSLIDEMIDRVKDFLESRGLLKGDPSSSRPRRRLHGDKEWK 2956 Query: 377 IVPTVLTLCEHLFVNFAIGWLRKQAGDLSSKIK------WDDKFKVGAKKAI------TK 520 I PTVLTLCEHLFV+FAI L++ A + ++ + G+ A+ K Sbjct: 2957 IGPTVLTLCEHLFVSFAIRILKQHATKAITSLRPKKEEAEAETSDSGSNTAMVPVVSDNK 3016 Query: 521 QETRVSVWKWGVGRFVFAGIVAYVDGRLCRSIPNPVARRIVSGFVLSFLDRT 676 ++ +WK G+G FV +GIVAY+DGRLCR IPNP+ARRIVSGF+LSFLD++ Sbjct: 3017 KKKMKFMWKAGIGNFVASGIVAYIDGRLCRQIPNPIARRIVSGFLLSFLDKS 3068 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,971,629 Number of Sequences: 27288 Number of extensions: 361148 Number of successful extensions: 962 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 936 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 958 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1192191032 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB41L05.yg.ab1 (506 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24690.1 putative protein / ; supported by cDNA: gi_17065... 124 2e-29 >At4g24690.1 putative protein / ; supported by cDNA: gi_17065501 Length = 704 Score = 124 bits (312), Expect = 2e-29 Identities = 57/81 (70%), Positives = 70/81 (86%) Frame = +1 Query: 7 LVKELEEMGFKQLDLNTEVLRMNDYELEKSIDDLCGVLEWDPMLDELQEMGFADTEANRR 186 ++KELEEMGFK++DLN E+LR N+Y LE+S+D LCGV EWDP+L+ELQEMGF D N+R Sbjct: 622 MLKELEEMGFKEIDLNKEILRDNEYNLEQSVDALCGVSEWDPILEELQEMGFCDDVTNKR 681 Query: 187 LLKKNNGSIKRVVMDLINGER 249 LLKKNNGSIK VVMDL+ GE+ Sbjct: 682 LLKKNNGSIKGVVMDLLTGEK 702 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,389,004 Number of Sequences: 27288 Number of extensions: 289828 Number of successful extensions: 986 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 981 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 684463600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB42A09.yg.ab1 (423 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g34050.1 expressed protein / ;supported by full-length cDN... 154 2e-38 >At2g34050.1 expressed protein / ;supported by full-length cDNA: Ceres:23892. Length = 248 Score = 154 bits (389), Expect = 2e-38 Identities = 71/93 (76%), Positives = 83/93 (88%) Frame = +1 Query: 22 TGLEDYKARGTQAAPYFTVSHYKEFAETKDLVLIRGDIVFASKLTDSEAKWLLETAQSFY 201 TGLEDYKARGTQAAPY T + Y E +ETKDLV IRGD+VF SKLTD EAKW++ETAQSFY Sbjct: 156 TGLEDYKARGTQAAPYLTTTFYTELSETKDLVFIRGDVVFTSKLTDEEAKWIMETAQSFY 215 Query: 202 LNDTRYKLVERFNKKTSEFDFKDVLRALDMPMM 300 LND+RYKL+ERFNK T +F+FKDVL+ALDMP++ Sbjct: 216 LNDSRYKLLERFNKHTHDFEFKDVLQALDMPLL 248 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,211,953 Number of Sequences: 27288 Number of extensions: 154741 Number of successful extensions: 371 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 371 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 463486164 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB42C02.yg.ab1 (449 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02100.1 hypothetical protein / predicted by genscan; supp... 95 2e-20 >At1g02100.1 hypothetical protein / predicted by genscan; supported by cDNA: gi_18377693 Length = 332 Score = 94.7 bits (234), Expect = 2e-20 Identities = 42/68 (61%), Positives = 56/68 (81%) Frame = +3 Query: 3 MLKIYTSFIEPQERQRIERVELFDEFEEWYMMQEHYCVACAINDAMGMFENFGFPKDQPV 182 MLK+Y SF++ QE++RIER+ELFDEFEEW+MMQEHYCV A+NDAMG+F +FGF ++ Sbjct: 263 MLKVYGSFVDTQEKRRIERLELFDEFEEWHMMQEHYCVTYAVNDAMGIFGDFGFTREGGG 322 Query: 183 TGASTTAS 206 S++AS Sbjct: 323 ERMSSSAS 330 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,756,472 Number of Sequences: 27288 Number of extensions: 200780 Number of successful extensions: 512 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 534579884 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB42D13.yg.ab1 (678 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66130.1 AtRAD17 (dbj|BAA90479.1) / ; supported by cDNA: ... 226 6e-60 >At5g66130.1 AtRAD17 (dbj|BAA90479.1) / ; supported by cDNA: gi_6855471_dbj_AB030250.1_AB030250 Length = 599 Score = 226 bits (577), Expect = 6e-60 Identities = 121/242 (50%), Positives = 153/242 (63%), Gaps = 16/242 (6%) Frame = +1 Query: 1 ACKVTFNPITVNSMAKTLSKICRVEKVRVTADQIDVIAKASGGDIRHAVTSMQYLCLKSG 180 A KV FNPIT NS+ K L +ICR E +VT +ID +A ASGGDIRHA+TS+Q +K Sbjct: 282 ALKVAFNPITKNSIKKVLQRICREEHCKVTTMEIDQMATASGGDIRHAITSLQLFSVKPE 341 Query: 181 -----------SIEKGPHKIDY-----LEDGCSLPFGRDETLSLFHALGKFLHNKRDTEN 312 +E H + L+ G S FGRDETLSLFHALGKFLHNKR+T+N Sbjct: 342 LNHTKIKSPRPGMEDNYHGNEQTMYSGLDSGISSCFGRDETLSLFHALGKFLHNKRETDN 401 Query: 313 STASDADSLLIKEDFARLPMKMDAPERVLGQAHGQARPIADFLQENVLDFVHEEAMDDAW 492 S+ S L+ ++FARLP+KMDAPE+VL QAHGQA + DFL ENVLDFV + A++DAW Sbjct: 402 VIISECSSSLVHDEFARLPLKMDAPEKVLSQAHGQAGRVVDFLHENVLDFVSDGAIEDAW 461 Query: 493 MATXXXXXXXXXXXXXXGAQYRNYVAENIIQSTAASVAVRGVMFGNRHPLSARWHAIRRP 672 + G + E++ QS ASVAVRGV++GN+ P S+RWH IR+P Sbjct: 462 CVSSYLADADLLLADIRGKMSGHNNTEDVPQSAGASVAVRGVLYGNKQPCSSRWHVIRKP 521 Query: 673 TL 678 L Sbjct: 522 KL 523 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,213,904 Number of Sequences: 27288 Number of extensions: 332333 Number of successful extensions: 808 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 807 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1147706292 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB42E09.yg.ab1 (491 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g37990.1 expressed protein / ;supported by full-length cD... 117 4e-27 >At2g37990.1 expressed protein / ;supported by full-length cDNA: Ceres:40538. Length = 318 Score = 117 bits (292), Expect = 4e-27 Identities = 53/103 (51%), Positives = 73/103 (70%) Frame = +3 Query: 15 PITGTQAAPRKVSKDELQNVXXXXXXXXXXXXKFDKKLAGEKPPKHDKKYRKFLPVVEGS 194 PI+GT+A P+K+ KDEL +V KFDKKL GEKPPK K+ K+LPVV G Sbjct: 194 PISGTKAQPKKIGKDELGDVAGLAATSTASGGKFDKKLPGEKPPKKQGKHHKYLPVVSGR 253 Query: 195 GMGSLEKQQSDKILNKLMAKNSHEIFNVGKAVDMYNAKSDKKR 323 G + EK+Q++ +L+K+ +K+SHEI NVGKA++MYN K +KK+ Sbjct: 254 GDVNAEKEQTNNVLSKIFSKHSHEILNVGKAINMYNVKKEKKK 296 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,346,347 Number of Sequences: 27288 Number of extensions: 220296 Number of successful extensions: 549 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 549 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 639433100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB42E14.yg.ab1 (738 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g64250.1 2-nitropropane dioxygenase-like protein / ;suppo... 337 4e-93 >At5g64250.1 2-nitropropane dioxygenase-like protein / ;supported by full-length cDNA: Ceres:207555. Length = 293 Score = 337 bits (864), Expect = 4e-93 Identities = 162/215 (75%), Positives = 189/215 (87%) Frame = +1 Query: 1 VKVVPQIGSIEEAKHAADAGVDAIIVQGHEAGGHVIGQEALTALVPRVVDLVGSKGIPVI 180 VKV+PQ+G++EEA+ A GVDAIIVQG EAGGHVIG++ L +L+PRVVDLVG + IPVI Sbjct: 69 VKVIPQVGNVEEARKAVAVGVDAIIVQGREAGGHVIGKDGLFSLLPRVVDLVGERDIPVI 128 Query: 181 AAGGIVDERGYVAALALGAQGVCLGTRFLATEESYAHPEYKKKLVEMSETEYTNVYGRAR 360 AAGGIVD RGYVAAL+LGAQGVCLGTRF+AT ESYAHP YK+KL+E +TEYT+V+GRAR Sbjct: 129 AAGGIVDGRGYVAALSLGAQGVCLGTRFVATHESYAHPIYKRKLIEYEKTEYTDVFGRAR 188 Query: 361 WPGAPQRVLKTPFFLEWRNLPNHENEANQPVIGRSTIHGMEKEIRRFAGTVPNKTTTGDI 540 WPGAPQRVL+TPFF +WR+LP HENE NQP+IGRSTIHG+EKEIRRF+GTVPN TTTGD+ Sbjct: 189 WPGAPQRVLETPFFDDWRSLPAHENEVNQPIIGRSTIHGVEKEIRRFSGTVPNMTTTGDL 248 Query: 541 ENMVMYASEGVGLINEILPAAQVVKRLVEGAQTLI 645 E+M MYA + VGLI EILPA +VVK LVE AQ LI Sbjct: 249 ESMAMYAGQSVGLIKEILPAGEVVKSLVEEAQALI 283 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,799,922 Number of Sequences: 27288 Number of extensions: 354831 Number of successful extensions: 1055 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1020 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1054 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1312709680 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB42I02.yg.ab1 (755 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g40740.1 putative protein / ; supported by cDNA: gi_14532... 216 1e-56 At3g17840.1 leucine-rich repeat transmembrane protein kinase, pu... 53 2e-07 At1g48480.1 leucine-rich repeat transmembrane protein kinase, pu... 51 6e-07 >At5g40740.1 putative protein / ; supported by cDNA: gi_14532693_gb_AY039971.1_ Length = 741 Score = 216 bits (550), Expect = 1e-56 Identities = 112/136 (82%), Positives = 119/136 (87%), Gaps = 5/136 (3%) Frame = +2 Query: 266 MTMDREKERETELESAMYTNCLLLGLDPSIIN-GANNGAPRVGNFRHSNPKLGEQLLYFI 442 MTMDREKERE ELESAMYTNCLLLGLDP++I GA+NG PRVG FRHSNPKLGEQLLYFI Sbjct: 1 MTMDREKERELELESAMYTNCLLLGLDPNVIGLGASNGTPRVGLFRHSNPKLGEQLLYFI 60 Query: 443 LSSLRGP----KDFDKVWPIFDSTQSRDFRKVVQSIISELESQGALPRSNSRVSSLATCC 610 LSSLRGP KDFDKVWPIFDS QSRDFRKVVQ+IISELESQGALPRSNSRVSSLATCC Sbjct: 61 LSSLRGPAQSSKDFDKVWPIFDSAQSRDFRKVVQAIISELESQGALPRSNSRVSSLATCC 120 Query: 611 GPRLVSIWIRL*IQML 658 GPR V + +L + L Sbjct: 121 GPRFVELLWQLSLHAL 136 >At3g17840.1 leucine-rich repeat transmembrane protein kinase, putative / similar to receptor kinase GB:AAA33715 from [Petunia integrifolia];supported by full-length cDNA: Ceres:22221. Length = 647 Score = 53.1 bits (126), Expect = 2e-07 Identities = 23/36 (63%), Positives = 30/36 (82%) Frame = -3 Query: 126 DLAADRSAILSIRSAVGGRSILWNISQPATPCTWPG 19 DLAAD+SA+LS RSAVGGR++LW++ Q +PC W G Sbjct: 30 DLAADKSALLSFRSAVGGRTLLWDVKQ-TSPCNWTG 64 >At1g48480.1 leucine-rich repeat transmembrane protein kinase, putative / contains similarity to many predicted protein kinases; supported by cDNA: gi_13430527_gb_AF360176.1_AF360176 Length = 655 Score = 51.2 bits (121), Expect = 6e-07 Identities = 23/38 (60%), Positives = 29/38 (75%) Frame = -3 Query: 126 DLAADRSAILSIRSAVGGRSILWNISQPATPCTWPGYR 13 DL ADR+A+LS+RSAVGGR+ WNI Q +PC W G + Sbjct: 32 DLNADRTALLSLRSAVGGRTFRWNIKQ-TSPCNWAGVK 68 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,670,833 Number of Sequences: 27288 Number of extensions: 264090 Number of successful extensions: 775 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 772 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB42I06.yg.ab1 (636 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g51050.1 putative protein / hypothetical protein L1648.04 ... 335 1e-92 >At3g51050.1 putative protein / hypothetical protein L1648.04 - Leishmania major, EMBL:LMFL1648; supported by cDNA: gi_18087607 Length = 698 Score = 335 bits (859), Expect = 1e-92 Identities = 157/213 (73%), Positives = 187/213 (87%), Gaps = 1/213 (0%) Frame = +1 Query: 1 GGNGAEQTVVSGSMEVLKPCWAVATSGVPVREQLFNGSICHRSHFNFIPHG-EYSRTFGR 177 GGN E+TVVSGSMEVLKPCWAVATSGVP+REQLFN SICH S FNF+ +G +YSR F + Sbjct: 443 GGNVGERTVVSGSMEVLKPCWAVATSGVPIREQLFNVSICHHSPFNFLHYGGDYSRHFAQ 502 Query: 178 AVDVSSLEVATPILIPTNDGHKHRKGSHGDIVFLTNRGEVTAYSPGLHGHEAVWQWQLLT 357 A D S+LE+ATPILIP +DGHKHRKGSHGD++FLTNRGEVT+Y+P +HGH+AVWQWQL T Sbjct: 503 ARDTSTLEIATPILIPRDDGHKHRKGSHGDVIFLTNRGEVTSYTPDVHGHDAVWQWQLQT 562 Query: 358 GATWSNLPSPAGMMDAGYVIPSLKPFNLRMHDNQHLILAAGDQEAVVISAGGSQLTSIDL 537 ATWSNLPSP+G+ ++G V+P+LKPF+LR+HDNQ +ILA GDQ AV+IS GGS L SI+L Sbjct: 563 EATWSNLPSPSGLTESGTVVPTLKPFSLRIHDNQPMILAGGDQAAVIISPGGSILASIEL 622 Query: 538 PAPPTHALVDADFSNDGLTDLIVVTSNGVYGFV 636 P+ PTHAL+ DFSNDGLTD+IV+TSNGVYGFV Sbjct: 623 PSQPTHALITDDFSNDGLTDVIVMTSNGVYGFV 655 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,821,539 Number of Sequences: 27288 Number of extensions: 329324 Number of successful extensions: 806 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 790 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB42L07.yg.ab1 (349 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05570.1 putative protein / similar to unknown protein (pi... 57 2e-09 >At5g05570.1 putative protein / similar to unknown protein (pir||T04661) Length = 1124 Score = 56.6 bits (135), Expect = 2e-09 Identities = 27/57 (47%), Positives = 34/57 (59%) Frame = +2 Query: 5 GDTAAVALEAKDKLLERQMXXXXXXXXXXXXASGSENFASLAGELVKQMENRKWWQL 175 G+T+A+A +AKDKL ER +ENFAS+A EL KQME RKWW + Sbjct: 1068 GETSAIASQAKDKLHERGEKLERISQRTAELQDNAENFASMAHELAKQMEKRKWWNI 1124 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,058,117 Number of Sequences: 27288 Number of extensions: 91977 Number of successful extensions: 134 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 216801312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB4d05.yg.ab1 (671 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26800.1 putative hydroxymethylglutaryl-CoA lyase / ; sup... 275 2e-74 >At2g26800.1 putative hydroxymethylglutaryl-CoA lyase / ; supported by cDNA: gi_11935188_gb_AF327420.1_AF327420 Length = 468 Score = 275 bits (702), Expect = 2e-74 Identities = 136/187 (72%), Positives = 153/187 (81%) Frame = +2 Query: 53 NINCSIDESLARYRDVTSAARKRSIPVRGYISCVVGCPMEGNVHPSKVAYVADELYKMGC 232 NINC+I+ESL RYR V +AA++ S+PVRGY+SCVVGCP+EG V PSKVAYV ELY MGC Sbjct: 273 NINCTIEESLLRYRVVATAAKEHSVPVRGYVSCVVGCPVEGPVLPSKVAYVVKELYDMGC 332 Query: 233 NEISLGDTIGVGTPGTVVPMIEAVKNVVPIEKLAVHFHDTYGQALSNILVSLQMXXXXXX 412 EISLGDTIG+GTPG+VVPM+EAV VVP +KLAVHFHDTYGQAL+NILVSLQM Sbjct: 333 FEISLGDTIGIGTPGSVVPMLEAVMAVVPADKLAVHFHDTYGQALANILVSLQMGISIVD 392 Query: 413 XXXXXXXXCPYAKGATGNVATEDVVYMLNGLGVKTNVDLKKLMLAGDFIRKHLGRPTESK 592 CPYAKGA+GNVATEDVVYMLNGLGV TNVDL KL+ AGDFI KHLGRP SK Sbjct: 393 SSIAGLGGCPYAKGASGNVATEDVVYMLNGLGVHTNVDLGKLIAAGDFISKHLGRPNGSK 452 Query: 593 AATALSK 613 AA AL++ Sbjct: 453 AAVALNR 459 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,777,802 Number of Sequences: 27288 Number of extensions: 337647 Number of successful extensions: 972 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 969 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1129912396 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB5E24.yg.ab1 (403 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66070.1 expressed protein / ;supported by full-length cDN... 130 3e-31 >At1g66070.1 expressed protein / ;supported by full-length cDNA: Ceres:20812. Length = 226 Score = 130 bits (326), Expect = 3e-31 Identities = 68/124 (54%), Positives = 88/124 (70%) Frame = +1 Query: 1 KLRQQRLVEEADYKNTAELFASKKGDDKTIDTFIPKSENDFLEYAELISNKLRPFEKSFH 180 KLRQQRLVEEADY+ TAELF K DDK +D FIPKSE+DFLEYAE+IS++++P+EKS+H Sbjct: 90 KLRQQRLVEEADYRATAELFGVKD-DDKNLDMFIPKSESDFLEYAEMISHRIKPYEKSYH 148 Query: 181 YIGLLKHVMRLSMTSLKAADAKEVASSVSXXXXXXXXXXXXXXXXXXXXXXXXXQLLVDK 360 YI LLK +MRLS+T++KAAD K+VASS++ QL+VDK Sbjct: 149 YIALLKTIMRLSLTNMKAADVKDVASSIT-TIANEKLKAEKEAAAGKKKGGKKKQLIVDK 207 Query: 361 PDDE 372 +D+ Sbjct: 208 ANDD 211 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.313 0.132 0.355 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,388,954 Number of Sequences: 27288 Number of extensions: 97272 Number of successful extensions: 221 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 220 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 410186340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB6D08.yg.ab1 (513 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g21660.1 glycine-rich RNA binding protein AtGRP7 / NULL 117 4e-27 At4g39260.1 glycine-rich RNA-binding protein 8 (GRP8) / CCR1 ... 103 4e-23 At2g16260.1 glycine-rich RNA-binding protein / 91 4e-19 At3g26420.1 glycine-rich RNA-binding protein / similar to RNA... 83 9e-17 At4g13850.1 glycine-rich RNA-binding protein AtGRP2 / glycine... 80 5e-16 At3g23830.1 glycine-rich RNA-binding protein / similar to gly... 75 2e-14 At5g61030.1 glycine-rich RNA-binding protein / RNA-binding pr... 74 3e-14 At4g24770.1 31 kDa ribonucleoprotein, chloroplast precursor (RNA... 73 1e-13 At5g04280.1 glycine-rich RNA-binding protein / 73 1e-13 At3g53460.1 29 kDa ribonucleoprotein, chloroplast precursor (RNA... 72 2e-13 At2g37220.1 chloroplast RNA-binding protein cp29, putative / ... 71 3e-13 At1g74230.1 glycine-rich RNA-binding protein / similar to RNA... 70 6e-13 >At2g21660.1 glycine-rich RNA binding protein AtGRP7 / NULL Length = 176 Score = 117 bits (292), Expect = 4e-27 Identities = 55/67 (82%), Positives = 63/67 (93%) Frame = +3 Query: 3 TTDRSLEDAFRQYGEVLDSKIINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRN 182 T DR+LE AF QYG+V+DSKIINDRETGRSRGFGFVTFKDE++++DAIEGMNGQ LDGR+ Sbjct: 19 TDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRS 78 Query: 183 ITVNEAQ 203 ITVNEAQ Sbjct: 79 ITVNEAQ 85 >At4g39260.1 glycine-rich RNA-binding protein 8 (GRP8) / CCR1 protein; supported by cDNA: gi_166838_gb_L00649.1_ATHRBPB Length = 169 Score = 103 bits (258), Expect = 4e-23 Identities = 49/67 (73%), Positives = 58/67 (86%) Frame = +3 Query: 3 TTDRSLEDAFRQYGEVLDSKIINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRN 182 T D L+ F Q+G+V+DSKIINDRE+GRSRGFGFVTFKDE+++RDAIE MNG+ LDGR Sbjct: 17 TNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRV 76 Query: 183 ITVNEAQ 203 ITVNEAQ Sbjct: 77 ITVNEAQ 83 >At2g16260.1 glycine-rich RNA-binding protein / Length = 185 Score = 90.5 bits (223), Expect = 4e-19 Identities = 43/62 (69%), Positives = 51/62 (81%) Frame = +3 Query: 3 TTDRSLEDAFRQYGEVLDSKIINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRN 182 T ++S+E F ++GEV DSKII DRETGRS+GF FVTFKDE S+R AI+ MNGQ LDGRN Sbjct: 55 TDEQSIERCFNEFGEVFDSKIIIDRETGRSKGFRFVTFKDEDSMRTAIDRMNGQELDGRN 114 Query: 183 IT 188 IT Sbjct: 115 IT 116 >At3g26420.1 glycine-rich RNA-binding protein / similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain); supported by cDNA: gi_15451065_gb_AY054613.1_ Length = 245 Score = 82.8 bits (203), Expect = 9e-17 Identities = 35/67 (52%), Positives = 54/67 (80%) Frame = +3 Query: 3 TTDRSLEDAFRQYGEVLDSKIINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRN 182 T+DR L DAF +YG ++++K++ D+ +GRSRGFGF+TF +++++ +AI MNG LDGR Sbjct: 18 TSDRGLRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRT 77 Query: 183 ITVNEAQ 203 ITV++AQ Sbjct: 78 ITVDKAQ 84 >At4g13850.1 glycine-rich RNA-binding protein AtGRP2 / glycine-rich RNA binding protein 2, Arabidopsis thaliana, AJ002892;supported by full-length cDNA: Ceres:16314. Length = 158 Score = 80.5 bits (197), Expect = 5e-16 Identities = 39/66 (59%), Positives = 49/66 (74%) Frame = +3 Query: 3 TTDRSLEDAFRQYGEVLDSKIINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRN 182 T D SL DAF +G+V+D+K+I DRETGRSRGFGFV F DE + AI M+G+ L+GR+ Sbjct: 46 TDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRH 105 Query: 183 ITVNEA 200 I VN A Sbjct: 106 IRVNPA 111 >At3g23830.1 glycine-rich RNA-binding protein / similar to glycine-rich RNA binding protein 2 (AtGRP2) GB:CAA05727 [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain);supported by full-length cDNA: Ceres:18903. Length = 136 Score = 75.1 bits (183), Expect = 2e-14 Identities = 37/66 (56%), Positives = 48/66 (72%) Frame = +3 Query: 3 TTDRSLEDAFRQYGEVLDSKIINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRN 182 T D SL+ AF +GEV ++ +I DRETGRSRGFGFV+F E S +AI+ M+G+ L+GR Sbjct: 46 TDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIKEMDGKELNGRQ 105 Query: 183 ITVNEA 200 I VN A Sbjct: 106 IRVNLA 111 >At5g61030.1 glycine-rich RNA-binding protein / RNA-binding protein, Nicotiana sylvestris, PIR:S46286; supported by cDNA: gi_16974555_gb_AY060565.1_ Length = 309 Score = 74.3 bits (181), Expect = 3e-14 Identities = 34/62 (54%), Positives = 47/62 (74%) Frame = +3 Query: 15 SLEDAFRQYGEVLDSKIINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRNITVN 194 SL +AF +YGEV+D+++I DRETGRSRGFGFVTF ++ AI+ ++G+ L GR + VN Sbjct: 55 SLREAFTKYGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQALDGRDLHGRVVKVN 114 Query: 195 EA 200 A Sbjct: 115 YA 116 >At4g24770.1 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp31) / (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) ; supported by cDNA: gi_15294253_gb_AF410318.1_AF410318 Length = 329 Score = 72.8 bits (177), Expect = 1e-13 Identities = 32/62 (51%), Positives = 47/62 (75%) Frame = +3 Query: 18 LEDAFRQYGEVLDSKIINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRNITVNE 197 LE F ++G+V++++++ DRETGRSRGFGFVT D L +AI ++GQ+L+GR I VN Sbjct: 260 LEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNV 319 Query: 198 AQ 203 A+ Sbjct: 320 AE 321 Score = 51.6 bits (122), Expect = 2e-07 Identities = 27/63 (42%), Positives = 38/63 (59%) Frame = +3 Query: 12 RSLEDAFRQYGEVLDSKIINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRNITV 191 ++L F Q G V +++I +RET +SRGFGFVT A+E N L+GR +TV Sbjct: 164 QALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTV 223 Query: 192 NEA 200 N+A Sbjct: 224 NKA 226 >At5g04280.1 glycine-rich RNA-binding protein / Length = 310 Score = 72.8 bits (177), Expect = 1e-13 Identities = 32/66 (48%), Positives = 50/66 (75%) Frame = +3 Query: 6 TDRSLEDAFRQYGEVLDSKIINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRNI 185 TDR LE AF ++G++LD +I+ +R+TGRSRGFGF+TF D +++ ++I M+G+ R I Sbjct: 19 TDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVI 78 Query: 186 TVNEAQ 203 +VN A+ Sbjct: 79 SVNRAE 84 >At3g53460.1 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) / ;supported by full-length cDNA: Ceres:38888. Length = 342 Score = 72.0 bits (175), Expect = 2e-13 Identities = 31/65 (47%), Positives = 48/65 (73%) Frame = +3 Query: 9 DRSLEDAFRQYGEVLDSKIINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRNIT 188 D +LE+ F + G+V+++++I DR++GRS+GFGFVT Q ++ AI +NG LDGR I Sbjct: 270 DMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIR 329 Query: 189 VNEAQ 203 V+EA+ Sbjct: 330 VSEAE 334 Score = 47.0 bits (110), Expect = 6e-06 Identities = 24/59 (40%), Positives = 31/59 (51%) Frame = +3 Query: 18 LEDAFRQYGEVLDSKIINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRNITVN 194 L F G V ++I D+ TGRSRGFGFVT + A + NG +GR + VN Sbjct: 115 LAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFNGYEFEGRPLRVN 173 >At2g37220.1 chloroplast RNA-binding protein cp29, putative / ; supported by full-length cDNA: Ceres: 8849. Length = 289 Score = 71.2 bits (173), Expect = 3e-13 Identities = 30/65 (46%), Positives = 50/65 (76%) Frame = +3 Query: 9 DRSLEDAFRQYGEVLDSKIINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRNIT 188 D +LE F + G+V+++++I DR++GRS+GFGFVT+ Q +++AI+ ++G LDGR I Sbjct: 217 DMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIR 276 Query: 189 VNEAQ 203 V+EA+ Sbjct: 277 VSEAE 281 Score = 50.1 bits (118), Expect = 7e-07 Identities = 26/59 (44%), Positives = 32/59 (54%) Frame = +3 Query: 18 LEDAFRQYGEVLDSKIINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRNITVN 194 L F G V ++I D+ TGRSRGFGFVT + A + NG LDGR + VN Sbjct: 107 LAQLFESAGNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEAAAQQFNGYELDGRPLRVN 165 >At1g74230.1 glycine-rich RNA-binding protein / similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 70.1 bits (170), Expect = 6e-13 Identities = 36/66 (54%), Positives = 47/66 (70%) Frame = +3 Query: 3 TTDRSLEDAFRQYGEVLDSKIINDRETGRSRGFGFVTFKDEQSLRDAIEGMNGQSLDGRN 182 T + L +AF +YGEV+D+KII DRETGRSRGF FVTF + +A++ ++GQ L GR Sbjct: 45 TDEFGLREAFSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQ-LDGQDLHGRR 103 Query: 183 ITVNEA 200 I VN A Sbjct: 104 IRVNYA 109 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,304,984 Number of Sequences: 27288 Number of extensions: 92778 Number of successful extensions: 591 Number of sequences better than 1.0e-05: 111 Number of HSP's better than 0.0 without gapping: 481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 575 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 702475800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB6D18.yg.ab1 (576 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26460.1 unknown protein / 128 2e-30 >At2g26460.1 unknown protein / Length = 585 Score = 128 bits (321), Expect = 2e-30 Identities = 60/77 (77%), Positives = 67/77 (86%), Gaps = 2/77 (2%) Frame = +1 Query: 136 GEKKGWLHRWDFETEEEWATYNEQKEAMPKAAFQFGVKMQDGRKTRKQN--KDQKITNEL 309 G+ KG LHRWDFETEEEW YNEQKEAMPKAAFQFGVKMQDGRKTRKQN +DQK+ NEL Sbjct: 491 GKAKGGLHRWDFETEEEWEKYNEQKEAMPKAAFQFGVKMQDGRKTRKQNRDRDQKLNNEL 550 Query: 310 HKINKILAKKNMQKDDG 360 H+INKIL +K M+K+ G Sbjct: 551 HQINKILTRKKMEKEGG 567 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,474,538 Number of Sequences: 27288 Number of extensions: 206562 Number of successful extensions: 1120 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 833 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1052 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 868297828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB6E14.yg.ab1 (588 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59390.1 putative protein / protein CG15643 - Drosophila m... 213 8e-56 >At3g59390.1 putative protein / protein CG15643 - Drosophila melanogaster, EMBL:AE003499 Length = 273 Score = 213 bits (541), Expect = 8e-56 Identities = 98/158 (62%), Positives = 122/158 (77%), Gaps = 5/158 (3%) Frame = +3 Query: 126 FKLRLVLILMLTSTTF-----AIRKDISFQETQICRTTVQGRYLITDYTGYVCDALSLDP 290 F L +++L++ F AIRKDI F E + CRTTVQGRYLI+D G VCDALSL+ Sbjct: 6 FSLLFLVLLLIMGFLFPLRVSAIRKDIGFLEERSCRTTVQGRYLISDDEGNVCDALSLES 65 Query: 291 KSHCCRVKRDQYSCQGCNLVSQCCNSYEYCVSCCLNPEKTHVNQALKVKIAKPVTSGTYS 470 ++ CC K +++SC GCN++SQCCNSYE+CVSCCLNP +T + + +KVK+AKP TSGTY Sbjct: 66 RTRCCPWKGERFSCHGCNILSQCCNSYEFCVSCCLNPSQTLLEKVVKVKVAKPATSGTYK 125 Query: 471 SLFDYCAGRCRHNSESVVH*NAYLSEFHHCFAPPSNNS 584 S+FD+CAGRCRHNSESVVH NAY SEFHHCF+ SN S Sbjct: 126 SVFDFCAGRCRHNSESVVHENAYHSEFHHCFSLTSNAS 163 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,018,945 Number of Sequences: 27288 Number of extensions: 206000 Number of successful extensions: 463 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 904103924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB6J05.yg.ab1 (673 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g35250.1 putative protein / Cyanophora paradoxa cyanelle, ... 431 e-121 At2g34460.1 expressed protein / ; supported by cDNA: gi_14334... 57 7e-09 At1g16720.1 unknown protein / ; supported by cDNA: gi_17065111 52 3e-07 At5g15910.1 putative protein / ;supported by full-length cDN... 48 5e-06 At5g18660.1 putative protein / 2'-hydroxyisoflavone reductase... 48 5e-06 At4g31530.1 putative protein / hypothetical protein - Arabido... 47 9e-06 >At4g35250.1 putative protein / Cyanophora paradoxa cyanelle, predicted protein;supported by full-length cDNA: Ceres:2912. Length = 395 Score = 431 bits (1108), Expect = e-121 Identities = 201/221 (90%), Positives = 215/221 (96%) Frame = +2 Query: 11 AANLAPGTPVRATSIMVIGATGTLGRQVVRRALDEGYDVRCLVRPRPAPADFLRDWGATV 190 A NLAPGTPVR TSI+V+GATGTLGRQ+VRRALDEGYDVRCLVRPRPAPADFLRDWGATV Sbjct: 68 AVNLAPGTPVRPTSILVVGATGTLGRQIVRRALDEGYDVRCLVRPRPAPADFLRDWGATV 127 Query: 191 VNGDLTKPETIPATLVGVHTIIDCATGRPEEPIKTVDWEGKVALIQCAKAMGIQKYVFFS 370 VN DL+KPETIPATLVG+HT+IDCATGRPEEPIKTVDWEGKVALIQCAKAMGIQKYVF+S Sbjct: 128 VNADLSKPETIPATLVGIHTVIDCATGRPEEPIKTVDWEGKVALIQCAKAMGIQKYVFYS 187 Query: 371 IHNCDKHPEVPLMEIKYCTEKYLQESGINHVVIRLCGFMQGLIGQYAVPILEEKSVWGTD 550 IHNCDKHPEVPLMEIKYCTEK+LQESG+NH+ IRLCGFMQGLIGQYAVPILEEKSVWGTD Sbjct: 188 IHNCDKHPEVPLMEIKYCTEKFLQESGLNHITIRLCGFMQGLIGQYAVPILEEKSVWGTD 247 Query: 551 APTRIAYMDTQDIARLTFIAIRSENVNGKLLTFAGPRAWTT 673 APTR+AYMDTQDIARLT IA+R+E +NGKLLTFAGPRAWTT Sbjct: 248 APTRVAYMDTQDIARLTLIALRNEKINGKLLTFAGPRAWTT 288 >At2g34460.1 expressed protein / ; supported by cDNA: gi_14334607_gb_AY034977.1_ Length = 246 Score = 57.4 bits (137), Expect = 7e-09 Identities = 46/165 (27%), Positives = 75/165 (44%), Gaps = 20/165 (12%) Frame = +2 Query: 38 VRATSIMVIGATGTLGRQVVRRALDEGYDVRCLVRP-RPAPADFLRDWGATVVNGDLTK- 211 V+ + V GATG G+++V + L G+ V+ VR A F D +V D+T+ Sbjct: 10 VKTKKVFVAGATGQTGKRIVEQLLSRGFAVKAGVRDVEKAKTSFKDDPSLQIVRADVTEG 69 Query: 212 PETIPATLVGVHTIIDCATG-RPEEPIKT---VDWEGKVALIQCAKAMGIQKYVFFSIHN 379 P+ + + + CATG RP I T VD G V L+ + G++K+V S Sbjct: 70 PDKLAEVIGDDSQAVICATGFRPGFDIFTPWKVDNFGTVNLVDACRKQGVEKFVLVSSIL 129 Query: 380 CDKHPEVPLMEIKYC--------------TEKYLQESGINHVVIR 472 + ++ Y EKY+++SGIN+ ++R Sbjct: 130 VNGAAMGQILNPAYLFLNLFGLTLVAKLQAEKYIKKSGINYTIVR 174 >At1g16720.1 unknown protein / ; supported by cDNA: gi_17065111 Length = 598 Score = 52.0 bits (123), Expect = 3e-07 Identities = 29/90 (32%), Positives = 47/90 (52%) Frame = +2 Query: 5 PVAANLAPGTPVRATSIMVIGATGTLGRQVVRRALDEGYDVRCLVRPRPAPADFLRDWGA 184 P+ PG + +++V+GAT +GR VVR+ + GY V+ LVR + + Sbjct: 151 PMCEFAVPGA--QNVTVLVVGATSRIGRIVVRKLMLRGYTVKALVRKQDEEVMSMLPRSV 208 Query: 185 TVVNGDLTKPETIPATLVGVHTIIDCATGR 274 +V GD+ +P T+ + + II CAT R Sbjct: 209 DIVVGDVGEPSTLKSAVESCSKIIYCATAR 238 >At5g15910.1 putative protein / ;supported by full-length cDNA: Ceres:22994. Length = 269 Score = 47.8 bits (112), Expect = 5e-06 Identities =