BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA10A15.yg.ab1 (508 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79140.1 unknown protein / 140 2e-44 >At1g79140.1 unknown protein / Length = 311 Score = 140 bits (352), Expect(2) = 2e-44 Identities = 66/104 (63%), Positives = 86/104 (82%) Frame = +1 Query: 133 RDLLXNDSGGGSLSGSIAKYQPYASDPNLSGAFATVLWELSGLSKHYHPSVSTMASGISN 312 R+LL ND+GGGS+SGSIAKYQPYA+DPNLSGA ATVLWELS LSKHYHP++STMA+ +SN Sbjct: 137 RNLLENDAGGGSVSGSIAKYQPYATDPNLSGALATVLWELSLLSKHYHPAISTMATTVSN 196 Query: 313 MANANNQGYGASISPQQAFSDMTLDKEKFTVKTTQKQSNSKRKR 444 M + +Q + ++++PQQAF+D +L KE F K ++ N+KRKR Sbjct: 197 MNTSQSQTFLSAVTPQQAFADFSLVKESFEPKNESRKLNNKRKR 240 Score = 56.2 bits (134), Expect(2) = 2e-44 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 18 QRAAAFIKRLASFSLCFGAAESMAALVTLKHLLXK 122 Q+AAAF+KRLA+F+LCFG AESM+ALVTLK LL K Sbjct: 98 QKAAAFVKRLATFALCFGCAESMSALVTLKTLLQK 132 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.314 0.130 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,632,497 Number of Sequences: 27288 Number of extensions: 284754 Number of successful extensions: 827 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 827 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 684463600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA10F21.yg.ab1 (560 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g33270.1 expressed protein / contains Patatin domain PF01734 66 1e-11 >At1g33270.1 expressed protein / contains Patatin domain PF01734 Length = 364 Score = 65.9 bits (159), Expect = 1e-11 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +3 Query: 9 RELFNWALEPAADSILDNLYELGYMDAAVWAASNPVEDLVQEDNLT 146 R+L NWALEPA D +L+ L+ELGY DAA WA NPVE LV +D T Sbjct: 312 RQLLNWALEPAEDEVLERLFELGYADAATWAEMNPVEGLVYDDTPT 357 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,423,879 Number of Sequences: 27288 Number of extensions: 239141 Number of successful extensions: 639 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 636 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 835029516 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA10O14.yg.ab1 (297 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20600.1 putative protein / ; supported by cDNA: gi_19310... 68 1e-12 >At5g20600.1 putative protein / ; supported by cDNA: gi_19310468 Length = 274 Score = 67.8 bits (164), Expect = 1e-12 Identities = 42/101 (41%), Positives = 57/101 (55%), Gaps = 5/101 (4%) Frame = +1 Query: 1 KFYDLGSGSEWFQGNRKGLVGLNKEFLKLEKELEASGVDVMFPTVEGDDGDLEGPDLVPI 180 +FY+LGS E QGNRK + L+KEFL+LEK++ +S ++V D E P+ VP+ Sbjct: 6 RFYELGSSPECHQGNRKLIFALHKEFLQLEKDMSSSSIEVSIVEASRPGND-EVPESVPV 64 Query: 181 GGRGT---QNSSGLLLEGSKSVAEGSKKSSKKKKK--KKGA 288 T S ++ GS S +G KK SK KK KKGA Sbjct: 65 SESNTNVVSKSKKIVANGSSSKKKGLKKCSKTKKDSVKKGA 105 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.306 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,025,754 Number of Sequences: 27288 Number of extensions: 215359 Number of successful extensions: 1532 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1321 length of database: 11,516,596 effective HSP length: 74 effective length of database: 9,497,284 effective search space used: 227934816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.9 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA11C07.yg.ab1 (378 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05000.1 unknown protein / similar to GB:CAB05547 [Caenorh... 89 8e-19 >At3g05000.1 unknown protein / similar to GB:CAB05547 [Caenorhabditis elegans] Length = 173 Score = 88.6 bits (218), Expect = 8e-19 Identities = 42/64 (65%), Positives = 52/64 (80%), Gaps = 2/64 (3%) Frame = +2 Query: 2 EPSTE--TRGSATEAGNKAAETTGMHLYFPCGIIRGALSNMGIPCAVSADISNLPACSFV 175 +PS+E T+ +T +KAA+ M+LYFPCGIIRG LSN+GIPCAVSADIS+LP CSFV Sbjct: 109 DPSSENETQDPSTPGESKAAQAVSMYLYFPCGIIRGVLSNLGIPCAVSADISSLPTCSFV 168 Query: 176 IRIK 187 IR+K Sbjct: 169 IRVK 172 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,762,930 Number of Sequences: 27288 Number of extensions: 182066 Number of successful extensions: 474 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 474 length of database: 11,516,596 effective HSP length: 87 effective length of database: 9,142,540 effective search space used: 347416520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA11D11.yg.ab1 (440 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g16810.1 expressed protein / ;supported by full-length cDN... 99 7e-22 >At1g16810.1 expressed protein / ;supported by full-length cDNA: Ceres:4887. Length = 144 Score = 99.4 bits (246), Expect = 7e-22 Identities = 49/81 (60%), Positives = 63/81 (77%), Gaps = 7/81 (8%) Frame = +2 Query: 11 EEELNDGSSSKAKGGAHV-------DSLTPAEKRYMEQRQKIDMQKMAKTSNKSHRDRLS 169 +EE+N S KA A + D LTPAE+RY+EQ+Q++D+QK+AK +NKSHR+R+ Sbjct: 66 DEEMN--RSEKASEDAKLQQQLDDDDHLTPAERRYIEQKQRLDVQKLAKEANKSHRNRIE 123 Query: 170 EFNQYLANMSEHYDIPKVGPG 232 +FNQYLANMSEHYDIPKVGPG Sbjct: 124 DFNQYLANMSEHYDIPKVGPG 144 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,479,275 Number of Sequences: 27288 Number of extensions: 183525 Number of successful extensions: 478 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 472 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 478 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 507397856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA11M21.yg.ab1 (301 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g23570.1 putative protein / similar to unknown protein (em... 113 2e-26 >At5g23570.1 putative protein / similar to unknown protein (emb|CAB62356.1) Length = 625 Score = 113 bits (282), Expect = 2e-26 Identities = 57/100 (57%), Positives = 73/100 (73%) Frame = +2 Query: 2 MSVLIFDTSAVGYFNAERLSNHFNRQGLDKNAWNHHPNLFTPDCKRQLYGFMATKQDLDI 181 MSVL+F++SA GY AERL GLD+ AW ++F+ RQLYGF+ATKQDLDI Sbjct: 354 MSVLMFESSATGYLEAERLHRELAEMGLDRIAWGQKRSMFSGGV-RQLYGFLATKQDLDI 412 Query: 182 LNQHSPGKLKLKFELASYQEKVVDQLKKMSEDSQELLRYK 301 NQHS GK +LKFEL SYQE VV +L+++SED+Q+L +K Sbjct: 413 FNQHSQGKTRLKFELKSYQEMVVKELRQISEDNQQLNYFK 452 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,326,125 Number of Sequences: 27288 Number of extensions: 115034 Number of successful extensions: 319 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 318 length of database: 11,516,596 effective HSP length: 75 effective length of database: 9,469,996 effective search space used: 227279904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA12B16.yg.ab1 (424 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g05060.1 expressed protein / ;supported by full-length cDN... 123 3e-29 >At1g05060.1 expressed protein / ;supported by full-length cDNA: Ceres:37455. Length = 253 Score = 123 bits (309), Expect = 3e-29 Identities = 59/97 (60%), Positives = 75/97 (76%), Gaps = 2/97 (2%) Frame = +1 Query: 1 LSQIAKAFAAATALIFGGATLTIGLAVSQLELHTTDDIRTKGKDIVQPKFESIKERVTPL 180 L I KAFAAAT +IFG ATL G A S+L++ DDIRTKGKD+ QPK ES+KE+V PL Sbjct: 156 LQHIGKAFAAATIIIFGSATLVFGTAASKLDMRNADDIRTKGKDLFQPKLESMKEQVEPL 215 Query: 181 RTWAEDVANKWHIKTE--EDIKEKPLIKELSRMMGAK 285 RTWAE+++ KWHI+ E IKEKP++KELS+++G K Sbjct: 216 RTWAENMSKKWHIENEGGNTIKEKPILKELSKILGPK 252 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,897,827 Number of Sequences: 27288 Number of extensions: 178183 Number of successful extensions: 526 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 524 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 463486164 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA12P03.yg.ab1 (684 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30790.1 putative protein / 186 1e-47 >At4g30790.1 putative protein / Length = 1148 Score = 186 bits (471), Expect = 1e-47 Identities = 101/178 (56%), Positives = 117/178 (64%), Gaps = 40/178 (22%) Frame = +3 Query: 3 ELIDRYTKTEASHEQLTKELEEKKDLVNALYMKLQSEKQVNKEKITFGRLELHEIAAFVL 182 EL+++ EA+ EQ K+LEEKK+LV LY K Q KQ NKEKI+FGRLE+HEIAAFVL Sbjct: 967 ELLEKCQNLEATSEQTRKDLEEKKELVKTLYTKHQLGKQANKEKISFGRLEVHEIAAFVL 1026 Query: 183 NEAGHYEAINRNCTHYYLSSESVALFTDHLPHQPTHIVGQIVHIERQTVK--------SS 338 N+AGHYEAINRNC +YYLSSES ALFTDHLP +PT+IVGQIVHIERQ VK +S Sbjct: 1027 NQAGHYEAINRNCPNYYLSSESEALFTDHLPSRPTYIVGQIVHIERQIVKLPSQLSASAS 1086 Query: 339 PV--------------------------------PYGLPVGCEYFVVTVAMIPDTAIH 416 P PYGL GCEYF+VT+AM+PDTAIH Sbjct: 1087 PEAGKTHHLCSDQGSRTLASSSISTSTSATTTSNPYGLSSGCEYFIVTIAMLPDTAIH 1144 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,710,622 Number of Sequences: 27288 Number of extensions: 360203 Number of successful extensions: 1029 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1029 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1165500188 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13C12.yg.ab1 (407 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79040.1 photosystem II polypeptide, putative / similar to... 151 1e-37 >At1g79040.1 photosystem II polypeptide, putative / similar to photosystem II polypeptide GI:967967 from [Brassica rapa];supported by full-length cDNA: Ceres:110067. Length = 140 Score = 151 bits (382), Expect = 1e-37 Identities = 72/87 (82%), Positives = 78/87 (88%) Frame = +1 Query: 1 GVNGGMALRDGLDASGRKPKGKGVYQYVDKYGANVDGYSPIYNEDEWSPSGDVYVGGKTG 180 G+NG M LRDG+DASGRK KG GVY+YVDKYGANVDGYSPIYNE+EWS SGDVY GG TG Sbjct: 54 GINGSMDLRDGVDASGRKGKGYGVYKYVDKYGANVDGYSPIYNENEWSASGDVYKGGVTG 113 Query: 181 LLIWAITLAGILGGGALLVYSTSALAQ 261 L IWA+TLAGIL GGALLVY+TSALAQ Sbjct: 114 LAIWAVTLAGILAGGALLVYNTSALAQ 140 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,552,365 Number of Sequences: 27288 Number of extensions: 218716 Number of successful extensions: 591 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 591 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 418046344 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13F19.yg.ab1 (653 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26280.1 unknown protein / 246 1e-65 At5g58720.1 putative PRL1 associated protein / ;supported by... 58 4e-09 >At2g26280.1 unknown protein / Length = 567 Score = 246 bits (627), Expect = 1e-65 Identities = 123/157 (78%), Positives = 136/157 (86%) Frame = +3 Query: 3 EARDHARLRNSYFEQARQAYLVGQKALAKELSAKGQLHNMQMKAAHEKAQESIYYQRNPG 182 EARD+ARLRN YFEQARQAYLVG KALAKELS KGQLHNMQMKAAH KAQE+IY QRNP Sbjct: 414 EARDYARLRNVYFEQARQAYLVGNKALAKELSVKGQLHNMQMKAAHGKAQEAIYRQRNPV 473 Query: 183 SLDIQGNGRGQERIIDLHGLHVNEAIHVLKRDLMTLRNIARSTDQRLQAYICVGTGHHTK 362 QGN RG ER+IDLHGLHV+EA+ VLK +L LR+ AR+T +RLQ YICVGTGHHT+ Sbjct: 474 G---QGNSRGNERMIDLHGLHVSEALQVLKHELSVLRSTARATQERLQIYICVGTGHHTR 530 Query: 363 GTRTPARLPVAVQRYLLEVEGLDYSEPQPGLLRVVLY 473 G+RTPARLPVAVQRYLLE EGLDYSEPQ GLLRV++Y Sbjct: 531 GSRTPARLPVAVQRYLLEEEGLDYSEPQAGLLRVIIY 567 >At5g58720.1 putative PRL1 associated protein / ;supported by full-length cDNA: Ceres:150336. Length = 519 Score = 58.2 bits (139), Expect = 4e-09 Identities = 48/155 (30%), Positives = 71/155 (44%) Frame = +3 Query: 6 ARDHARLRNSYFEQARQAYLVGQKALAKELSAKGQLHNMQMKAAHEKAQESIYYQRNPGS 185 A D + SY+++A +AY G +A A LS KG++ + Q + A E+A + I+ RN G Sbjct: 363 ANDQWNVTKSYYQKAAEAYSKGGRAHAAYLSDKGRVASKQAQRADERASQDIFVARNKGI 422 Query: 186 LDIQGNGRGQERIIDLHGLHVNEAIHVLKRDLMTLRNIARSTDQRLQAYICVGTGHHTKG 365 ++ IDLHG HV A+ +LK L+ + R + G G G Sbjct: 423 ENVV--------TIDLHGQHVKPAMKLLKLHLLFGSYVPSIQTLR----VITGCGASGFG 470 Query: 366 TRTPARLPVAVQRYLLEVEGLDYSEPQPGLLRVVL 470 + V LLE EG+ Y E G L + L Sbjct: 471 KSKVKQSVVK----LLEREGVRYCEENRGTLLIKL 501 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,061,380 Number of Sequences: 27288 Number of extensions: 307032 Number of successful extensions: 776 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 773 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1088756792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13G18.yg.ab1 (750 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g36305.1 similar to CAAX prenyl protease 2 / temporary aut... 216 1e-56 >At2g36305.1 similar to CAAX prenyl protease 2 / temporary automated functional assignment Length = 242 Score = 216 bits (550), Expect = 1e-56 Identities = 100/169 (59%), Positives = 122/169 (72%) Frame = +3 Query: 57 NWMVSAVYDISVWRMYIVAPVTEELVFRACMISLLLCGGFKAYTVILLSPVLFSLAHLNH 236 +W S + + R +APVTEELVFR+CMI LLLC GF+ T I L PVLFSLAHLNH Sbjct: 73 SWEASYILGVYGIRKDHLAPVTEELVFRSCMIPLLLCAGFRINTAIFLCPVLFSLAHLNH 132 Query: 237 LLEYYMQQNTSLLKASMVVGFQLGYTVIFGSYASFLFVRTGHIAAPLVSHIFCNIMGLPA 416 E Y++ N S L+AS++VG QLGYTVIFG+YASFLF+RTGH+AAPL +HIFCN MGLP Sbjct: 133 FREMYIRHNRSYLRASLIVGLQLGYTVIFGAYASFLFIRTGHLAAPLFAHIFCNYMGLPV 192 Query: 417 FFSRRTWLVGVGFVAGAISFVYLLFPLTSPALYNDRTDNCECWHTYCYW 563 ++ LV F+ G + FV LLFPLT P +YND T++C CW YC W Sbjct: 193 LYANGKGLVSAAFLGGVVGFVLLLFPLTKPLMYNDSTNDCPCWLGYCLW 241 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,296,826 Number of Sequences: 27288 Number of extensions: 389148 Number of successful extensions: 1073 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1031 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1073 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13H06.yg.ab1 (495 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g04305.1 hypothetical protein / predicted by genefinder; s... 110 1e-26 >At2g04305.1 hypothetical protein / predicted by genefinder; supported by cDNA: gi_19310533 Length = 434 Score = 110 bits (274), Expect(2) = 1e-26 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = +3 Query: 51 SLEELIGRLRRLKENVGFISNRVTAVQAGLDSWLAEQINRKLYCLSFLSIIFLPLSIITG 230 SLEELIGRLRRLKENVGFI+NRVTA+QAGLDSW AEQINRKLY LSFLSIIFLPLSIITG Sbjct: 289 SLEELIGRLRRLKENVGFIANRVTAIQAGLDSWQAEQINRKLYYLSFLSIIFLPLSIITG 348 Score = 26.6 bits (57), Expect(2) = 1e-26 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 2 VKEKCSVKDWFGTVDI 49 VKEKCS K WF DI Sbjct: 272 VKEKCSTKPWFLAEDI 287 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,889,533 Number of Sequences: 27288 Number of extensions: 224717 Number of successful extensions: 626 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 648439200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13J10.yg.ab1 (514 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54440.1 unknown protein / ; supported by cDNA: gi_20259378 114 2e-26 >At5g54440.1 unknown protein / ; supported by cDNA: gi_20259378 Length = 829 Score = 114 bits (286), Expect = 2e-26 Identities = 52/69 (75%), Positives = 60/69 (86%) Frame = +1 Query: 1 RKQGHVPLSIKQGSRIEISILCVPLTAGYVRPPQLELPNIGDANISCNPAGPHLVCVFPP 180 RK+GHV LS +QGSR+ ISILCVPL AGYVRPPQL LPN+ +AN+S NP+GPHLVCV PP Sbjct: 759 RKRGHVSLSEEQGSRVVISILCVPLVAGYVRPPQLGLPNVEEANVSSNPSGPHLVCVLPP 818 Query: 181 PLSSSYCIP 207 LSSSYC+P Sbjct: 819 LLSSSYCLP 827 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,884,317 Number of Sequences: 27288 Number of extensions: 273014 Number of successful extensions: 638 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 638 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 702475800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13O06.yg.ab1 (513 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g07910.1 expressed protein / ;supported by full-length cD... 127 3e-30 At4g33650.1 dynamin-like protein ADL2 / supported by cDNA gi:... 50 9e-07 At2g14120.2 dynamin-like protein / 47 7e-06 At2g14120.1 dynamin-like protein / 47 7e-06 >At3g07910.1 expressed protein / ;supported by full-length cDNA: Ceres:24905. Length = 74 Score = 127 bits (320), Expect = 3e-30 Identities = 59/74 (79%), Positives = 70/74 (93%) Frame = +2 Query: 110 VAKDSCLARVTAGVAVGGAVGGAVGAVYGTYEAVKFEVPGLMKIRYIGETTLGSAAIFGL 289 +AK+SCLA++TAGVAVGGA+GGAVGAVYGTYEA++ +VPGL K+R+IG+TTL SAAIFGL Sbjct: 1 MAKNSCLAKITAGVAVGGALGGAVGAVYGTYEAIRVKVPGLHKVRFIGQTTLSSAAIFGL 60 Query: 290 FLGAGSLIHCGKSY 331 FLGAGSLIHCGK Y Sbjct: 61 FLGAGSLIHCGKGY 74 >At4g33650.1 dynamin-like protein ADL2 / supported by cDNA gi:19032336 Length = 808 Score = 49.7 bits (117), Expect = 9e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 93 VEENKGYFDKQIRLKIFSPNVLDITLVDLPG 1 V ENKG D QIRLKI SPNVL+ITLVDLPG Sbjct: 145 VGENKGVADTQIRLKISSPNVLNITLVDLPG 175 >At2g14120.2 dynamin-like protein / Length = 370 Score = 46.6 bits (109), Expect = 7e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -1 Query: 87 ENKGYFDKQIRLKIFSPNVLDITLVDLPG 1 ENKG D I LKIFSPNVLDI+LVDLPG Sbjct: 132 ENKGVSDIPIGLKIFSPNVLDISLVDLPG 160 >At2g14120.1 dynamin-like protein / Length = 780 Score = 46.6 bits (109), Expect = 7e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -1 Query: 87 ENKGYFDKQIRLKIFSPNVLDITLVDLPG 1 ENKG D I LKIFSPNVLDI+LVDLPG Sbjct: 132 ENKGVSDIPIGLKIFSPNVLDISLVDLPG 160 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,775,481 Number of Sequences: 27288 Number of extensions: 272827 Number of successful extensions: 1461 Number of sequences better than 1.0e-05: 8 Number of HSP's better than 0.0 without gapping: 1107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1379 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 702475800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA14A15.yg.ab1 (616 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g14260.1 proline iminopeptidase / identical to GP:1710151:... 247 3e-66 >At2g14260.1 proline iminopeptidase / identical to GP:1710151:U72711; supported by cDNA: gi_15450388_gb_AY052295.1_ Length = 329 Score = 247 bits (631), Expect = 3e-66 Identities = 116/153 (75%), Positives = 129/153 (83%), Gaps = 1/153 (0%) Frame = +2 Query: 2 LIPENER-DCFVKAYHKRLNSDDLNTQYEAARAWTKWEMMTAHLIPNEETIKKGDSDEFS 178 LIPENER V AYHKRLNSDDL QY AARAWTKWEMMTA+L PN E ++K + D+FS Sbjct: 176 LIPENERGSSLVDAYHKRLNSDDLEIQYAAARAWTKWEMMTAYLRPNLENVQKAEDDKFS 235 Query: 179 LAFARIENHYFTNKGFFYTDSHLLDNIDKIRHINAVIVQGRYDCCCPMMSAWDLHKAWPE 358 LAFARIENHYF NKGFF +DSHLLDN+DKIRHI IVQGRYD CCPMMSAWDLHKAWPE Sbjct: 236 LAFARIENHYFVNKGFFPSDSHLLDNVDKIRHIKTTIVQGRYDVCCPMMSAWDLHKAWPE 295 Query: 359 ADFKVVTDAGHSVNEPGIAAELVAANEKLKNII 457 A+ K+V DAGHS NEPGI+AELV ANEK+K ++ Sbjct: 296 AELKIVYDAGHSANEPGISAELVVANEKMKALM 328 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,979,238 Number of Sequences: 27288 Number of extensions: 270879 Number of successful extensions: 754 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 754 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 972741724 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA14B10.yg.ab1 (368 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g43240.1 putative protein / predicted protein, Drosophila ... 115 6e-27 >At3g43240.1 putative protein / predicted protein, Drosophila melanogaster, EMBL:AE003789 Length = 717 Score = 115 bits (288), Expect = 6e-27 Identities = 47/56 (83%), Positives = 51/56 (90%) Frame = +1 Query: 1 DWVNCGVCGEWAHFGCDRRQGLGAFKDYAKTDGLEYICPQCSISNFKKKLPKTSNG 168 DWVNCG CGEWAHFGCDRR GLGAFKDYAKTDGLEY+CP CS+SN++KK KTSNG Sbjct: 657 DWVNCGSCGEWAHFGCDRRPGLGAFKDYAKTDGLEYVCPNCSVSNYRKKSQKTSNG 712 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,350,392 Number of Sequences: 27288 Number of extensions: 169501 Number of successful extensions: 474 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 11,516,596 effective HSP length: 87 effective length of database: 9,142,540 effective search space used: 319988900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA14E20.yg.ab1 (540 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g51820.1 chlorophyll synthetase / ; supported by cDNA: gi... 169 1e-42 >At3g51820.1 chlorophyll synthetase / ; supported by cDNA: gi_14596066_gb_AY042821.1_ Length = 387 Score = 169 bits (427), Expect = 1e-42 Identities = 81/96 (84%), Positives = 87/96 (90%) Frame = +3 Query: 3 DRKMGLQSLPVAFGEETAKWICVGAIDITQLSVAGYLLGAGKPYYAAALVGLIAPQVFFQ 182 DR +GLQSLPVAFG ETAKWICVGAIDITQLSVAGYLL +GKPYYA ALV LI PQ+ FQ Sbjct: 292 DRALGLQSLPVAFGTETAKWICVGAIDITQLSVAGYLLASGKPYYALALVALIIPQIVFQ 351 Query: 183 FKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 290 FKYFLKDPVKYDVKYQASAQPFL+LG+ VTALA+ H Sbjct: 352 FKYFLKDPVKYDVKYQASAQPFLVLGIFVTALASQH 387 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,972,579 Number of Sequences: 27288 Number of extensions: 249523 Number of successful extensions: 576 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 575 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 772177832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA14H16.yg.ab1 (372 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67740.1 F12A21.13 / putative photosystem II Core Complex ... 125 4e-30 >At1g67740.1 F12A21.13 / putative photosystem II Core Complex sp|049347|PSBY_ARATH; similar to ESTs gb|BE523181, dbj|AV531372.1, dbj|AV527826.1, dbj AV520274.1, dbj|AV522153.1, dbj|AV530317.1, dbj|AV526312.1, dbj|AV527090.1, dbj|AV521148.1, and dbj|AV531908.1;supported by full-l Length = 189 Score = 125 bits (315), Expect = 4e-30 Identities = 65/93 (69%), Positives = 78/93 (82%), Gaps = 1/93 (1%) Frame = +3 Query: 3 LYNIFQPAVNQINRMR-TKGVIVGLGIGGGLAASSGLFATPEATASEFAAIAEAAAANDN 179 LYNI QPA+NQ+N+MR +KG++VGLGIGGGLAAS L PEA +AA AAA++D+ Sbjct: 99 LYNILQPAINQVNKMRESKGIVVGLGIGGGLAASGLLTPPPEA----YAAAEAAAASSDS 154 Query: 180 RGQLLLIVIAPAILWVLYNILQPALNQINKMRN 278 RGQLLLIV+ PA+LWVLYNILQPALNQINKMR+ Sbjct: 155 RGQLLLIVVTPALLWVLYNILQPALNQINKMRS 187 Score = 69.7 bits (169), Expect = 4e-13 Identities = 34/63 (53%), Positives = 43/63 (67%) Frame = +3 Query: 87 GLAASSGLFATPEATASEFAAIAEAAAANDNRGQLLLIVIAPAILWVLYNILQPALNQIN 266 G SS ++ P + A +A A A++DNRG LL+ I PAI WVLYNILQPA+NQ+N Sbjct: 52 GAVFSSLSYSEPALAIQQIAQLAAANASSDNRGLALLLPIVPAIAWVLYNILQPAINQVN 111 Query: 267 KMR 275 KMR Sbjct: 112 KMR 114 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,802,377 Number of Sequences: 27288 Number of extensions: 152163 Number of successful extensions: 907 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 769 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 892 length of database: 11,516,596 effective HSP length: 87 effective length of database: 9,142,540 effective search space used: 329131440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA14P07.yg.ab1 (474 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20390.1 translational inhibitor protein, putative / simil... 129 1e-30 >At3g20390.1 translational inhibitor protein, putative / similar to GB:NP_005827 from [Homo sapiens], contains Pfam profile: PF01042 Domain of unknown function;supported by full-length cDNA: Ceres:20767. Length = 187 Score = 129 bits (323), Expect = 1e-30 Identities = 68/96 (70%), Positives = 73/96 (75%) Frame = +1 Query: 187 RSNRFACFAVSTDASLKEAVKTDKAPAALGPYSQAIKTGNTVYLSGALGLIPETGKFASH 366 RS FA +VS + KE V T+KAPAALGPYSQAIK N V+LSG LGLIPETGKF S Sbjct: 48 RSPPFASLSVSASSVKKEVVSTEKAPAALGPYSQAIKANNLVFLSGVLGLIPETGKFVSE 107 Query: 367 SVEEQTEQALNNMGEILKASGARYSSAATTTIMPAD 474 SVE+QTEQ L NMGEILKASGA YSS TTIM AD Sbjct: 108 SVEDQTEQVLKNMGEILKASGADYSSVVKTTIMLAD 143 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,317,636 Number of Sequences: 27288 Number of extensions: 249369 Number of successful extensions: 763 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 763 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 596203608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA15A14.yg.ab1 (441 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06890.1 expressed protein / ;supported by full-length cDN... 140 3e-34 At2g31940.1 hypothetical protein / predicted by genscan 50 6e-07 >At3g06890.1 expressed protein / ;supported by full-length cDNA: Ceres:262487. Length = 128 Score = 140 bits (353), Expect = 3e-34 Identities = 71/90 (78%), Positives = 79/90 (86%) Frame = +3 Query: 21 GGGGEALTEFIAELLSPLGLLLLPIILLLAIQYLSSDSGSFVSSIFSAGEPSSIHRASGS 200 G GEA+T+ IAELLSP+GLLLLPIILLL IQ+LSS+ GSFVS+IFS GEP SIHR SGS Sbjct: 39 GDSGEAITDAIAELLSPVGLLLLPIILLLTIQFLSSERGSFVSAIFSTGEPESIHRVSGS 98 Query: 201 PVGVALVLVLVLFLLYNKFSIFGGDDDSDD 290 PVGVAL LVL+LFLLY +FSIFGGDD SDD Sbjct: 99 PVGVALFLVLILFLLYYRFSIFGGDDGSDD 128 >At2g31940.1 hypothetical protein / predicted by genscan Length = 120 Score = 49.7 bits (117), Expect = 6e-07 Identities = 24/60 (40%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = +3 Query: 72 LGLLLLPIILLLAIQYLSSDSG--SFVSSIFSAGEPSSIHRASGSPVGVALVLVLVLFLL 245 L L+ P++LLLA+ +LS D G ++S+ E S++RA G+P GVA +LV + F++ Sbjct: 47 LALMASPLLLLLAVHFLSDDQGVGGMMTSLIHLNERESLYRAGGTPWGVAFMLVFLFFMV 106 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,079,781 Number of Sequences: 27288 Number of extensions: 224031 Number of successful extensions: 1375 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1325 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 507397856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA15B17.yg.ab1 (542 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g55010.1 phosphoribosylformylglycinamidine cyclo-ligase precu... 126 6e-30 >At3g55010.1 phosphoribosylformylglycinamidine cyclo-ligase precursor / ; supported by cDNA: gi_16974614_gb_AY060585.1_ Length = 389 Score = 126 bits (317), Expect = 6e-30 Identities = 59/92 (64%), Positives = 75/92 (81%), Gaps = 4/92 (4%) Frame = +2 Query: 2 GGFTDNIPRVFPQGLGARIYNNSWPVLPVFKWIQKAGNIEEAEMKRTFNMGIGMVLVASK 181 GGFTDNIPRVFP GLGA I+ ++W + P+FKWIQ+ G IE++EM+RTFN+GIGMV+V S Sbjct: 298 GGFTDNIPRVFPDGLGAVIHTDAWELPPLFKWIQQTGRIEDSEMRRTFNLGIGMVMVVSP 357 Query: 182 EAAERILSEGE----TAYRIGEVINGDGVTYQ 265 EAA RIL E + AYR+GEV+NG+GV+YQ Sbjct: 358 EAASRILEEVKNGDYVAYRVGEVVNGEGVSYQ 389 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,404,654 Number of Sequences: 27288 Number of extensions: 243997 Number of successful extensions: 710 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 709 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 781156644 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA15H21.yg.ab1 (398 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27100.1 hypothetical protein / predicted by genemark.hmm 62 7e-11 At1g09740.1 putative ER6 protein / similar to GB:AAD46412 fro... 53 6e-08 At2g19370.1 unknown protein / predicted by genscan and genefi... 52 1e-07 >At3g27100.1 hypothetical protein / predicted by genemark.hmm Length = 143 Score = 62.4 bits (150), Expect = 7e-11 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +2 Query: 263 TLEEIINIKLIESGEKERLKELLRERLNECGRKDEMKSLCR 385 TL EIIN+KL+ESGEKE L EL+R+RL ECG KDEM+ CR Sbjct: 54 TLREIINVKLVESGEKENLMELVRDRLVECGWKDEMRIACR 94 >At1g09740.1 putative ER6 protein / similar to GB:AAD46412 from [Lycopersicon esculentum], ESTs gb|ATTS1236,gb|T43334,gb|N97019,gb|AA395203 come from this gene Length = 174 Score = 52.8 bits (125), Expect = 6e-08 Identities = 27/48 (56%), Positives = 34/48 (70%), Gaps = 3/48 (6%) Frame = -1 Query: 143 MTENKKLRCVVVAVDGSEESMKGLQWALDNVKL---HPEGSLVIIHVQ 9 M + L CVVVAVDGSE SM+ L+WALDN+KL + S V++HVQ Sbjct: 1 MDVSGSLNCVVVAVDGSEVSMEALRWALDNLKLSSSSSDSSFVVLHVQ 48 >At2g19370.1 unknown protein / predicted by genscan and genefinder Length = 102 Score = 52.0 bits (123), Expect = 1e-07 Identities = 31/57 (54%), Positives = 35/57 (61%) Frame = +2 Query: 197 ERERGGEREREREREREREREPTLEEIINIKLIESGEKERLKELLRERLNECGRKDE 367 ERERG ERERERERERERERE E + E+ER +E RER E R+ E Sbjct: 2 ERERGSERERERERERERERERERERERERERERERERERERERERERERERERERE 58 Score = 48.9 bits (115), Expect = 8e-07 Identities = 30/56 (53%), Positives = 34/56 (60%) Frame = +2 Query: 194 RERERGGEREREREREREREREPTLEEIINIKLIESGEKERLKELLRERLNECGRK 361 RERER ERERERERERERERE E + E+ER +E RER E R+ Sbjct: 9 RERERERERERERERERERERERERERERERERERERERERERERERERERERERE 64 Score = 48.1 bits (113), Expect = 1e-06 Identities = 30/57 (52%), Positives = 34/57 (59%) Frame = +2 Query: 197 ERERGGEREREREREREREREPTLEEIINIKLIESGEKERLKELLRERLNECGRKDE 367 ERER ERERERERERERERE E + E+ER +E RER E R+ E Sbjct: 8 ERERERERERERERERERERERERERERERERERERERERERERERERERERERERE 64 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,394,298 Number of Sequences: 27288 Number of extensions: 184668 Number of successful extensions: 4444 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 1236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2345 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 401071088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA16G07.yg.ab1 (351 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g42070.1 putative protein / similar to unknown protein (db... 75 5e-15 >At5g42070.1 putative protein / similar to unknown protein (dbj|BAA92898.1);supported by full-length cDNA: Ceres:97314. Length = 164 Score = 75.5 bits (184), Expect = 5e-15 Identities = 36/63 (57%), Positives = 41/63 (64%) Frame = +2 Query: 2 FGWWPIKAYRPCPGFVATGGRYRRQGQSMDEVAGFGSVPRKPANMTTTATATVSTETPSS 181 FGWWPIKAYRPCP FV GGRYRR GQSMDEVA FG K + T+ + + P+S Sbjct: 99 FGWWPIKAYRPCPAFVEAGGRYRRIGQSMDEVA-FGRGDSKSSTSVDTSDSLLRQTKPTS 157 Query: 182 EKK 190 K Sbjct: 158 SSK 160 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,766,031 Number of Sequences: 27288 Number of extensions: 189900 Number of successful extensions: 1355 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1268 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 216146400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA17A01.yg.ab1 (240 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20495.1 similar to Serine/threonine-protein kinase / temp... 72 4e-14 >At2g20495.1 similar to Serine/threonine-protein kinase / temporary automated functional assignment Length = 294 Score = 72.4 bits (176), Expect = 4e-14 Identities = 32/58 (55%), Positives = 46/58 (79%) Frame = +2 Query: 2 LSLLYLTKYYQLMLAILHNKRLRLSPLDITFHLPDLLGSGHLKTIQTPSGLVIRVVKN 175 LSL+ ++ ++ LA L KRLR SPLD+ FH+ DL+GSGHLKT+QT SGL++R++K+ Sbjct: 237 LSLIKRKRHKEMFLAELEKKRLRFSPLDVRFHVRDLIGSGHLKTVQTTSGLIVRILKD 294 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,284,617 Number of Sequences: 27288 Number of extensions: 98844 Number of successful extensions: 221 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 220 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 221 length of database: 11,516,596 effective HSP length: 55 effective length of database: 10,015,756 effective search space used: 240378144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA17D19.yg.ab1 (504 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25400.1 unknown protein / 129 1e-30 >At3g25400.1 unknown protein / Length = 99 Score = 129 bits (323), Expect = 1e-30 Identities = 65/96 (67%), Positives = 74/96 (76%) Frame = +3 Query: 51 VGEVGELSEIFQWKGEVPRGLPGWEDKEKQHLGEELSDVLLYLVRLSDICGVDLGKAALX 230 VGEVGELSEIFQWKGEV RG P W+++EK HLGEELSDVLLYLVRLSD CGVDLGKAAL Sbjct: 4 VGEVGELSEIFQWKGEVARGCPDWKEEEKVHLGEELSDVLLYLVRLSDACGVDLGKAALR 63 Query: 231 KLEINATKYPVKLCKGSSKKHNQIINNSDTSSSNIK 338 K+E+NA KYPV K + + + + SSS IK Sbjct: 64 KIELNAIKYPV-----PKKTDDHCVGDGEDSSSKIK 94 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,772,661 Number of Sequences: 27288 Number of extensions: 223976 Number of successful extensions: 958 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 937 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 675457500 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA17I14.yg.ab1 (525 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16550.1 expressed protein / ; supported by cDNA: gi_1442... 111 2e-25 >At5g16550.1 expressed protein / ; supported by cDNA: gi_14423559_gb_AF387017.1_AF387017 Length = 249 Score = 111 bits (278), Expect = 2e-25 Identities = 51/96 (53%), Positives = 70/96 (72%) Frame = +3 Query: 6 LLALTGMLVFTVVFLAATVNAIVISLLISLAAVGGFLAIFFACMTTMYIGLLFVTAFVTF 185 LL ++VFT+ F+AAT NAI+ISLLISLA GGFLA+FF C+T +YIG L V AFV Sbjct: 124 LLTTMALVVFTLFFVAATANAIIISLLISLAVAGGFLALFFLCLTGVYIGALSVAAFVIS 183 Query: 186 TVTISSIIAALVAAGWIGFIWMIWLAASEGARMVKR 293 T T+S++++ L+A+GWIGF + +WL R+ K+ Sbjct: 184 TATVSAVVSVLIASGWIGFFYAVWLGTRGSLRLAKQ 219 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,159,394 Number of Sequences: 27288 Number of extensions: 242372 Number of successful extensions: 725 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 696 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 727283772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA17I19.yg.ab1 (571 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g42210.1 expressed protein / ; supported by full-length c... 167 3e-42 >At2g42210.1 expressed protein / ; supported by full-length cDNA: Ceres: 28982. Length = 159 Score = 167 bits (424), Expect = 3e-42 Identities = 78/105 (74%), Positives = 91/105 (86%) Frame = +3 Query: 18 PGLVRTLKMMGNHGLTFAAIGGVYIGVEQLTQNYRMKRDFVNGAVGGFVAGAAILGFKGK 197 PGL+RTLKMMG HGLTFAAIGGVYIGVEQL QN+R KRDF NGA+GGFVAGA++LG++ + Sbjct: 53 PGLIRTLKMMGTHGLTFAAIGGVYIGVEQLVQNFRSKRDFYNGAIGGFVAGASVLGYRAR 112 Query: 198 SISTALSAGAALAATSTAIDVGGQTTRVDTGKEYYPYTTKKRVDA 332 SI TA++AGA LA TS ID GGQTTRVD G+EYYPYT +KR +A Sbjct: 113 SIPTAIAAGATLAVTSALIDSGGQTTRVDNGREYYPYTVEKRAEA 157 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,981,679 Number of Sequences: 27288 Number of extensions: 292359 Number of successful extensions: 814 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 809 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 850394780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA17M20.yg.ab1 (726 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g27385.1 Expressed protein / ; supported by full-length cD... 224 4e-59 >At1g27385.1 Expressed protein / ; supported by full-length cDNA: Ceres: 39286. Length = 202 Score = 224 bits (571), Expect = 4e-59 Identities = 120/181 (66%), Positives = 136/181 (74%) Frame = +3 Query: 54 FPFPFSLSFVVNQISTTTPPRCRITRRMHHRFNCSHHDENLSSTEDDGDQEPPQEAVLKV 233 FP P SL F + P R R NCSH+D++ DQ PPQEAVLK Sbjct: 40 FPAPKSLCF---NGFASVPERAT-------RLNCSHNDQS--------DQGPPQEAVLKA 81 Query: 234 ISEVSKTEGRVGQTTNMVLGGTVTDDSSDEWLTLDQKVNTYPTVRGFTAIGTGGDDFVQA 413 ISEVSKT+GRVG+TTNM++GGTV DDS+ +WL LDQKVNTYPT RGFTAIGTGG+DFV A Sbjct: 82 ISEVSKTDGRVGKTTNMIIGGTVADDSAKDWLELDQKVNTYPTERGFTAIGTGGNDFVHA 141 Query: 414 MVIAVESVVQHPIPQGNVKQKMSSGGKYVSVNIGPVQVVSSEQVQAVYNAMRRDVRMKYF 593 MV+AVESV+ IP+ VKQ +SS GKYVSVNIGP+QVVSSEQVQAVYNAMRRD RMKYF Sbjct: 142 MVVAVESVIDRQIPEDCVKQTLSSKGKYVSVNIGPIQVVSSEQVQAVYNAMRRDERMKYF 201 Query: 594 L 596 L Sbjct: 202 L 202 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,353,606 Number of Sequences: 27288 Number of extensions: 389657 Number of successful extensions: 1703 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1670 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1277231040 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA19C23.yg.ab1 (602 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21110.1 G10 - like protein / Maternal G10 like protein, O... 292 1e-79 >At4g21110.1 G10 - like protein / Maternal G10 like protein, Oryza sativa, PATCHX:D1002643; supported by cDNA: gi_15294271_gb_AF410327.1_AF410327 Length = 145 Score = 292 bits (747), Expect = 1e-79 Identities = 127/145 (87%), Positives = 138/145 (94%) Frame = +2 Query: 23 MPKVKTNRVKYPEGWELIEPTLRELQGKMREAENDPHDGKRKCEALWPIFKIAHQKSRYI 202 MPKVKTNRVKYPEGWELIEPTLREL KMREAE D HDGKRKCE LWPIFK++HQ+SRY+ Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELDAKMREAETDSHDGKRKCETLWPIFKVSHQRSRYV 60 Query: 203 YDLYYRRKEISKELFEFCLDQGYADRNIIAKWKKPGYERLCCLRCIQPRDHNFQTTCVCR 382 YDLYYRR+EISKEL+EFCLDQGYADR++IAKWKK GYERLCCLRCIQPRDHN+ TTCVCR Sbjct: 61 YDLYYRREEISKELYEFCLDQGYADRSLIAKWKKSGYERLCCLRCIQPRDHNYGTTCVCR 120 Query: 383 VPKHLREEKVIECVHCGCKGCASGD 457 VPKHLREEKV+ECVHCGC+GCASGD Sbjct: 121 VPKHLREEKVVECVHCGCQGCASGD 145 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,560,626 Number of Sequences: 27288 Number of extensions: 307649 Number of successful extensions: 773 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 771 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 948861544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA1c02.yg.ab1 (391 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g31350.1 F-box protein family / similar to hypothetical pr... 63 5e-11 >At1g31350.1 F-box protein family / similar to hypothetical protein GB:AAF24593 GI:6692128 from [Arabidopsis thaliana] Length = 395 Score = 62.8 bits (151), Expect = 5e-11 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 3/72 (4%) Frame = -2 Query: 210 TTTSSGH-NPTLQLSSFDPISTDWSIITPPTPY--LRHICLRHPSFIARNLPMQSISVAG 40 +T+ +G NP+++ F+P+S+ W + PP P L I RHPSFI+ NLP+Q +S AG Sbjct: 86 STSDTGRVNPSVRFMCFNPVSSKWYPLPPPPPDPPLHRILYRHPSFISFNLPIQCVSAAG 145 Query: 39 NLVLLAGTTGDL 4 L+L+AG+ L Sbjct: 146 KLILIAGSNQQL 157 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,631,892 Number of Sequences: 27288 Number of extensions: 292200 Number of successful extensions: 2222 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2005 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 373725332 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA1c12.yg.ab1 (513 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11980.1 putative protein / predicted protein W02G9.1 Caen... 41 2e-12 At2g05070.1 light-harvesting chlorophyll a/b binding protein /... 53 8e-08 At2g05100.1 light-harvesting chlorophyll a/b binding protein / 52 2e-07 At3g27690.1 light harvesting chlorophyll A/B binding protein, pu... 51 3e-07 At2g34430.1 photosystem II type I chlorophyll a /b binding prot... 49 2e-06 At1g29930.1 light-harvesting chlorophyll a/b binding protein /... 49 2e-06 At1g29920.1 photosystem II type I chlorophyll a /b binding prot... 49 2e-06 At1g29910.1 photosystem II type I chlorophyll a /b binding prot... 49 2e-06 At2g34420.1 photosystem II type I chlorophyll a /b binding prot... 49 2e-06 >At4g11980.1 putative protein / predicted protein W02G9.1 Caenorhabditis elegans cosmid W02G9, PID:g3165571; supported by cDNA: gi_15450340_gb_AY052271.1_ Length = 309 Score = 41.2 bits (95), Expect(3) = 2e-12 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = +1 Query: 163 LWHMTADAKELMSIAIYEMAKKEGLL 240 LW TADAK LMSI +YEMA++EGL+ Sbjct: 275 LWRKTADAKVLMSIGLYEMAQREGLV 300 Score = 35.8 bits (81), Expect(3) = 2e-12 Identities = 15/24 (62%), Positives = 19/24 (78%) Frame = +3 Query: 75 DDIKQMHGKETGLRVHGELIKVHV 146 + I+Q+ GKETGLR HGE IKV + Sbjct: 246 ETIRQLQGKETGLREHGEFIKVRL 269 Score = 30.8 bits (68), Expect(3) = 2e-12 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +2 Query: 8 YPLPGGWDEELSLLMYRG 61 +P PGG DEE+S+ +YRG Sbjct: 224 FPSPGGCDEEMSVFLYRG 241 >At2g05070.1 light-harvesting chlorophyll a/b binding protein / ; supported by cDNA: gi_4741945_gb_AF134123.1_AF134123 Length = 265 Score = 53.1 bits (126), Expect = 8e-08 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPVANNAWSYATNFVP K Sbjct: 229 VQAIVTGKGPIENLFDHLADPVANNAWSYATNFVPGK 265 >At2g05100.1 light-harvesting chlorophyll a/b binding protein / Length = 265 Score = 52.0 bits (123), Expect = 2e-07 Identities = 22/35 (62%), Positives = 28/35 (79%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVP 424 ++++ + +NL DHLADPVANNAWSYATNFVP Sbjct: 229 VQAIVTGKGPIENLFDHLADPVANNAWSYATNFVP 263 >At3g27690.1 light harvesting chlorophyll A/B binding protein, putative / similar to chlorophyll A-B binding protein 151 precursor (LHCP) GB:P27518 from [Gossypium hirsutum];supported by full-length cDNA: Ceres:7700.; supported by cDNA: gi_13899124 Length = 266 Score = 51.2 bits (121), Expect = 3e-07 Identities = 21/37 (56%), Positives = 29/37 (77%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DH+ADPVANNAW+YATNFVP K Sbjct: 230 VQAIVTGKGPIENLFDHIADPVANNAWAYATNFVPGK 266 >At2g34430.1 photosystem II type I chlorophyll a /b binding protein / ; supported by full-length cDNA: Ceres: 23727. Length = 266 Score = 48.5 bits (114), Expect = 2e-06 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPV NNAW++ATNFVP K Sbjct: 230 VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 266 >At1g29930.1 light-harvesting chlorophyll a/b binding protein / similar to photosystem II type I chlorophyll a /b binding protein GI:16364 from [Arabidopsis thaliana]; supported by cDNA: gi_15010743_gb_AY045673.1_ Length = 267 Score = 48.5 bits (114), Expect = 2e-06 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPV NNAW++ATNFVP K Sbjct: 231 VQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK 267 >At1g29920.1 photosystem II type I chlorophyll a /b binding protein, putative / similar to photosystem II type I chlorophyll a /b binding protein GI:16364 from [Arabidopsis thaliana];supported by full-length cDNA: Ceres:29298. Length = 267 Score = 48.5 bits (114), Expect = 2e-06 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPV NNAW++ATNFVP K Sbjct: 231 VQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK 267 >At1g29910.1 photosystem II type I chlorophyll a /b binding protein, putative / similar to photosystem II type I chlorophyll a /b binding protein GI:16364 from [Arabidopsis thaliana] Length = 267 Score = 48.5 bits (114), Expect = 2e-06 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPV NNAW++ATNFVP K Sbjct: 231 VQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK 267 >At2g34420.1 photosystem II type I chlorophyll a /b binding protein / identical to GB:X64460; supported by cDNA: gi_13926259_gb_AF372886.1_AF372886 Length = 265 Score = 48.5 bits (114), Expect = 2e-06 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPV NNAW++ATNFVP K Sbjct: 229 VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 265 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,342,582 Number of Sequences: 27288 Number of extensions: 229764 Number of successful extensions: 587 Number of sequences better than 1.0e-05: 18 Number of HSP's better than 0.0 without gapping: 572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 587 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 702475800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA1g09.yg.ab1 (399 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g38240.1 glycosyltransferase like protein / alpha-1,3-mann... 101 1e-22 >At4g38240.1 glycosyltransferase like protein / alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (EC 2.4.1.101) I - rat,PIR2:JC2076 Length = 457 Score = 101 bits (251), Expect = 1e-22 Identities = 47/67 (70%), Positives = 55/67 (81%) Frame = +1 Query: 1 VNGDVRIHYTDQSHFENIARQFGIFEEWKDGVPRTAYKGIVVFRYQTSKXVXLVGPNSLQ 180 + DVRI Y DQ FE IA +FGIFEEWKDGVPRTAYKG+VVFR QT++ V LVGP+S+ Sbjct: 391 IKDDVRIRYKDQVEFERIAGEFGIFEEWKDGVPRTAYKGVVVFRIQTTRRVFLVGPDSVM 450 Query: 181 QLGIQNS 201 QLGI+NS Sbjct: 451 QLGIRNS 457 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,869,217 Number of Sequences: 27288 Number of extensions: 182329 Number of successful extensions: 345 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 345 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 401071088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA20B23.yg.ab1 (349 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62140.1 hypothetical protein / 70 2e-13 >At3g62140.1 hypothetical protein / Length = 241 Score = 69.7 bits (169), Expect = 2e-13 Identities = 46/108 (42%), Positives = 59/108 (54%), Gaps = 26/108 (24%) Frame = +2 Query: 8 VAAQSAVLHELKESPVAPPK--LQEQQPSGEKKTRARPLGVVIKVKPQPKKAKISTPEE- 178 VAA+SA+LHE KE+ + PP +EQ+P G++ RP +IKVKPQPKKAK + EE Sbjct: 133 VAARSAILHEPKEAALPPPAPVTKEQKPIGKRNPATRPFKAIIKVKPQPKKAKATEKEEK 192 Query: 179 -----SKPSVPVTNV--------VTG----------GLVSYSDESDDD 253 KP+ + VTG LVSYSDES+DD Sbjct: 193 EIPGNGKPASHIDQASLDSVKGNVTGKTTEGLQTGLALVSYSDESEDD 240 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,985,285 Number of Sequences: 27288 Number of extensions: 162620 Number of successful extensions: 541 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 534 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 216801312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA20G20.yg.ab1 (639 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61970.1 signal recognition particle - like protein / sign... 175 2e-44 >At5g61970.1 signal recognition particle - like protein / signal recognition particle 68, Homo sapiens, EMBL:AF195951; supported by cDNA: gi_15293136_gb_AY051002.1_ Length = 605 Score = 175 bits (444), Expect = 2e-44 Identities = 92/155 (59%), Positives = 120/155 (77%), Gaps = 5/155 (3%) Frame = +3 Query: 9 EAYSLFSFARSLAENALKKLRSATSRDQVTIKELETLHNNCRSNSCIEHAMGIMEHEKAP 188 EA++L+S ARSLAE+AL K +S +D+ TI+EL+TL CR+NSCIEHA GIME E+AP Sbjct: 452 EAFALYSRARSLAEDALNKFQSIAKKDEGTIQELKTLIKECRANSCIEHATGIMEEERAP 511 Query: 189 EDLSKKISTVSISGTDRKA-EKFLIEKLDSYESAVGDSSTKVAPRIAAYQPSFQPIARSP 365 E+LS ++ST+S++ T + EK+L++KLD YESAVGDS+TK AP+I + P+ Q I R+P Sbjct: 512 ENLSNRMSTISLNNTAAQVEEKYLLDKLDVYESAVGDSNTKTAPKIERFPPALQSIPRNP 571 Query: 366 IVLDLAYNSIDFPSIDNRMKQDKKGF----ISRLW 458 IVLDLAYN IDFP I+NRMK+ K GF IS LW Sbjct: 572 IVLDLAYNCIDFPVIENRMKK-KGGFFSSRISSLW 605 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,726,792 Number of Sequences: 27288 Number of extensions: 290184 Number of successful extensions: 865 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 831 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1044135612 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA20J16.yg.ab1 (518 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24460.1 unknown protein / ; supported by cDNA: gi_17065179 68 2e-12 >At5g24460.1 unknown protein / ; supported by cDNA: gi_17065179 Length = 300 Score = 68.2 bits (165), Expect = 2e-12 Identities = 37/69 (53%), Positives = 46/69 (66%), Gaps = 5/69 (7%) Frame = +3 Query: 84 VSYPGLPACYILHTVDAYVDGLPEGEFWTEEGDEYEGLGEKEHERCEL-----AVSCKKH 248 +SYPGLPA Y LH+V+A V+GLPE +F TEE EYEG G+ + E AV+ K+H Sbjct: 231 LSYPGLPARYALHSVNATVEGLPEQDFCTEE-KEYEG-GDSTKDSVETLAAGNAVTVKRH 288 Query: 249 YWKWVDEGS 275 YWKWV S Sbjct: 289 YWKWVSPDS 297 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,002,226 Number of Sequences: 27288 Number of extensions: 332186 Number of successful extensions: 1878 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1786 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 720488000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA20P20.yg.ab1 (394 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63135.1 Expressed protein / ; supported by full-length cD... 87 2e-18 >At5g63135.1 Expressed protein / ; supported by full-length cDNA: Ceres: 28326. Length = 99 Score = 87.4 bits (215), Expect = 2e-18 Identities = 42/64 (65%), Positives = 55/64 (85%) Frame = +1 Query: 1 ELLLAIEESELEEKYNDIRKINSNLIVIGKTSVENDKEDFDDEADDDDADNAEESEGDEF 180 E+LLA+EE+E EEK N+IRK++ L VIGK V N++E+ D+EA+DDDADNAEES+G+EF Sbjct: 35 EILLAMEEAEFEEKCNEIRKMSPALPVIGKPVVNNEQEEDDNEAEDDDADNAEESDGEEF 94 Query: 181 EQET 192 EQET Sbjct: 95 EQET 98 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,496,506 Number of Sequences: 27288 Number of extensions: 147491 Number of successful extensions: 3202 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2555 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 382840584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA21B20.yg.ab1 (396 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79810.1 expressed protein / contains similarity to peroxi... 210 2e-55 >At1g79810.1 expressed protein / contains similarity to peroxisome membrane protein PEX2 GI:2623264 from [Mus musculus]; supported by full-length cDNA: Ceres: 118765. Length = 333 Score = 210 bits (534), Expect = 2e-55 Identities = 94/128 (73%), Positives = 112/128 (87%) Frame = +1 Query: 1 RYRNLIERALRARLVYGSPHMNRAVSFEYMNRQLVWNEFSEMLLLLLPILNSASIKSIFR 180 RYRNLIE+AL+ARLVY SPHMNR+VSFEYMNRQLVWNEFSEMLLLLLP+LNS+++K+I Sbjct: 201 RYRNLIEKALKARLVYRSPHMNRSVSFEYMNRQLVWNEFSEMLLLLLPLLNSSAVKNILS 260 Query: 181 PFSKDKSSGSTGDETQCPICHINPTIGYVALPCQHRYCYYCLRTRCAATASFRCSRCSEP 360 PF+KDKSS + D CPIC ++P I ++ALPCQHRYCYYC+RTRCA+ ASFRC RC+EP Sbjct: 261 PFAKDKSSSTKEDTVTCPICQVDPAIPFIALPCQHRYCYYCIRTRCASAASFRCLRCNEP 320 Query: 361 VVAMQPPG 384 VVA+Q G Sbjct: 321 VVAIQREG 328 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,868,866 Number of Sequences: 27288 Number of extensions: 183108 Number of successful extensions: 629 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 391955836 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA22B12.yg.ab1 (461 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30820.1 Expressed protein / ; supported by full-length cD... 65 2e-11 >At4g30820.1 Expressed protein / ; supported by full-length cDNA: Ceres: 14193. Length = 178 Score = 64.7 bits (156), Expect = 2e-11 Identities = 39/70 (55%), Positives = 48/70 (67%), Gaps = 5/70 (7%) Frame = +2 Query: 17 AGGTIPQP-RPT----QPLPMGSGDDLHAYHMDGEETMRLKAERGGKAGGWSLEISRKRA 181 AG T Q RPT QP+P+ G + Y M+ E T R+KAER AGG+SLEIS++RA Sbjct: 112 AGTTYGQASRPTGMGPQPVPIVGGAERQHYAMEDEATRRMKAER---AGGFSLEISKRRA 168 Query: 182 LEEAFASIWI 211 LEEAFASIW+ Sbjct: 169 LEEAFASIWV 178 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,130,143 Number of Sequences: 27288 Number of extensions: 247497 Number of successful extensions: 600 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 599 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 560070056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA2f04.yg.ab1 (551 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25740.1 hypothetical protein / predicted by genscan; supp... 258 2e-69 >At2g25740.1 hypothetical protein / predicted by genscan; supported by cDNA: gi_18377846 Length = 547 Score = 258 bits (658), Expect = 2e-69 Identities = 120/173 (69%), Positives = 142/173 (81%) Frame = +3 Query: 33 RECPRAFWPYWVYRMHDSYCLAQRLSDMWKKIVGTPSMDAFVRQPGLLSFHVASKIPVSE 212 R PRAFWP+W YRM DSY LAQR D+WK+IVG P+M+AFV +P +LSF +ASKIPVSE Sbjct: 354 RMTPRAFWPFWAYRMFDSYYLAQRAVDLWKQIVGVPNMEAFVNKPDILSFSIASKIPVSE 413 Query: 213 STRQELLEIDGISYRLRREIELLENFDQIKCRSCQTLIANRSDMLVMSTDGPLGAYVNPS 392 S RQELLE+DG+SYRL+REIELLE+FD+++C CQT+IA R DMLVMS +GPLGAYVNP Sbjct: 414 SIRQELLELDGVSYRLQREIELLESFDRVRCIHCQTVIARRKDMLVMSNEGPLGAYVNPH 473 Query: 393 GYVHEIMTLLKASGLALIGVPTEEYSWFPGYAWTEAYWATCEYQMGWLLTATN 551 GYVHEIMT KA+ +AL G P ++ SWFPGYAWT A ATCE Q+GW TATN Sbjct: 474 GYVHEIMTFYKANDIALRGRPVKKDSWFPGYAWTIANCATCETQLGWHFTATN 526 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,034,451 Number of Sequences: 27288 Number of extensions: 282382 Number of successful extensions: 773 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 714 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 768 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 808093080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA3h02.yg.ab1 (347 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30900.1 hypothetical protein / ; supported by cDNA: gi_1... 100 1e-22 >At4g30900.1 hypothetical protein / ; supported by cDNA: gi_18958014 Length = 254 Score = 100 bits (250), Expect = 1e-22 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = +3 Query: 3 RQTQDLHIDWILFRGRSLAPVSCEVVNDNIDGHYPSSHYPVFAEFMLPRTVRPLEP 170 RQTQDLH DWIL+RGRS+ PV CE+VND ID YPSSHYPVFAEFMLPR+VR LEP Sbjct: 187 RQTQDLHTDWILYRGRSIVPVMCEIVNDKIDDLYPSSHYPVFAEFMLPRSVRMLEP 242 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,396,810 Number of Sequences: 27288 Number of extensions: 144537 Number of successful extensions: 405 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 216801312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA4f06.yg.ab1 (363 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g08580.1 hypothetical protein / predicted by genscan 65 8e-12 >At1g08580.1 hypothetical protein / predicted by genscan Length = 123 Score = 64.7 bits (156), Expect = 8e-12 Identities = 33/71 (46%), Positives = 48/71 (67%) Frame = +1 Query: 31 RDQKERVEKGLITMEDIEMAVADGSGTSSQQTTTKIHLKKSLKIRTKRSNKKDKKGKKKG 210 R+QK+ VEKGL+TMED+EMA A + S+++ K +KKSLK+ K +NK KK +K Sbjct: 54 REQKDMVEKGLVTMEDVEMASAQAASEDSKKSPRKFSVKKSLKL-NKLNNKGKKKKNQKA 112 Query: 211 TSSASSDVMME 243 + S+D M+E Sbjct: 113 SGEKSADCMLE 123 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,329,298 Number of Sequences: 27288 Number of extensions: 176483 Number of successful extensions: 701 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 699 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 213526752 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA4g03.yg.ab1 (386 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g10780.1 putative protein / HSPC184, Homo sapiens, EMBL:AF... 120 2e-28 >At5g10780.1 putative protein / HSPC184, Homo sapiens, EMBL:AF151018; supported by cDNA: gi_14335059_gb_AY037209.1_ Length = 180 Score = 120 bits (302), Expect = 2e-28 Identities = 55/77 (71%), Positives = 64/77 (82%) Frame = +2 Query: 14 PLWPLYGVGKAFAPYKDSKVDLLAPKLLFIALNLGGMLLGVWKLNALGLLPTHASDWVSS 193 P+ L VGK F P+KD+KV+LL PKL+F+ALNLGG+ LGVWKLN LGLLPTHASDWVSS Sbjct: 104 PISALQSVGKIFEPFKDNKVELLMPKLVFLALNLGGLALGVWKLNTLGLLPTHASDWVSS 163 Query: 194 LPPAREVEYSGGGIALH 244 LPP +EVE+SGGG H Sbjct: 164 LPPPQEVEHSGGGFVFH 180 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,925,886 Number of Sequences: 27288 Number of extensions: 196059 Number of successful extensions: 500 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 500 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 364610080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA6G22.yg.ab1 (313 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g04700.1 putative ferredoxin-thioredoxin reductase / ;sup... 101 8e-23 >At2g04700.1 putative ferredoxin-thioredoxin reductase / ;supported by full-length cDNA: Ceres:40781. Length = 146 Score = 101 bits (251), Expect = 8e-23 Identities = 43/51 (84%), Positives = 46/51 (89%) Frame = +1 Query: 1 EATQGFWNCPCVPMRERKECHCMLFLTPDNDFAGNEQVITMEEIKESTANM 153 E QGFWNCPCVPMRERKECHCMLFLTPDNDFAG +Q IT +EIKE+TANM Sbjct: 96 EVGQGFWNCPCVPMRERKECHCMLFLTPDNDFAGKDQTITSDEIKETTANM 146 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,210,724 Number of Sequences: 27288 Number of extensions: 145369 Number of successful extensions: 263 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 263 length of database: 11,516,596 effective HSP length: 79 effective length of database: 9,360,844 effective search space used: 224660256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA6N18.yg.ab1 (500 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27050.1 expressed protein / ; supported by cDNA: gi_13937... 116 7e-27 >At3g27050.1 expressed protein / ; supported by cDNA: gi_13937132_gb_AF372920.1_AF372920 Length = 182 Score = 116 bits (290), Expect = 7e-27 Identities = 57/96 (59%), Positives = 77/96 (79%), Gaps = 1/96 (1%) Frame = +3 Query: 3 KINMEYENDQDLMISFYKFVAKEEMVCEEAELGPDEYAERLQSQQTLHQQQLEMLKHMRN 182 K+N YEND++LMI FYKF+AKEEM CEEAELG D + +++++ Q L +QQLEMLK+MR Sbjct: 74 KLNSAYENDKELMIGFYKFLAKEEMACEEAELGQDGFEQKMKALQQLQEQQLEMLKYMRK 133 Query: 183 YGADDQSAILETLRQKMEKE-FESEASLLSVEEIKE 287 + DDQSAIL+ L++++E FE EASLLS EE++E Sbjct: 134 FSLDDQSAILQKLQKQLENAGFEPEASLLSGEEMEE 169 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,696,648 Number of Sequences: 27288 Number of extensions: 216400 Number of successful extensions: 822 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 791 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 666451400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA7F05.yg.ab1 (321 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48720.1 putative protein / similar to unknown protein (gb... 95 6e-21 >At5g48720.1 putative protein / similar to unknown protein (gb|AAD20092.1) Length = 286 Score = 95.1 bits (235), Expect = 6e-21 Identities = 49/107 (45%), Positives = 70/107 (64%) Frame = +1 Query: 1 GLHPSSEEWLADCLINDTEMHLHVDDMNPSGSTGGQIDLTESNNSEPENGCGTGQKLPTP 180 GL +EEW ADCL ND E + DD+N GS Q+D++E N PE Q+ T Sbjct: 131 GLDLYAEEWYADCL-NDAETPMLPDDLN-FGSPDVQVDISEYLNVPPETETREVQRPVTR 188 Query: 181 TSKNIVFKGKRSCIKTPTKMTSSVVRPFAFVKPCGMQGAVTIKDINQ 321 +S N++FKG++S + +K+ SS++ PFAF+KPCG+ G +T+KDINQ Sbjct: 189 SSPNVIFKGRKSFSRPVSKLPSSIIYPFAFIKPCGVHGGMTLKDINQ 235 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.312 0.131 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,654,460 Number of Sequences: 27288 Number of extensions: 167301 Number of successful extensions: 387 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 386 length of database: 11,516,596 effective HSP length: 82 effective length of database: 9,278,980 effective search space used: 222695520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA7G06.yg.ab1 (362 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28260.1 putative protein / 74 1e-14 >At4g28260.1 putative protein / Length = 516 Score = 73.9 bits (180), Expect = 1e-14 Identities = 35/76 (46%), Positives = 52/76 (68%), Gaps = 5/76 (6%) Frame = +3 Query: 3 TGIELGGDELEKPTVSLSEMFKYKMKASDGHKEYIKAPELLQNCSTGFYFPSQSEEAMQ- 179 TGI + G +E+ T LS+ +++++K S+G K ++K PE L+NCSTGF+FP Q+EE Q Sbjct: 437 TGINIEGAVIERDTFPLSQTWRFQVKVSEGRKAWVKNPERLKNCSTGFHFPQQAEETEQI 496 Query: 180 ----ENVSPLKLLRFY 215 E V +KL+RFY Sbjct: 497 PVQEERVQMMKLVRFY 512 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,894,478 Number of Sequences: 27288 Number of extensions: 161995 Number of successful extensions: 434 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 213526752 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA7G20.yg.ab1 (666 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79790.1 expressed protein / ; supported by full-length cD... 181 3e-46 >At1g79790.1 expressed protein / ; supported by full-length cDNA: Ceres: 268411. Length = 245 Score = 181 bits (459), Expect = 3e-46 Identities = 96/180 (53%), Positives = 116/180 (64%) Frame = +2 Query: 2 LIDEMELARIFFKDGRHFDLEGLKSCIYQGYSYIEGVEELLSTLKDNGYEIHAFTNYPIW 181 LIDE ELAR FF DGR FDLEGLK C+ GYSY++G++ELL TL + +EIHAFTNYPIW Sbjct: 94 LIDEEELARNFFIDGRDFDLEGLKECMRSGYSYLDGMQELLQTLAADDFEIHAFTNYPIW 153 Query: 182 YG*TARYKMIEDKLKLSSYLSWTFCSCVIGKYKT*ST*YQNTTFMCFSV*RYCRSINVGK 361 Y +IEDKLKLS+YLSWTFCSC+ GK Sbjct: 154 YN------IIEDKLKLSAYLSWTFCSCI-----------------------------AGK 178 Query: 362 RKPDPLFYSEVLQHLDTEPQNCVFIDDRLKNIEAAKDAGIIGIQFKNAHSLQQDLSLLGI 541 RKPDP FY EV+ HL EP +C+FIDDR N++ A + G+ G+ F+NA SL +DLS LGI Sbjct: 179 RKPDPEFYLEVVGHLGVEPCDCIFIDDRPTNVKCAIEIGMGGLCFENADSLAKDLSDLGI 238 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,171,064 Number of Sequences: 27288 Number of extensions: 300541 Number of successful extensions: 756 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 732 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1112118500 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA7M13.yg.ab1 (501 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53850.1 putative protein / contains similarity to enolase... 201 2e-52 >At5g53850.1 putative protein / contains similarity to enolase-phosphatase Length = 507 Score = 201 bits (510), Expect = 2e-52 Identities = 92/133 (69%), Positives = 116/133 (87%) Frame = +1 Query: 1 FEKNVIKGVVYDDVVQAFERWHASGVKVYIYSSGSRLAQRLIFGYTNYGDLRKYLCGFFD 180 FE + +K +V++DV A E+WH+SG+KVYIYSSGSRLAQ+L+FG T+YGDLRKY+ GFFD Sbjct: 375 FECDELKAIVFEDVADALEKWHSSGIKVYIYSSGSRLAQKLLFGNTDYGDLRKYISGFFD 434 Query: 181 TKVGNKRETKSYVEISESLGVDKPSEVLFVTDVVQEAVAAKAAGLEVIISVRPGNAPLPE 360 T +GNK+E++SY EI E+LGVD P+E++FVTDV QEAVAAKAAGLE IIS+RPGNAPLPE Sbjct: 435 TTIGNKKESRSYKEIKETLGVDDPAEIMFVTDVYQEAVAAKAAGLEAIISIRPGNAPLPE 494 Query: 361 NHGCDTVETFTEI 399 NHG TV +F++I Sbjct: 495 NHGFKTVTSFSQI 507 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,241,250 Number of Sequences: 27288 Number of extensions: 240509 Number of successful extensions: 716 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 715 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 666451400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA8L15.yg.ab1 (493 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g63980.1 expressed protein / similar to hypothetical prote... 84 4e-17 >At1g63980.1 expressed protein / similar to hypothetical protein GB:AAF07360 from [Arabidopsis thaliana]; supported by cDNA: gi_15810007_gb_AY054272.1_ Length = 391 Score = 84.0 bits (206), Expect = 4e-17 Identities = 53/135 (39%), Positives = 77/135 (56%), Gaps = 29/135 (21%) Frame = +1 Query: 1 VHFQGKKTSFS-----------DSESQESESEPEPEPEDNN----------GKRS----- 102 V ++GKKTSF D E E E E E E +D++ KR Sbjct: 254 VRYEGKKTSFDNSDDDDDDDDDDDEEDEEEDEDESEADDDDKDSVIESSLPAKRKHDEII 313 Query: 103 ESKLKLKKLCKKLLSQEPERS--LKLKQLMALVDEHH-SIFNNFSSKKHALAFFKNKLES 273 E K+KLK LCK+++ ++ + +KLKQL +L+DE S+ + FSS+K A+A+ K KLE Sbjct: 314 EPKIKLKNLCKQIVKKDAGKGGFMKLKQLKSLIDEQAPSVLSEFSSRKDAIAYLKLKLER 373 Query: 274 SSKFIVEGKRVRLMS 318 S KF+VEGK++ L+S Sbjct: 374 SGKFVVEGKKISLVS 388 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,153,187 Number of Sequences: 27288 Number of extensions: 179135 Number of successful extensions: 1043 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1024 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 639433100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA8M14.yg.ab1 (397 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76150.1 hypothetical protein / contains similarity to 17-... 116 4e-27 >At1g76150.1 hypothetical protein / contains similarity to 17-beta-hydroxysteroid dehydrogenase type IV GI:2315980 from [Gallus gallus]; supported by cDNA: gi_17979530 Length = 309 Score = 116 bits (290), Expect = 4e-27 Identities = 55/77 (71%), Positives = 64/77 (82%) Frame = +1 Query: 1 LCTLGFAVRAIIKTICNGDANLVKAISGRFLLHVYPGETLITEMWLQGSRVLYQTKVKER 180 LCTLGFA++AIIK +C GD VK ISGRFL V+PGETLITEMWL+G RV+YQTKVKER Sbjct: 232 LCTLGFAIKAIIKCVCKGDPTAVKTISGRFLTTVFPGETLITEMWLEGLRVIYQTKVKER 291 Query: 181 NRAVLAGFVDLDQLRSS 231 N+ VLAG+VD+ L SS Sbjct: 292 NKTVLAGYVDIRGLSSS 308 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,708,315 Number of Sequences: 27288 Number of extensions: 167577 Number of successful extensions: 417 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 391955836 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA9A15.yg.ab1 (769 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34280.1 putative protein / damage-specific DNA binding pr... 271 3e-73 >At4g34280.1 putative protein / damage-specific DNA binding protein 2, Homo sapiens ,PIR2:I38909 Length = 748 Score = 271 bits (693), Expect = 3e-73 Identities = 135/190 (71%), Positives = 155/190 (81%), Gaps = 2/190 (1%) Frame = +3 Query: 3 HINVVKFANHSPSMFATSSFDHDVKMWDLRQKPIHPCYTVSSGRGNVMVCFSPDDHYLLA 182 HINVVKF+NHSP +FATSSFD DVK+WDLRQ+P PCYT SS +GNVMVCFSPDD YLLA Sbjct: 538 HINVVKFSNHSPFLFATSSFDKDVKLWDLRQEPSRPCYTASSTKGNVMVCFSPDDRYLLA 597 Query: 183 SAVDNEVKQLLAVDGRLHLDFGIPPTGSSQNYTRSYYMNGRDYILSGSCDEHVVRICSAQ 362 SAVDNEV+QLL VDGRLHL+F I P SS NYTRSYYMNG DYI+SGSCDE+V+R+C AQ Sbjct: 598 SAVDNEVRQLLTVDGRLHLNFEIVPRVSSMNYTRSYYMNGNDYIISGSCDENVIRVCCAQ 657 Query: 363 TGRRLRDISLEGRSSG-SSMFVQSLRGDPFRDFNLSVLAAYLSPNSSPEIVKVNM-LTSK 536 TGRRLRD++LEG S S M+VQSLRGDPFRDFN+SVLAAY +S EIVK+ + S Sbjct: 658 TGRRLRDVTLEGNGSDFSMMYVQSLRGDPFRDFNMSVLAAYARSSSLSEIVKIKFPILST 717 Query: 537 DADKDSLSDE 566 DK+ + E Sbjct: 718 VDDKNVTAGE 727 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,976,240 Number of Sequences: 27288 Number of extensions: 377162 Number of successful extensions: 1049 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 983 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1041 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1401406280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA9D19.yg.ab1 (664 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25605.1 hypothetical protein / predicted by genscan+ 195 2e-50 >At2g25605.1 hypothetical protein / predicted by genscan+ Length = 191 Score = 195 bits (495), Expect = 2e-50 Identities = 98/159 (61%), Positives = 112/159 (69%), Gaps = 12/159 (7%) Frame = +1 Query: 1 KRPFGPRLSFNAEECVQYQLDALMLNDQPRPDYGVEVMYRFAGFDPFERSLYFGPSFDLG 180 KRPFGPRL F+AE+ V++QLDAL ND PR DYG+EVMYRF Sbjct: 54 KRPFGPRLDFSAEDAVRHQLDALKYNDHPRDDYGIEVMYRF------------------- 94 Query: 181 QFERFRRIFHHSSYRVLLNHKERKILSTLNVEE------------NRYKQRVWIRGARPE 324 ERFRRIFHHSSYRVLL HK+RK+LS+L VEE NR+KQR+WI+G RPE Sbjct: 95 --ERFRRIFHHSSYRVLLGHKDRKLLSSLFVEESSPHDILFFDMQNRFKQRIWIQGNRPE 152 Query: 325 EEETFQFTMVQRVGGFWDGYWLTESLHHDGDSFSGGVAY 441 EEE F+FTM QR+GG WDGYWLTESL HDGD FSGG+AY Sbjct: 153 EEEIFEFTMFQRIGGSWDGYWLTESLLHDGDVFSGGMAY 191 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 L