BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA10A15.yg.ab1 (508 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79140.1 unknown protein / 140 2e-44 >At1g79140.1 unknown protein / Length = 311 Score = 140 bits (352), Expect(2) = 2e-44 Identities = 66/104 (63%), Positives = 86/104 (82%) Frame = +1 Query: 133 RDLLXNDSGGGSLSGSIAKYQPYASDPNLSGAFATVLWELSGLSKHYHPSVSTMASGISN 312 R+LL ND+GGGS+SGSIAKYQPYA+DPNLSGA ATVLWELS LSKHYHP++STMA+ +SN Sbjct: 137 RNLLENDAGGGSVSGSIAKYQPYATDPNLSGALATVLWELSLLSKHYHPAISTMATTVSN 196 Query: 313 MANANNQGYGASISPQQAFSDMTLDKEKFTVKTTQKQSNSKRKR 444 M + +Q + ++++PQQAF+D +L KE F K ++ N+KRKR Sbjct: 197 MNTSQSQTFLSAVTPQQAFADFSLVKESFEPKNESRKLNNKRKR 240 Score = 56.2 bits (134), Expect(2) = 2e-44 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 18 QRAAAFIKRLASFSLCFGAAESMAALVTLKHLLXK 122 Q+AAAF+KRLA+F+LCFG AESM+ALVTLK LL K Sbjct: 98 QKAAAFVKRLATFALCFGCAESMSALVTLKTLLQK 132 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.314 0.130 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,632,497 Number of Sequences: 27288 Number of extensions: 284754 Number of successful extensions: 827 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 827 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 684463600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA10F21.yg.ab1 (560 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g33270.1 expressed protein / contains Patatin domain PF01734 66 1e-11 >At1g33270.1 expressed protein / contains Patatin domain PF01734 Length = 364 Score = 65.9 bits (159), Expect = 1e-11 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +3 Query: 9 RELFNWALEPAADSILDNLYELGYMDAAVWAASNPVEDLVQEDNLT 146 R+L NWALEPA D +L+ L+ELGY DAA WA NPVE LV +D T Sbjct: 312 RQLLNWALEPAEDEVLERLFELGYADAATWAEMNPVEGLVYDDTPT 357 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,423,879 Number of Sequences: 27288 Number of extensions: 239141 Number of successful extensions: 639 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 636 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 835029516 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA10O14.yg.ab1 (297 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20600.1 putative protein / ; supported by cDNA: gi_19310... 68 1e-12 >At5g20600.1 putative protein / ; supported by cDNA: gi_19310468 Length = 274 Score = 67.8 bits (164), Expect = 1e-12 Identities = 42/101 (41%), Positives = 57/101 (55%), Gaps = 5/101 (4%) Frame = +1 Query: 1 KFYDLGSGSEWFQGNRKGLVGLNKEFLKLEKELEASGVDVMFPTVEGDDGDLEGPDLVPI 180 +FY+LGS E QGNRK + L+KEFL+LEK++ +S ++V D E P+ VP+ Sbjct: 6 RFYELGSSPECHQGNRKLIFALHKEFLQLEKDMSSSSIEVSIVEASRPGND-EVPESVPV 64 Query: 181 GGRGT---QNSSGLLLEGSKSVAEGSKKSSKKKKK--KKGA 288 T S ++ GS S +G KK SK KK KKGA Sbjct: 65 SESNTNVVSKSKKIVANGSSSKKKGLKKCSKTKKDSVKKGA 105 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.306 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,025,754 Number of Sequences: 27288 Number of extensions: 215359 Number of successful extensions: 1532 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1321 length of database: 11,516,596 effective HSP length: 74 effective length of database: 9,497,284 effective search space used: 227934816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.9 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA11C07.yg.ab1 (378 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05000.1 unknown protein / similar to GB:CAB05547 [Caenorh... 89 8e-19 >At3g05000.1 unknown protein / similar to GB:CAB05547 [Caenorhabditis elegans] Length = 173 Score = 88.6 bits (218), Expect = 8e-19 Identities = 42/64 (65%), Positives = 52/64 (80%), Gaps = 2/64 (3%) Frame = +2 Query: 2 EPSTE--TRGSATEAGNKAAETTGMHLYFPCGIIRGALSNMGIPCAVSADISNLPACSFV 175 +PS+E T+ +T +KAA+ M+LYFPCGIIRG LSN+GIPCAVSADIS+LP CSFV Sbjct: 109 DPSSENETQDPSTPGESKAAQAVSMYLYFPCGIIRGVLSNLGIPCAVSADISSLPTCSFV 168 Query: 176 IRIK 187 IR+K Sbjct: 169 IRVK 172 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,762,930 Number of Sequences: 27288 Number of extensions: 182066 Number of successful extensions: 474 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 474 length of database: 11,516,596 effective HSP length: 87 effective length of database: 9,142,540 effective search space used: 347416520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA11D11.yg.ab1 (440 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g16810.1 expressed protein / ;supported by full-length cDN... 99 7e-22 >At1g16810.1 expressed protein / ;supported by full-length cDNA: Ceres:4887. Length = 144 Score = 99.4 bits (246), Expect = 7e-22 Identities = 49/81 (60%), Positives = 63/81 (77%), Gaps = 7/81 (8%) Frame = +2 Query: 11 EEELNDGSSSKAKGGAHV-------DSLTPAEKRYMEQRQKIDMQKMAKTSNKSHRDRLS 169 +EE+N S KA A + D LTPAE+RY+EQ+Q++D+QK+AK +NKSHR+R+ Sbjct: 66 DEEMN--RSEKASEDAKLQQQLDDDDHLTPAERRYIEQKQRLDVQKLAKEANKSHRNRIE 123 Query: 170 EFNQYLANMSEHYDIPKVGPG 232 +FNQYLANMSEHYDIPKVGPG Sbjct: 124 DFNQYLANMSEHYDIPKVGPG 144 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,479,275 Number of Sequences: 27288 Number of extensions: 183525 Number of successful extensions: 478 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 472 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 478 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 507397856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA11M21.yg.ab1 (301 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g23570.1 putative protein / similar to unknown protein (em... 113 2e-26 >At5g23570.1 putative protein / similar to unknown protein (emb|CAB62356.1) Length = 625 Score = 113 bits (282), Expect = 2e-26 Identities = 57/100 (57%), Positives = 73/100 (73%) Frame = +2 Query: 2 MSVLIFDTSAVGYFNAERLSNHFNRQGLDKNAWNHHPNLFTPDCKRQLYGFMATKQDLDI 181 MSVL+F++SA GY AERL GLD+ AW ++F+ RQLYGF+ATKQDLDI Sbjct: 354 MSVLMFESSATGYLEAERLHRELAEMGLDRIAWGQKRSMFSGGV-RQLYGFLATKQDLDI 412 Query: 182 LNQHSPGKLKLKFELASYQEKVVDQLKKMSEDSQELLRYK 301 NQHS GK +LKFEL SYQE VV +L+++SED+Q+L +K Sbjct: 413 FNQHSQGKTRLKFELKSYQEMVVKELRQISEDNQQLNYFK 452 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,326,125 Number of Sequences: 27288 Number of extensions: 115034 Number of successful extensions: 319 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 318 length of database: 11,516,596 effective HSP length: 75 effective length of database: 9,469,996 effective search space used: 227279904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA12B16.yg.ab1 (424 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g05060.1 expressed protein / ;supported by full-length cDN... 123 3e-29 >At1g05060.1 expressed protein / ;supported by full-length cDNA: Ceres:37455. Length = 253 Score = 123 bits (309), Expect = 3e-29 Identities = 59/97 (60%), Positives = 75/97 (76%), Gaps = 2/97 (2%) Frame = +1 Query: 1 LSQIAKAFAAATALIFGGATLTIGLAVSQLELHTTDDIRTKGKDIVQPKFESIKERVTPL 180 L I KAFAAAT +IFG ATL G A S+L++ DDIRTKGKD+ QPK ES+KE+V PL Sbjct: 156 LQHIGKAFAAATIIIFGSATLVFGTAASKLDMRNADDIRTKGKDLFQPKLESMKEQVEPL 215 Query: 181 RTWAEDVANKWHIKTE--EDIKEKPLIKELSRMMGAK 285 RTWAE+++ KWHI+ E IKEKP++KELS+++G K Sbjct: 216 RTWAENMSKKWHIENEGGNTIKEKPILKELSKILGPK 252 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,897,827 Number of Sequences: 27288 Number of extensions: 178183 Number of successful extensions: 526 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 524 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 463486164 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA12P03.yg.ab1 (684 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30790.1 putative protein / 186 1e-47 >At4g30790.1 putative protein / Length = 1148 Score = 186 bits (471), Expect = 1e-47 Identities = 101/178 (56%), Positives = 117/178 (64%), Gaps = 40/178 (22%) Frame = +3 Query: 3 ELIDRYTKTEASHEQLTKELEEKKDLVNALYMKLQSEKQVNKEKITFGRLELHEIAAFVL 182 EL+++ EA+ EQ K+LEEKK+LV LY K Q KQ NKEKI+FGRLE+HEIAAFVL Sbjct: 967 ELLEKCQNLEATSEQTRKDLEEKKELVKTLYTKHQLGKQANKEKISFGRLEVHEIAAFVL 1026 Query: 183 NEAGHYEAINRNCTHYYLSSESVALFTDHLPHQPTHIVGQIVHIERQTVK--------SS 338 N+AGHYEAINRNC +YYLSSES ALFTDHLP +PT+IVGQIVHIERQ VK +S Sbjct: 1027 NQAGHYEAINRNCPNYYLSSESEALFTDHLPSRPTYIVGQIVHIERQIVKLPSQLSASAS 1086 Query: 339 PV--------------------------------PYGLPVGCEYFVVTVAMIPDTAIH 416 P PYGL GCEYF+VT+AM+PDTAIH Sbjct: 1087 PEAGKTHHLCSDQGSRTLASSSISTSTSATTTSNPYGLSSGCEYFIVTIAMLPDTAIH 1144 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,710,622 Number of Sequences: 27288 Number of extensions: 360203 Number of successful extensions: 1029 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1029 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1165500188 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13C12.yg.ab1 (407 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79040.1 photosystem II polypeptide, putative / similar to... 151 1e-37 >At1g79040.1 photosystem II polypeptide, putative / similar to photosystem II polypeptide GI:967967 from [Brassica rapa];supported by full-length cDNA: Ceres:110067. Length = 140 Score = 151 bits (382), Expect = 1e-37 Identities = 72/87 (82%), Positives = 78/87 (88%) Frame = +1 Query: 1 GVNGGMALRDGLDASGRKPKGKGVYQYVDKYGANVDGYSPIYNEDEWSPSGDVYVGGKTG 180 G+NG M LRDG+DASGRK KG GVY+YVDKYGANVDGYSPIYNE+EWS SGDVY GG TG Sbjct: 54 GINGSMDLRDGVDASGRKGKGYGVYKYVDKYGANVDGYSPIYNENEWSASGDVYKGGVTG 113 Query: 181 LLIWAITLAGILGGGALLVYSTSALAQ 261 L IWA+TLAGIL GGALLVY+TSALAQ Sbjct: 114 LAIWAVTLAGILAGGALLVYNTSALAQ 140 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,552,365 Number of Sequences: 27288 Number of extensions: 218716 Number of successful extensions: 591 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 591 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 418046344 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13F19.yg.ab1 (653 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26280.1 unknown protein / 246 1e-65 At5g58720.1 putative PRL1 associated protein / ;supported by... 58 4e-09 >At2g26280.1 unknown protein / Length = 567 Score = 246 bits (627), Expect = 1e-65 Identities = 123/157 (78%), Positives = 136/157 (86%) Frame = +3 Query: 3 EARDHARLRNSYFEQARQAYLVGQKALAKELSAKGQLHNMQMKAAHEKAQESIYYQRNPG 182 EARD+ARLRN YFEQARQAYLVG KALAKELS KGQLHNMQMKAAH KAQE+IY QRNP Sbjct: 414 EARDYARLRNVYFEQARQAYLVGNKALAKELSVKGQLHNMQMKAAHGKAQEAIYRQRNPV 473 Query: 183 SLDIQGNGRGQERIIDLHGLHVNEAIHVLKRDLMTLRNIARSTDQRLQAYICVGTGHHTK 362 QGN RG ER+IDLHGLHV+EA+ VLK +L LR+ AR+T +RLQ YICVGTGHHT+ Sbjct: 474 G---QGNSRGNERMIDLHGLHVSEALQVLKHELSVLRSTARATQERLQIYICVGTGHHTR 530 Query: 363 GTRTPARLPVAVQRYLLEVEGLDYSEPQPGLLRVVLY 473 G+RTPARLPVAVQRYLLE EGLDYSEPQ GLLRV++Y Sbjct: 531 GSRTPARLPVAVQRYLLEEEGLDYSEPQAGLLRVIIY 567 >At5g58720.1 putative PRL1 associated protein / ;supported by full-length cDNA: Ceres:150336. Length = 519 Score = 58.2 bits (139), Expect = 4e-09 Identities = 48/155 (30%), Positives = 71/155 (44%) Frame = +3 Query: 6 ARDHARLRNSYFEQARQAYLVGQKALAKELSAKGQLHNMQMKAAHEKAQESIYYQRNPGS 185 A D + SY+++A +AY G +A A LS KG++ + Q + A E+A + I+ RN G Sbjct: 363 ANDQWNVTKSYYQKAAEAYSKGGRAHAAYLSDKGRVASKQAQRADERASQDIFVARNKGI 422 Query: 186 LDIQGNGRGQERIIDLHGLHVNEAIHVLKRDLMTLRNIARSTDQRLQAYICVGTGHHTKG 365 ++ IDLHG HV A+ +LK L+ + R + G G G Sbjct: 423 ENVV--------TIDLHGQHVKPAMKLLKLHLLFGSYVPSIQTLR----VITGCGASGFG 470 Query: 366 TRTPARLPVAVQRYLLEVEGLDYSEPQPGLLRVVL 470 + V LLE EG+ Y E G L + L Sbjct: 471 KSKVKQSVVK----LLEREGVRYCEENRGTLLIKL 501 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,061,380 Number of Sequences: 27288 Number of extensions: 307032 Number of successful extensions: 776 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 773 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1088756792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13G18.yg.ab1 (750 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g36305.1 similar to CAAX prenyl protease 2 / temporary aut... 216 1e-56 >At2g36305.1 similar to CAAX prenyl protease 2 / temporary automated functional assignment Length = 242 Score = 216 bits (550), Expect = 1e-56 Identities = 100/169 (59%), Positives = 122/169 (72%) Frame = +3 Query: 57 NWMVSAVYDISVWRMYIVAPVTEELVFRACMISLLLCGGFKAYTVILLSPVLFSLAHLNH 236 +W S + + R +APVTEELVFR+CMI LLLC GF+ T I L PVLFSLAHLNH Sbjct: 73 SWEASYILGVYGIRKDHLAPVTEELVFRSCMIPLLLCAGFRINTAIFLCPVLFSLAHLNH 132 Query: 237 LLEYYMQQNTSLLKASMVVGFQLGYTVIFGSYASFLFVRTGHIAAPLVSHIFCNIMGLPA 416 E Y++ N S L+AS++VG QLGYTVIFG+YASFLF+RTGH+AAPL +HIFCN MGLP Sbjct: 133 FREMYIRHNRSYLRASLIVGLQLGYTVIFGAYASFLFIRTGHLAAPLFAHIFCNYMGLPV 192 Query: 417 FFSRRTWLVGVGFVAGAISFVYLLFPLTSPALYNDRTDNCECWHTYCYW 563 ++ LV F+ G + FV LLFPLT P +YND T++C CW YC W Sbjct: 193 LYANGKGLVSAAFLGGVVGFVLLLFPLTKPLMYNDSTNDCPCWLGYCLW 241 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,296,826 Number of Sequences: 27288 Number of extensions: 389148 Number of successful extensions: 1073 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1031 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1073 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13H06.yg.ab1 (495 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g04305.1 hypothetical protein / predicted by genefinder; s... 110 1e-26 >At2g04305.1 hypothetical protein / predicted by genefinder; supported by cDNA: gi_19310533 Length = 434 Score = 110 bits (274), Expect(2) = 1e-26 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = +3 Query: 51 SLEELIGRLRRLKENVGFISNRVTAVQAGLDSWLAEQINRKLYCLSFLSIIFLPLSIITG 230 SLEELIGRLRRLKENVGFI+NRVTA+QAGLDSW AEQINRKLY LSFLSIIFLPLSIITG Sbjct: 289 SLEELIGRLRRLKENVGFIANRVTAIQAGLDSWQAEQINRKLYYLSFLSIIFLPLSIITG 348 Score = 26.6 bits (57), Expect(2) = 1e-26 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 2 VKEKCSVKDWFGTVDI 49 VKEKCS K WF DI Sbjct: 272 VKEKCSTKPWFLAEDI 287 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,889,533 Number of Sequences: 27288 Number of extensions: 224717 Number of successful extensions: 626 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 648439200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13J10.yg.ab1 (514 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54440.1 unknown protein / ; supported by cDNA: gi_20259378 114 2e-26 >At5g54440.1 unknown protein / ; supported by cDNA: gi_20259378 Length = 829 Score = 114 bits (286), Expect = 2e-26 Identities = 52/69 (75%), Positives = 60/69 (86%) Frame = +1 Query: 1 RKQGHVPLSIKQGSRIEISILCVPLTAGYVRPPQLELPNIGDANISCNPAGPHLVCVFPP 180 RK+GHV LS +QGSR+ ISILCVPL AGYVRPPQL LPN+ +AN+S NP+GPHLVCV PP Sbjct: 759 RKRGHVSLSEEQGSRVVISILCVPLVAGYVRPPQLGLPNVEEANVSSNPSGPHLVCVLPP 818 Query: 181 PLSSSYCIP 207 LSSSYC+P Sbjct: 819 LLSSSYCLP 827 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,884,317 Number of Sequences: 27288 Number of extensions: 273014 Number of successful extensions: 638 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 638 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 702475800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA13O06.yg.ab1 (513 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g07910.1 expressed protein / ;supported by full-length cD... 127 3e-30 At4g33650.1 dynamin-like protein ADL2 / supported by cDNA gi:... 50 9e-07 At2g14120.2 dynamin-like protein / 47 7e-06 At2g14120.1 dynamin-like protein / 47 7e-06 >At3g07910.1 expressed protein / ;supported by full-length cDNA: Ceres:24905. Length = 74 Score = 127 bits (320), Expect = 3e-30 Identities = 59/74 (79%), Positives = 70/74 (93%) Frame = +2 Query: 110 VAKDSCLARVTAGVAVGGAVGGAVGAVYGTYEAVKFEVPGLMKIRYIGETTLGSAAIFGL 289 +AK+SCLA++TAGVAVGGA+GGAVGAVYGTYEA++ +VPGL K+R+IG+TTL SAAIFGL Sbjct: 1 MAKNSCLAKITAGVAVGGALGGAVGAVYGTYEAIRVKVPGLHKVRFIGQTTLSSAAIFGL 60 Query: 290 FLGAGSLIHCGKSY 331 FLGAGSLIHCGK Y Sbjct: 61 FLGAGSLIHCGKGY 74 >At4g33650.1 dynamin-like protein ADL2 / supported by cDNA gi:19032336 Length = 808 Score = 49.7 bits (117), Expect = 9e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 93 VEENKGYFDKQIRLKIFSPNVLDITLVDLPG 1 V ENKG D QIRLKI SPNVL+ITLVDLPG Sbjct: 145 VGENKGVADTQIRLKISSPNVLNITLVDLPG 175 >At2g14120.2 dynamin-like protein / Length = 370 Score = 46.6 bits (109), Expect = 7e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -1 Query: 87 ENKGYFDKQIRLKIFSPNVLDITLVDLPG 1 ENKG D I LKIFSPNVLDI+LVDLPG Sbjct: 132 ENKGVSDIPIGLKIFSPNVLDISLVDLPG 160 >At2g14120.1 dynamin-like protein / Length = 780 Score = 46.6 bits (109), Expect = 7e-06 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -1 Query: 87 ENKGYFDKQIRLKIFSPNVLDITLVDLPG 1 ENKG D I LKIFSPNVLDI+LVDLPG Sbjct: 132 ENKGVSDIPIGLKIFSPNVLDISLVDLPG 160 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,775,481 Number of Sequences: 27288 Number of extensions: 272827 Number of successful extensions: 1461 Number of sequences better than 1.0e-05: 8 Number of HSP's better than 0.0 without gapping: 1107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1379 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 702475800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA14A15.yg.ab1 (616 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g14260.1 proline iminopeptidase / identical to GP:1710151:... 247 3e-66 >At2g14260.1 proline iminopeptidase / identical to GP:1710151:U72711; supported by cDNA: gi_15450388_gb_AY052295.1_ Length = 329 Score = 247 bits (631), Expect = 3e-66 Identities = 116/153 (75%), Positives = 129/153 (83%), Gaps = 1/153 (0%) Frame = +2 Query: 2 LIPENER-DCFVKAYHKRLNSDDLNTQYEAARAWTKWEMMTAHLIPNEETIKKGDSDEFS 178 LIPENER V AYHKRLNSDDL QY AARAWTKWEMMTA+L PN E ++K + D+FS Sbjct: 176 LIPENERGSSLVDAYHKRLNSDDLEIQYAAARAWTKWEMMTAYLRPNLENVQKAEDDKFS 235 Query: 179 LAFARIENHYFTNKGFFYTDSHLLDNIDKIRHINAVIVQGRYDCCCPMMSAWDLHKAWPE 358 LAFARIENHYF NKGFF +DSHLLDN+DKIRHI IVQGRYD CCPMMSAWDLHKAWPE Sbjct: 236 LAFARIENHYFVNKGFFPSDSHLLDNVDKIRHIKTTIVQGRYDVCCPMMSAWDLHKAWPE 295 Query: 359 ADFKVVTDAGHSVNEPGIAAELVAANEKLKNII 457 A+ K+V DAGHS NEPGI+AELV ANEK+K ++ Sbjct: 296 AELKIVYDAGHSANEPGISAELVVANEKMKALM 328 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,979,238 Number of Sequences: 27288 Number of extensions: 270879 Number of successful extensions: 754 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 754 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 972741724 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA14B10.yg.ab1 (368 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g43240.1 putative protein / predicted protein, Drosophila ... 115 6e-27 >At3g43240.1 putative protein / predicted protein, Drosophila melanogaster, EMBL:AE003789 Length = 717 Score = 115 bits (288), Expect = 6e-27 Identities = 47/56 (83%), Positives = 51/56 (90%) Frame = +1 Query: 1 DWVNCGVCGEWAHFGCDRRQGLGAFKDYAKTDGLEYICPQCSISNFKKKLPKTSNG 168 DWVNCG CGEWAHFGCDRR GLGAFKDYAKTDGLEY+CP CS+SN++KK KTSNG Sbjct: 657 DWVNCGSCGEWAHFGCDRRPGLGAFKDYAKTDGLEYVCPNCSVSNYRKKSQKTSNG 712 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,350,392 Number of Sequences: 27288 Number of extensions: 169501 Number of successful extensions: 474 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 11,516,596 effective HSP length: 87 effective length of database: 9,142,540 effective search space used: 319988900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA14E20.yg.ab1 (540 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g51820.1 chlorophyll synthetase / ; supported by cDNA: gi... 169 1e-42 >At3g51820.1 chlorophyll synthetase / ; supported by cDNA: gi_14596066_gb_AY042821.1_ Length = 387 Score = 169 bits (427), Expect = 1e-42 Identities = 81/96 (84%), Positives = 87/96 (90%) Frame = +3 Query: 3 DRKMGLQSLPVAFGEETAKWICVGAIDITQLSVAGYLLGAGKPYYAAALVGLIAPQVFFQ 182 DR +GLQSLPVAFG ETAKWICVGAIDITQLSVAGYLL +GKPYYA ALV LI PQ+ FQ Sbjct: 292 DRALGLQSLPVAFGTETAKWICVGAIDITQLSVAGYLLASGKPYYALALVALIIPQIVFQ 351 Query: 183 FKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 290 FKYFLKDPVKYDVKYQASAQPFL+LG+ VTALA+ H Sbjct: 352 FKYFLKDPVKYDVKYQASAQPFLVLGIFVTALASQH 387 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,972,579 Number of Sequences: 27288 Number of extensions: 249523 Number of successful extensions: 576 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 575 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 772177832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA14H16.yg.ab1 (372 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67740.1 F12A21.13 / putative photosystem II Core Complex ... 125 4e-30 >At1g67740.1 F12A21.13 / putative photosystem II Core Complex sp|049347|PSBY_ARATH; similar to ESTs gb|BE523181, dbj|AV531372.1, dbj|AV527826.1, dbj AV520274.1, dbj|AV522153.1, dbj|AV530317.1, dbj|AV526312.1, dbj|AV527090.1, dbj|AV521148.1, and dbj|AV531908.1;supported by full-l Length = 189 Score = 125 bits (315), Expect = 4e-30 Identities = 65/93 (69%), Positives = 78/93 (82%), Gaps = 1/93 (1%) Frame = +3 Query: 3 LYNIFQPAVNQINRMR-TKGVIVGLGIGGGLAASSGLFATPEATASEFAAIAEAAAANDN 179 LYNI QPA+NQ+N+MR +KG++VGLGIGGGLAAS L PEA +AA AAA++D+ Sbjct: 99 LYNILQPAINQVNKMRESKGIVVGLGIGGGLAASGLLTPPPEA----YAAAEAAAASSDS 154 Query: 180 RGQLLLIVIAPAILWVLYNILQPALNQINKMRN 278 RGQLLLIV+ PA+LWVLYNILQPALNQINKMR+ Sbjct: 155 RGQLLLIVVTPALLWVLYNILQPALNQINKMRS 187 Score = 69.7 bits (169), Expect = 4e-13 Identities = 34/63 (53%), Positives = 43/63 (67%) Frame = +3 Query: 87 GLAASSGLFATPEATASEFAAIAEAAAANDNRGQLLLIVIAPAILWVLYNILQPALNQIN 266 G SS ++ P + A +A A A++DNRG LL+ I PAI WVLYNILQPA+NQ+N Sbjct: 52 GAVFSSLSYSEPALAIQQIAQLAAANASSDNRGLALLLPIVPAIAWVLYNILQPAINQVN 111 Query: 267 KMR 275 KMR Sbjct: 112 KMR 114 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,802,377 Number of Sequences: 27288 Number of extensions: 152163 Number of successful extensions: 907 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 769 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 892 length of database: 11,516,596 effective HSP length: 87 effective length of database: 9,142,540 effective search space used: 329131440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA14P07.yg.ab1 (474 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20390.1 translational inhibitor protein, putative / simil... 129 1e-30 >At3g20390.1 translational inhibitor protein, putative / similar to GB:NP_005827 from [Homo sapiens], contains Pfam profile: PF01042 Domain of unknown function;supported by full-length cDNA: Ceres:20767. Length = 187 Score = 129 bits (323), Expect = 1e-30 Identities = 68/96 (70%), Positives = 73/96 (75%) Frame = +1 Query: 187 RSNRFACFAVSTDASLKEAVKTDKAPAALGPYSQAIKTGNTVYLSGALGLIPETGKFASH 366 RS FA +VS + KE V T+KAPAALGPYSQAIK N V+LSG LGLIPETGKF S Sbjct: 48 RSPPFASLSVSASSVKKEVVSTEKAPAALGPYSQAIKANNLVFLSGVLGLIPETGKFVSE 107 Query: 367 SVEEQTEQALNNMGEILKASGARYSSAATTTIMPAD 474 SVE+QTEQ L NMGEILKASGA YSS TTIM AD Sbjct: 108 SVEDQTEQVLKNMGEILKASGADYSSVVKTTIMLAD 143 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,317,636 Number of Sequences: 27288 Number of extensions: 249369 Number of successful extensions: 763 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 763 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 596203608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA15A14.yg.ab1 (441 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06890.1 expressed protein / ;supported by full-length cDN... 140 3e-34 At2g31940.1 hypothetical protein / predicted by genscan 50 6e-07 >At3g06890.1 expressed protein / ;supported by full-length cDNA: Ceres:262487. Length = 128 Score = 140 bits (353), Expect = 3e-34 Identities = 71/90 (78%), Positives = 79/90 (86%) Frame = +3 Query: 21 GGGGEALTEFIAELLSPLGLLLLPIILLLAIQYLSSDSGSFVSSIFSAGEPSSIHRASGS 200 G GEA+T+ IAELLSP+GLLLLPIILLL IQ+LSS+ GSFVS+IFS GEP SIHR SGS Sbjct: 39 GDSGEAITDAIAELLSPVGLLLLPIILLLTIQFLSSERGSFVSAIFSTGEPESIHRVSGS 98 Query: 201 PVGVALVLVLVLFLLYNKFSIFGGDDDSDD 290 PVGVAL LVL+LFLLY +FSIFGGDD SDD Sbjct: 99 PVGVALFLVLILFLLYYRFSIFGGDDGSDD 128 >At2g31940.1 hypothetical protein / predicted by genscan Length = 120 Score = 49.7 bits (117), Expect = 6e-07 Identities = 24/60 (40%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = +3 Query: 72 LGLLLLPIILLLAIQYLSSDSG--SFVSSIFSAGEPSSIHRASGSPVGVALVLVLVLFLL 245 L L+ P++LLLA+ +LS D G ++S+ E S++RA G+P GVA +LV + F++ Sbjct: 47 LALMASPLLLLLAVHFLSDDQGVGGMMTSLIHLNERESLYRAGGTPWGVAFMLVFLFFMV 106 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,079,781 Number of Sequences: 27288 Number of extensions: 224031 Number of successful extensions: 1375 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1325 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 507397856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA15B17.yg.ab1 (542 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g55010.1 phosphoribosylformylglycinamidine cyclo-ligase precu... 126 6e-30 >At3g55010.1 phosphoribosylformylglycinamidine cyclo-ligase precursor / ; supported by cDNA: gi_16974614_gb_AY060585.1_ Length = 389 Score = 126 bits (317), Expect = 6e-30 Identities = 59/92 (64%), Positives = 75/92 (81%), Gaps = 4/92 (4%) Frame = +2 Query: 2 GGFTDNIPRVFPQGLGARIYNNSWPVLPVFKWIQKAGNIEEAEMKRTFNMGIGMVLVASK 181 GGFTDNIPRVFP GLGA I+ ++W + P+FKWIQ+ G IE++EM+RTFN+GIGMV+V S Sbjct: 298 GGFTDNIPRVFPDGLGAVIHTDAWELPPLFKWIQQTGRIEDSEMRRTFNLGIGMVMVVSP 357 Query: 182 EAAERILSEGE----TAYRIGEVINGDGVTYQ 265 EAA RIL E + AYR+GEV+NG+GV+YQ Sbjct: 358 EAASRILEEVKNGDYVAYRVGEVVNGEGVSYQ 389 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,404,654 Number of Sequences: 27288 Number of extensions: 243997 Number of successful extensions: 710 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 709 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 781156644 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA15H21.yg.ab1 (398 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27100.1 hypothetical protein / predicted by genemark.hmm 62 7e-11 At1g09740.1 putative ER6 protein / similar to GB:AAD46412 fro... 53 6e-08 At2g19370.1 unknown protein / predicted by genscan and genefi... 52 1e-07 >At3g27100.1 hypothetical protein / predicted by genemark.hmm Length = 143 Score = 62.4 bits (150), Expect = 7e-11 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +2 Query: 263 TLEEIINIKLIESGEKERLKELLRERLNECGRKDEMKSLCR 385 TL EIIN+KL+ESGEKE L EL+R+RL ECG KDEM+ CR Sbjct: 54 TLREIINVKLVESGEKENLMELVRDRLVECGWKDEMRIACR 94 >At1g09740.1 putative ER6 protein / similar to GB:AAD46412 from [Lycopersicon esculentum], ESTs gb|ATTS1236,gb|T43334,gb|N97019,gb|AA395203 come from this gene Length = 174 Score = 52.8 bits (125), Expect = 6e-08 Identities = 27/48 (56%), Positives = 34/48 (70%), Gaps = 3/48 (6%) Frame = -1 Query: 143 MTENKKLRCVVVAVDGSEESMKGLQWALDNVKL---HPEGSLVIIHVQ 9 M + L CVVVAVDGSE SM+ L+WALDN+KL + S V++HVQ Sbjct: 1 MDVSGSLNCVVVAVDGSEVSMEALRWALDNLKLSSSSSDSSFVVLHVQ 48 >At2g19370.1 unknown protein / predicted by genscan and genefinder Length = 102 Score = 52.0 bits (123), Expect = 1e-07 Identities = 31/57 (54%), Positives = 35/57 (61%) Frame = +2 Query: 197 ERERGGEREREREREREREREPTLEEIINIKLIESGEKERLKELLRERLNECGRKDE 367 ERERG ERERERERERERERE E + E+ER +E RER E R+ E Sbjct: 2 ERERGSERERERERERERERERERERERERERERERERERERERERERERERERERE 58 Score = 48.9 bits (115), Expect = 8e-07 Identities = 30/56 (53%), Positives = 34/56 (60%) Frame = +2 Query: 194 RERERGGEREREREREREREREPTLEEIINIKLIESGEKERLKELLRERLNECGRK 361 RERER ERERERERERERERE E + E+ER +E RER E R+ Sbjct: 9 RERERERERERERERERERERERERERERERERERERERERERERERERERERERE 64 Score = 48.1 bits (113), Expect = 1e-06 Identities = 30/57 (52%), Positives = 34/57 (59%) Frame = +2 Query: 197 ERERGGEREREREREREREREPTLEEIINIKLIESGEKERLKELLRERLNECGRKDE 367 ERER ERERERERERERERE E + E+ER +E RER E R+ E Sbjct: 8 ERERERERERERERERERERERERERERERERERERERERERERERERERERERERE 64 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,394,298 Number of Sequences: 27288 Number of extensions: 184668 Number of successful extensions: 4444 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 1236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2345 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 401071088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA16G07.yg.ab1 (351 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g42070.1 putative protein / similar to unknown protein (db... 75 5e-15 >At5g42070.1 putative protein / similar to unknown protein (dbj|BAA92898.1);supported by full-length cDNA: Ceres:97314. Length = 164 Score = 75.5 bits (184), Expect = 5e-15 Identities = 36/63 (57%), Positives = 41/63 (64%) Frame = +2 Query: 2 FGWWPIKAYRPCPGFVATGGRYRRQGQSMDEVAGFGSVPRKPANMTTTATATVSTETPSS 181 FGWWPIKAYRPCP FV GGRYRR GQSMDEVA FG K + T+ + + P+S Sbjct: 99 FGWWPIKAYRPCPAFVEAGGRYRRIGQSMDEVA-FGRGDSKSSTSVDTSDSLLRQTKPTS 157 Query: 182 EKK 190 K Sbjct: 158 SSK 160 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,766,031 Number of Sequences: 27288 Number of extensions: 189900 Number of successful extensions: 1355 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1268 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 216146400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA17A01.yg.ab1 (240 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20495.1 similar to Serine/threonine-protein kinase / temp... 72 4e-14 >At2g20495.1 similar to Serine/threonine-protein kinase / temporary automated functional assignment Length = 294 Score = 72.4 bits (176), Expect = 4e-14 Identities = 32/58 (55%), Positives = 46/58 (79%) Frame = +2 Query: 2 LSLLYLTKYYQLMLAILHNKRLRLSPLDITFHLPDLLGSGHLKTIQTPSGLVIRVVKN 175 LSL+ ++ ++ LA L KRLR SPLD+ FH+ DL+GSGHLKT+QT SGL++R++K+ Sbjct: 237 LSLIKRKRHKEMFLAELEKKRLRFSPLDVRFHVRDLIGSGHLKTVQTTSGLIVRILKD 294 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,284,617 Number of Sequences: 27288 Number of extensions: 98844 Number of successful extensions: 221 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 220 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 221 length of database: 11,516,596 effective HSP length: 55 effective length of database: 10,015,756 effective search space used: 240378144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA17D19.yg.ab1 (504 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25400.1 unknown protein / 129 1e-30 >At3g25400.1 unknown protein / Length = 99 Score = 129 bits (323), Expect = 1e-30 Identities = 65/96 (67%), Positives = 74/96 (76%) Frame = +3 Query: 51 VGEVGELSEIFQWKGEVPRGLPGWEDKEKQHLGEELSDVLLYLVRLSDICGVDLGKAALX 230 VGEVGELSEIFQWKGEV RG P W+++EK HLGEELSDVLLYLVRLSD CGVDLGKAAL Sbjct: 4 VGEVGELSEIFQWKGEVARGCPDWKEEEKVHLGEELSDVLLYLVRLSDACGVDLGKAALR 63 Query: 231 KLEINATKYPVKLCKGSSKKHNQIINNSDTSSSNIK 338 K+E+NA KYPV K + + + + SSS IK Sbjct: 64 KIELNAIKYPV-----PKKTDDHCVGDGEDSSSKIK 94 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,772,661 Number of Sequences: 27288 Number of extensions: 223976 Number of successful extensions: 958 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 937 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 675457500 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA17I14.yg.ab1 (525 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16550.1 expressed protein / ; supported by cDNA: gi_1442... 111 2e-25 >At5g16550.1 expressed protein / ; supported by cDNA: gi_14423559_gb_AF387017.1_AF387017 Length = 249 Score = 111 bits (278), Expect = 2e-25 Identities = 51/96 (53%), Positives = 70/96 (72%) Frame = +3 Query: 6 LLALTGMLVFTVVFLAATVNAIVISLLISLAAVGGFLAIFFACMTTMYIGLLFVTAFVTF 185 LL ++VFT+ F+AAT NAI+ISLLISLA GGFLA+FF C+T +YIG L V AFV Sbjct: 124 LLTTMALVVFTLFFVAATANAIIISLLISLAVAGGFLALFFLCLTGVYIGALSVAAFVIS 183 Query: 186 TVTISSIIAALVAAGWIGFIWMIWLAASEGARMVKR 293 T T+S++++ L+A+GWIGF + +WL R+ K+ Sbjct: 184 TATVSAVVSVLIASGWIGFFYAVWLGTRGSLRLAKQ 219 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,159,394 Number of Sequences: 27288 Number of extensions: 242372 Number of successful extensions: 725 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 696 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 727283772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA17I19.yg.ab1 (571 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g42210.1 expressed protein / ; supported by full-length c... 167 3e-42 >At2g42210.1 expressed protein / ; supported by full-length cDNA: Ceres: 28982. Length = 159 Score = 167 bits (424), Expect = 3e-42 Identities = 78/105 (74%), Positives = 91/105 (86%) Frame = +3 Query: 18 PGLVRTLKMMGNHGLTFAAIGGVYIGVEQLTQNYRMKRDFVNGAVGGFVAGAAILGFKGK 197 PGL+RTLKMMG HGLTFAAIGGVYIGVEQL QN+R KRDF NGA+GGFVAGA++LG++ + Sbjct: 53 PGLIRTLKMMGTHGLTFAAIGGVYIGVEQLVQNFRSKRDFYNGAIGGFVAGASVLGYRAR 112 Query: 198 SISTALSAGAALAATSTAIDVGGQTTRVDTGKEYYPYTTKKRVDA 332 SI TA++AGA LA TS ID GGQTTRVD G+EYYPYT +KR +A Sbjct: 113 SIPTAIAAGATLAVTSALIDSGGQTTRVDNGREYYPYTVEKRAEA 157 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,981,679 Number of Sequences: 27288 Number of extensions: 292359 Number of successful extensions: 814 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 809 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 850394780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA17M20.yg.ab1 (726 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g27385.1 Expressed protein / ; supported by full-length cD... 224 4e-59 >At1g27385.1 Expressed protein / ; supported by full-length cDNA: Ceres: 39286. Length = 202 Score = 224 bits (571), Expect = 4e-59 Identities = 120/181 (66%), Positives = 136/181 (74%) Frame = +3 Query: 54 FPFPFSLSFVVNQISTTTPPRCRITRRMHHRFNCSHHDENLSSTEDDGDQEPPQEAVLKV 233 FP P SL F + P R R NCSH+D++ DQ PPQEAVLK Sbjct: 40 FPAPKSLCF---NGFASVPERAT-------RLNCSHNDQS--------DQGPPQEAVLKA 81 Query: 234 ISEVSKTEGRVGQTTNMVLGGTVTDDSSDEWLTLDQKVNTYPTVRGFTAIGTGGDDFVQA 413 ISEVSKT+GRVG+TTNM++GGTV DDS+ +WL LDQKVNTYPT RGFTAIGTGG+DFV A Sbjct: 82 ISEVSKTDGRVGKTTNMIIGGTVADDSAKDWLELDQKVNTYPTERGFTAIGTGGNDFVHA 141 Query: 414 MVIAVESVVQHPIPQGNVKQKMSSGGKYVSVNIGPVQVVSSEQVQAVYNAMRRDVRMKYF 593 MV+AVESV+ IP+ VKQ +SS GKYVSVNIGP+QVVSSEQVQAVYNAMRRD RMKYF Sbjct: 142 MVVAVESVIDRQIPEDCVKQTLSSKGKYVSVNIGPIQVVSSEQVQAVYNAMRRDERMKYF 201 Query: 594 L 596 L Sbjct: 202 L 202 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,353,606 Number of Sequences: 27288 Number of extensions: 389657 Number of successful extensions: 1703 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1670 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1277231040 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA19C23.yg.ab1 (602 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21110.1 G10 - like protein / Maternal G10 like protein, O... 292 1e-79 >At4g21110.1 G10 - like protein / Maternal G10 like protein, Oryza sativa, PATCHX:D1002643; supported by cDNA: gi_15294271_gb_AF410327.1_AF410327 Length = 145 Score = 292 bits (747), Expect = 1e-79 Identities = 127/145 (87%), Positives = 138/145 (94%) Frame = +2 Query: 23 MPKVKTNRVKYPEGWELIEPTLRELQGKMREAENDPHDGKRKCEALWPIFKIAHQKSRYI 202 MPKVKTNRVKYPEGWELIEPTLREL KMREAE D HDGKRKCE LWPIFK++HQ+SRY+ Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELDAKMREAETDSHDGKRKCETLWPIFKVSHQRSRYV 60 Query: 203 YDLYYRRKEISKELFEFCLDQGYADRNIIAKWKKPGYERLCCLRCIQPRDHNFQTTCVCR 382 YDLYYRR+EISKEL+EFCLDQGYADR++IAKWKK GYERLCCLRCIQPRDHN+ TTCVCR Sbjct: 61 YDLYYRREEISKELYEFCLDQGYADRSLIAKWKKSGYERLCCLRCIQPRDHNYGTTCVCR 120 Query: 383 VPKHLREEKVIECVHCGCKGCASGD 457 VPKHLREEKV+ECVHCGC+GCASGD Sbjct: 121 VPKHLREEKVVECVHCGCQGCASGD 145 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,560,626 Number of Sequences: 27288 Number of extensions: 307649 Number of successful extensions: 773 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 771 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 948861544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA1c02.yg.ab1 (391 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g31350.1 F-box protein family / similar to hypothetical pr... 63 5e-11 >At1g31350.1 F-box protein family / similar to hypothetical protein GB:AAF24593 GI:6692128 from [Arabidopsis thaliana] Length = 395 Score = 62.8 bits (151), Expect = 5e-11 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 3/72 (4%) Frame = -2 Query: 210 TTTSSGH-NPTLQLSSFDPISTDWSIITPPTPY--LRHICLRHPSFIARNLPMQSISVAG 40 +T+ +G NP+++ F+P+S+ W + PP P L I RHPSFI+ NLP+Q +S AG Sbjct: 86 STSDTGRVNPSVRFMCFNPVSSKWYPLPPPPPDPPLHRILYRHPSFISFNLPIQCVSAAG 145 Query: 39 NLVLLAGTTGDL 4 L+L+AG+ L Sbjct: 146 KLILIAGSNQQL 157 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,631,892 Number of Sequences: 27288 Number of extensions: 292200 Number of successful extensions: 2222 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2005 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 373725332 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA1c12.yg.ab1 (513 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11980.1 putative protein / predicted protein W02G9.1 Caen... 41 2e-12 At2g05070.1 light-harvesting chlorophyll a/b binding protein /... 53 8e-08 At2g05100.1 light-harvesting chlorophyll a/b binding protein / 52 2e-07 At3g27690.1 light harvesting chlorophyll A/B binding protein, pu... 51 3e-07 At2g34430.1 photosystem II type I chlorophyll a /b binding prot... 49 2e-06 At1g29930.1 light-harvesting chlorophyll a/b binding protein /... 49 2e-06 At1g29920.1 photosystem II type I chlorophyll a /b binding prot... 49 2e-06 At1g29910.1 photosystem II type I chlorophyll a /b binding prot... 49 2e-06 At2g34420.1 photosystem II type I chlorophyll a /b binding prot... 49 2e-06 >At4g11980.1 putative protein / predicted protein W02G9.1 Caenorhabditis elegans cosmid W02G9, PID:g3165571; supported by cDNA: gi_15450340_gb_AY052271.1_ Length = 309 Score = 41.2 bits (95), Expect(3) = 2e-12 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = +1 Query: 163 LWHMTADAKELMSIAIYEMAKKEGLL 240 LW TADAK LMSI +YEMA++EGL+ Sbjct: 275 LWRKTADAKVLMSIGLYEMAQREGLV 300 Score = 35.8 bits (81), Expect(3) = 2e-12 Identities = 15/24 (62%), Positives = 19/24 (78%) Frame = +3 Query: 75 DDIKQMHGKETGLRVHGELIKVHV 146 + I+Q+ GKETGLR HGE IKV + Sbjct: 246 ETIRQLQGKETGLREHGEFIKVRL 269 Score = 30.8 bits (68), Expect(3) = 2e-12 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +2 Query: 8 YPLPGGWDEELSLLMYRG 61 +P PGG DEE+S+ +YRG Sbjct: 224 FPSPGGCDEEMSVFLYRG 241 >At2g05070.1 light-harvesting chlorophyll a/b binding protein / ; supported by cDNA: gi_4741945_gb_AF134123.1_AF134123 Length = 265 Score = 53.1 bits (126), Expect = 8e-08 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPVANNAWSYATNFVP K Sbjct: 229 VQAIVTGKGPIENLFDHLADPVANNAWSYATNFVPGK 265 >At2g05100.1 light-harvesting chlorophyll a/b binding protein / Length = 265 Score = 52.0 bits (123), Expect = 2e-07 Identities = 22/35 (62%), Positives = 28/35 (79%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVP 424 ++++ + +NL DHLADPVANNAWSYATNFVP Sbjct: 229 VQAIVTGKGPIENLFDHLADPVANNAWSYATNFVP 263 >At3g27690.1 light harvesting chlorophyll A/B binding protein, putative / similar to chlorophyll A-B binding protein 151 precursor (LHCP) GB:P27518 from [Gossypium hirsutum];supported by full-length cDNA: Ceres:7700.; supported by cDNA: gi_13899124 Length = 266 Score = 51.2 bits (121), Expect = 3e-07 Identities = 21/37 (56%), Positives = 29/37 (77%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DH+ADPVANNAW+YATNFVP K Sbjct: 230 VQAIVTGKGPIENLFDHIADPVANNAWAYATNFVPGK 266 >At2g34430.1 photosystem II type I chlorophyll a /b binding protein / ; supported by full-length cDNA: Ceres: 23727. Length = 266 Score = 48.5 bits (114), Expect = 2e-06 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPV NNAW++ATNFVP K Sbjct: 230 VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 266 >At1g29930.1 light-harvesting chlorophyll a/b binding protein / similar to photosystem II type I chlorophyll a /b binding protein GI:16364 from [Arabidopsis thaliana]; supported by cDNA: gi_15010743_gb_AY045673.1_ Length = 267 Score = 48.5 bits (114), Expect = 2e-06 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPV NNAW++ATNFVP K Sbjct: 231 VQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK 267 >At1g29920.1 photosystem II type I chlorophyll a /b binding protein, putative / similar to photosystem II type I chlorophyll a /b binding protein GI:16364 from [Arabidopsis thaliana];supported by full-length cDNA: Ceres:29298. Length = 267 Score = 48.5 bits (114), Expect = 2e-06 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPV NNAW++ATNFVP K Sbjct: 231 VQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK 267 >At1g29910.1 photosystem II type I chlorophyll a /b binding protein, putative / similar to photosystem II type I chlorophyll a /b binding protein GI:16364 from [Arabidopsis thaliana] Length = 267 Score = 48.5 bits (114), Expect = 2e-06 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPV NNAW++ATNFVP K Sbjct: 231 VQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK 267 >At2g34420.1 photosystem II type I chlorophyll a /b binding protein / identical to GB:X64460; supported by cDNA: gi_13926259_gb_AF372886.1_AF372886 Length = 265 Score = 48.5 bits (114), Expect = 2e-06 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = +2 Query: 320 IESLCPKRDRCKNLDDHLADPVANNAWSYATNFVPRK 430 ++++ + +NL DHLADPV NNAW++ATNFVP K Sbjct: 229 VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK 265 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,342,582 Number of Sequences: 27288 Number of extensions: 229764 Number of successful extensions: 587 Number of sequences better than 1.0e-05: 18 Number of HSP's better than 0.0 without gapping: 572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 587 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 702475800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA1g09.yg.ab1 (399 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g38240.1 glycosyltransferase like protein / alpha-1,3-mann... 101 1e-22 >At4g38240.1 glycosyltransferase like protein / alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (EC 2.4.1.101) I - rat,PIR2:JC2076 Length = 457 Score = 101 bits (251), Expect = 1e-22 Identities = 47/67 (70%), Positives = 55/67 (81%) Frame = +1 Query: 1 VNGDVRIHYTDQSHFENIARQFGIFEEWKDGVPRTAYKGIVVFRYQTSKXVXLVGPNSLQ 180 + DVRI Y DQ FE IA +FGIFEEWKDGVPRTAYKG+VVFR QT++ V LVGP+S+ Sbjct: 391 IKDDVRIRYKDQVEFERIAGEFGIFEEWKDGVPRTAYKGVVVFRIQTTRRVFLVGPDSVM 450 Query: 181 QLGIQNS 201 QLGI+NS Sbjct: 451 QLGIRNS 457 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,869,217 Number of Sequences: 27288 Number of extensions: 182329 Number of successful extensions: 345 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 345 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 401071088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA20B23.yg.ab1 (349 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62140.1 hypothetical protein / 70 2e-13 >At3g62140.1 hypothetical protein / Length = 241 Score = 69.7 bits (169), Expect = 2e-13 Identities = 46/108 (42%), Positives = 59/108 (54%), Gaps = 26/108 (24%) Frame = +2 Query: 8 VAAQSAVLHELKESPVAPPK--LQEQQPSGEKKTRARPLGVVIKVKPQPKKAKISTPEE- 178 VAA+SA+LHE KE+ + PP +EQ+P G++ RP +IKVKPQPKKAK + EE Sbjct: 133 VAARSAILHEPKEAALPPPAPVTKEQKPIGKRNPATRPFKAIIKVKPQPKKAKATEKEEK 192 Query: 179 -----SKPSVPVTNV--------VTG----------GLVSYSDESDDD 253 KP+ + VTG LVSYSDES+DD Sbjct: 193 EIPGNGKPASHIDQASLDSVKGNVTGKTTEGLQTGLALVSYSDESEDD 240 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,985,285 Number of Sequences: 27288 Number of extensions: 162620 Number of successful extensions: 541 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 534 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 216801312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA20G20.yg.ab1 (639 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61970.1 signal recognition particle - like protein / sign... 175 2e-44 >At5g61970.1 signal recognition particle - like protein / signal recognition particle 68, Homo sapiens, EMBL:AF195951; supported by cDNA: gi_15293136_gb_AY051002.1_ Length = 605 Score = 175 bits (444), Expect = 2e-44 Identities = 92/155 (59%), Positives = 120/155 (77%), Gaps = 5/155 (3%) Frame = +3 Query: 9 EAYSLFSFARSLAENALKKLRSATSRDQVTIKELETLHNNCRSNSCIEHAMGIMEHEKAP 188 EA++L+S ARSLAE+AL K +S +D+ TI+EL+TL CR+NSCIEHA GIME E+AP Sbjct: 452 EAFALYSRARSLAEDALNKFQSIAKKDEGTIQELKTLIKECRANSCIEHATGIMEEERAP 511 Query: 189 EDLSKKISTVSISGTDRKA-EKFLIEKLDSYESAVGDSSTKVAPRIAAYQPSFQPIARSP 365 E+LS ++ST+S++ T + EK+L++KLD YESAVGDS+TK AP+I + P+ Q I R+P Sbjct: 512 ENLSNRMSTISLNNTAAQVEEKYLLDKLDVYESAVGDSNTKTAPKIERFPPALQSIPRNP 571 Query: 366 IVLDLAYNSIDFPSIDNRMKQDKKGF----ISRLW 458 IVLDLAYN IDFP I+NRMK+ K GF IS LW Sbjct: 572 IVLDLAYNCIDFPVIENRMKK-KGGFFSSRISSLW 605 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,726,792 Number of Sequences: 27288 Number of extensions: 290184 Number of successful extensions: 865 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 831 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1044135612 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA20J16.yg.ab1 (518 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24460.1 unknown protein / ; supported by cDNA: gi_17065179 68 2e-12 >At5g24460.1 unknown protein / ; supported by cDNA: gi_17065179 Length = 300 Score = 68.2 bits (165), Expect = 2e-12 Identities = 37/69 (53%), Positives = 46/69 (66%), Gaps = 5/69 (7%) Frame = +3 Query: 84 VSYPGLPACYILHTVDAYVDGLPEGEFWTEEGDEYEGLGEKEHERCEL-----AVSCKKH 248 +SYPGLPA Y LH+V+A V+GLPE +F TEE EYEG G+ + E AV+ K+H Sbjct: 231 LSYPGLPARYALHSVNATVEGLPEQDFCTEE-KEYEG-GDSTKDSVETLAAGNAVTVKRH 288 Query: 249 YWKWVDEGS 275 YWKWV S Sbjct: 289 YWKWVSPDS 297 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,002,226 Number of Sequences: 27288 Number of extensions: 332186 Number of successful extensions: 1878 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1786 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 720488000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA20P20.yg.ab1 (394 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63135.1 Expressed protein / ; supported by full-length cD... 87 2e-18 >At5g63135.1 Expressed protein / ; supported by full-length cDNA: Ceres: 28326. Length = 99 Score = 87.4 bits (215), Expect = 2e-18 Identities = 42/64 (65%), Positives = 55/64 (85%) Frame = +1 Query: 1 ELLLAIEESELEEKYNDIRKINSNLIVIGKTSVENDKEDFDDEADDDDADNAEESEGDEF 180 E+LLA+EE+E EEK N+IRK++ L VIGK V N++E+ D+EA+DDDADNAEES+G+EF Sbjct: 35 EILLAMEEAEFEEKCNEIRKMSPALPVIGKPVVNNEQEEDDNEAEDDDADNAEESDGEEF 94 Query: 181 EQET 192 EQET Sbjct: 95 EQET 98 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,496,506 Number of Sequences: 27288 Number of extensions: 147491 Number of successful extensions: 3202 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2555 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 382840584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA21B20.yg.ab1 (396 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79810.1 expressed protein / contains similarity to peroxi... 210 2e-55 >At1g79810.1 expressed protein / contains similarity to peroxisome membrane protein PEX2 GI:2623264 from [Mus musculus]; supported by full-length cDNA: Ceres: 118765. Length = 333 Score = 210 bits (534), Expect = 2e-55 Identities = 94/128 (73%), Positives = 112/128 (87%) Frame = +1 Query: 1 RYRNLIERALRARLVYGSPHMNRAVSFEYMNRQLVWNEFSEMLLLLLPILNSASIKSIFR 180 RYRNLIE+AL+ARLVY SPHMNR+VSFEYMNRQLVWNEFSEMLLLLLP+LNS+++K+I Sbjct: 201 RYRNLIEKALKARLVYRSPHMNRSVSFEYMNRQLVWNEFSEMLLLLLPLLNSSAVKNILS 260 Query: 181 PFSKDKSSGSTGDETQCPICHINPTIGYVALPCQHRYCYYCLRTRCAATASFRCSRCSEP 360 PF+KDKSS + D CPIC ++P I ++ALPCQHRYCYYC+RTRCA+ ASFRC RC+EP Sbjct: 261 PFAKDKSSSTKEDTVTCPICQVDPAIPFIALPCQHRYCYYCIRTRCASAASFRCLRCNEP 320 Query: 361 VVAMQPPG 384 VVA+Q G Sbjct: 321 VVAIQREG 328 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,868,866 Number of Sequences: 27288 Number of extensions: 183108 Number of successful extensions: 629 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 391955836 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA22B12.yg.ab1 (461 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30820.1 Expressed protein / ; supported by full-length cD... 65 2e-11 >At4g30820.1 Expressed protein / ; supported by full-length cDNA: Ceres: 14193. Length = 178 Score = 64.7 bits (156), Expect = 2e-11 Identities = 39/70 (55%), Positives = 48/70 (67%), Gaps = 5/70 (7%) Frame = +2 Query: 17 AGGTIPQP-RPT----QPLPMGSGDDLHAYHMDGEETMRLKAERGGKAGGWSLEISRKRA 181 AG T Q RPT QP+P+ G + Y M+ E T R+KAER AGG+SLEIS++RA Sbjct: 112 AGTTYGQASRPTGMGPQPVPIVGGAERQHYAMEDEATRRMKAER---AGGFSLEISKRRA 168 Query: 182 LEEAFASIWI 211 LEEAFASIW+ Sbjct: 169 LEEAFASIWV 178 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,130,143 Number of Sequences: 27288 Number of extensions: 247497 Number of successful extensions: 600 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 599 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 560070056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA2f04.yg.ab1 (551 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25740.1 hypothetical protein / predicted by genscan; supp... 258 2e-69 >At2g25740.1 hypothetical protein / predicted by genscan; supported by cDNA: gi_18377846 Length = 547 Score = 258 bits (658), Expect = 2e-69 Identities = 120/173 (69%), Positives = 142/173 (81%) Frame = +3 Query: 33 RECPRAFWPYWVYRMHDSYCLAQRLSDMWKKIVGTPSMDAFVRQPGLLSFHVASKIPVSE 212 R PRAFWP+W YRM DSY LAQR D+WK+IVG P+M+AFV +P +LSF +ASKIPVSE Sbjct: 354 RMTPRAFWPFWAYRMFDSYYLAQRAVDLWKQIVGVPNMEAFVNKPDILSFSIASKIPVSE 413 Query: 213 STRQELLEIDGISYRLRREIELLENFDQIKCRSCQTLIANRSDMLVMSTDGPLGAYVNPS 392 S RQELLE+DG+SYRL+REIELLE+FD+++C CQT+IA R DMLVMS +GPLGAYVNP Sbjct: 414 SIRQELLELDGVSYRLQREIELLESFDRVRCIHCQTVIARRKDMLVMSNEGPLGAYVNPH 473 Query: 393 GYVHEIMTLLKASGLALIGVPTEEYSWFPGYAWTEAYWATCEYQMGWLLTATN 551 GYVHEIMT KA+ +AL G P ++ SWFPGYAWT A ATCE Q+GW TATN Sbjct: 474 GYVHEIMTFYKANDIALRGRPVKKDSWFPGYAWTIANCATCETQLGWHFTATN 526 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,034,451 Number of Sequences: 27288 Number of extensions: 282382 Number of successful extensions: 773 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 714 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 768 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 808093080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA3h02.yg.ab1 (347 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30900.1 hypothetical protein / ; supported by cDNA: gi_1... 100 1e-22 >At4g30900.1 hypothetical protein / ; supported by cDNA: gi_18958014 Length = 254 Score = 100 bits (250), Expect = 1e-22 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = +3 Query: 3 RQTQDLHIDWILFRGRSLAPVSCEVVNDNIDGHYPSSHYPVFAEFMLPRTVRPLEP 170 RQTQDLH DWIL+RGRS+ PV CE+VND ID YPSSHYPVFAEFMLPR+VR LEP Sbjct: 187 RQTQDLHTDWILYRGRSIVPVMCEIVNDKIDDLYPSSHYPVFAEFMLPRSVRMLEP 242 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,396,810 Number of Sequences: 27288 Number of extensions: 144537 Number of successful extensions: 405 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 216801312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA4f06.yg.ab1 (363 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g08580.1 hypothetical protein / predicted by genscan 65 8e-12 >At1g08580.1 hypothetical protein / predicted by genscan Length = 123 Score = 64.7 bits (156), Expect = 8e-12 Identities = 33/71 (46%), Positives = 48/71 (67%) Frame = +1 Query: 31 RDQKERVEKGLITMEDIEMAVADGSGTSSQQTTTKIHLKKSLKIRTKRSNKKDKKGKKKG 210 R+QK+ VEKGL+TMED+EMA A + S+++ K +KKSLK+ K +NK KK +K Sbjct: 54 REQKDMVEKGLVTMEDVEMASAQAASEDSKKSPRKFSVKKSLKL-NKLNNKGKKKKNQKA 112 Query: 211 TSSASSDVMME 243 + S+D M+E Sbjct: 113 SGEKSADCMLE 123 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,329,298 Number of Sequences: 27288 Number of extensions: 176483 Number of successful extensions: 701 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 699 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 213526752 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA4g03.yg.ab1 (386 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g10780.1 putative protein / HSPC184, Homo sapiens, EMBL:AF... 120 2e-28 >At5g10780.1 putative protein / HSPC184, Homo sapiens, EMBL:AF151018; supported by cDNA: gi_14335059_gb_AY037209.1_ Length = 180 Score = 120 bits (302), Expect = 2e-28 Identities = 55/77 (71%), Positives = 64/77 (82%) Frame = +2 Query: 14 PLWPLYGVGKAFAPYKDSKVDLLAPKLLFIALNLGGMLLGVWKLNALGLLPTHASDWVSS 193 P+ L VGK F P+KD+KV+LL PKL+F+ALNLGG+ LGVWKLN LGLLPTHASDWVSS Sbjct: 104 PISALQSVGKIFEPFKDNKVELLMPKLVFLALNLGGLALGVWKLNTLGLLPTHASDWVSS 163 Query: 194 LPPAREVEYSGGGIALH 244 LPP +EVE+SGGG H Sbjct: 164 LPPPQEVEHSGGGFVFH 180 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,925,886 Number of Sequences: 27288 Number of extensions: 196059 Number of successful extensions: 500 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 500 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 364610080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA6G22.yg.ab1 (313 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g04700.1 putative ferredoxin-thioredoxin reductase / ;sup... 101 8e-23 >At2g04700.1 putative ferredoxin-thioredoxin reductase / ;supported by full-length cDNA: Ceres:40781. Length = 146 Score = 101 bits (251), Expect = 8e-23 Identities = 43/51 (84%), Positives = 46/51 (89%) Frame = +1 Query: 1 EATQGFWNCPCVPMRERKECHCMLFLTPDNDFAGNEQVITMEEIKESTANM 153 E QGFWNCPCVPMRERKECHCMLFLTPDNDFAG +Q IT +EIKE+TANM Sbjct: 96 EVGQGFWNCPCVPMRERKECHCMLFLTPDNDFAGKDQTITSDEIKETTANM 146 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,210,724 Number of Sequences: 27288 Number of extensions: 145369 Number of successful extensions: 263 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 263 length of database: 11,516,596 effective HSP length: 79 effective length of database: 9,360,844 effective search space used: 224660256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA6N18.yg.ab1 (500 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27050.1 expressed protein / ; supported by cDNA: gi_13937... 116 7e-27 >At3g27050.1 expressed protein / ; supported by cDNA: gi_13937132_gb_AF372920.1_AF372920 Length = 182 Score = 116 bits (290), Expect = 7e-27 Identities = 57/96 (59%), Positives = 77/96 (79%), Gaps = 1/96 (1%) Frame = +3 Query: 3 KINMEYENDQDLMISFYKFVAKEEMVCEEAELGPDEYAERLQSQQTLHQQQLEMLKHMRN 182 K+N YEND++LMI FYKF+AKEEM CEEAELG D + +++++ Q L +QQLEMLK+MR Sbjct: 74 KLNSAYENDKELMIGFYKFLAKEEMACEEAELGQDGFEQKMKALQQLQEQQLEMLKYMRK 133 Query: 183 YGADDQSAILETLRQKMEKE-FESEASLLSVEEIKE 287 + DDQSAIL+ L++++E FE EASLLS EE++E Sbjct: 134 FSLDDQSAILQKLQKQLENAGFEPEASLLSGEEMEE 169 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,696,648 Number of Sequences: 27288 Number of extensions: 216400 Number of successful extensions: 822 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 791 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 666451400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA7F05.yg.ab1 (321 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48720.1 putative protein / similar to unknown protein (gb... 95 6e-21 >At5g48720.1 putative protein / similar to unknown protein (gb|AAD20092.1) Length = 286 Score = 95.1 bits (235), Expect = 6e-21 Identities = 49/107 (45%), Positives = 70/107 (64%) Frame = +1 Query: 1 GLHPSSEEWLADCLINDTEMHLHVDDMNPSGSTGGQIDLTESNNSEPENGCGTGQKLPTP 180 GL +EEW ADCL ND E + DD+N GS Q+D++E N PE Q+ T Sbjct: 131 GLDLYAEEWYADCL-NDAETPMLPDDLN-FGSPDVQVDISEYLNVPPETETREVQRPVTR 188 Query: 181 TSKNIVFKGKRSCIKTPTKMTSSVVRPFAFVKPCGMQGAVTIKDINQ 321 +S N++FKG++S + +K+ SS++ PFAF+KPCG+ G +T+KDINQ Sbjct: 189 SSPNVIFKGRKSFSRPVSKLPSSIIYPFAFIKPCGVHGGMTLKDINQ 235 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.312 0.131 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,654,460 Number of Sequences: 27288 Number of extensions: 167301 Number of successful extensions: 387 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 386 length of database: 11,516,596 effective HSP length: 82 effective length of database: 9,278,980 effective search space used: 222695520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA7G06.yg.ab1 (362 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28260.1 putative protein / 74 1e-14 >At4g28260.1 putative protein / Length = 516 Score = 73.9 bits (180), Expect = 1e-14 Identities = 35/76 (46%), Positives = 52/76 (68%), Gaps = 5/76 (6%) Frame = +3 Query: 3 TGIELGGDELEKPTVSLSEMFKYKMKASDGHKEYIKAPELLQNCSTGFYFPSQSEEAMQ- 179 TGI + G +E+ T LS+ +++++K S+G K ++K PE L+NCSTGF+FP Q+EE Q Sbjct: 437 TGINIEGAVIERDTFPLSQTWRFQVKVSEGRKAWVKNPERLKNCSTGFHFPQQAEETEQI 496 Query: 180 ----ENVSPLKLLRFY 215 E V +KL+RFY Sbjct: 497 PVQEERVQMMKLVRFY 512 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,894,478 Number of Sequences: 27288 Number of extensions: 161995 Number of successful extensions: 434 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 213526752 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA7G20.yg.ab1 (666 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79790.1 expressed protein / ; supported by full-length cD... 181 3e-46 >At1g79790.1 expressed protein / ; supported by full-length cDNA: Ceres: 268411. Length = 245 Score = 181 bits (459), Expect = 3e-46 Identities = 96/180 (53%), Positives = 116/180 (64%) Frame = +2 Query: 2 LIDEMELARIFFKDGRHFDLEGLKSCIYQGYSYIEGVEELLSTLKDNGYEIHAFTNYPIW 181 LIDE ELAR FF DGR FDLEGLK C+ GYSY++G++ELL TL + +EIHAFTNYPIW Sbjct: 94 LIDEEELARNFFIDGRDFDLEGLKECMRSGYSYLDGMQELLQTLAADDFEIHAFTNYPIW 153 Query: 182 YG*TARYKMIEDKLKLSSYLSWTFCSCVIGKYKT*ST*YQNTTFMCFSV*RYCRSINVGK 361 Y +IEDKLKLS+YLSWTFCSC+ GK Sbjct: 154 YN------IIEDKLKLSAYLSWTFCSCI-----------------------------AGK 178 Query: 362 RKPDPLFYSEVLQHLDTEPQNCVFIDDRLKNIEAAKDAGIIGIQFKNAHSLQQDLSLLGI 541 RKPDP FY EV+ HL EP +C+FIDDR N++ A + G+ G+ F+NA SL +DLS LGI Sbjct: 179 RKPDPEFYLEVVGHLGVEPCDCIFIDDRPTNVKCAIEIGMGGLCFENADSLAKDLSDLGI 238 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,171,064 Number of Sequences: 27288 Number of extensions: 300541 Number of successful extensions: 756 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 732 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1112118500 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA7M13.yg.ab1 (501 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53850.1 putative protein / contains similarity to enolase... 201 2e-52 >At5g53850.1 putative protein / contains similarity to enolase-phosphatase Length = 507 Score = 201 bits (510), Expect = 2e-52 Identities = 92/133 (69%), Positives = 116/133 (87%) Frame = +1 Query: 1 FEKNVIKGVVYDDVVQAFERWHASGVKVYIYSSGSRLAQRLIFGYTNYGDLRKYLCGFFD 180 FE + +K +V++DV A E+WH+SG+KVYIYSSGSRLAQ+L+FG T+YGDLRKY+ GFFD Sbjct: 375 FECDELKAIVFEDVADALEKWHSSGIKVYIYSSGSRLAQKLLFGNTDYGDLRKYISGFFD 434 Query: 181 TKVGNKRETKSYVEISESLGVDKPSEVLFVTDVVQEAVAAKAAGLEVIISVRPGNAPLPE 360 T +GNK+E++SY EI E+LGVD P+E++FVTDV QEAVAAKAAGLE IIS+RPGNAPLPE Sbjct: 435 TTIGNKKESRSYKEIKETLGVDDPAEIMFVTDVYQEAVAAKAAGLEAIISIRPGNAPLPE 494 Query: 361 NHGCDTVETFTEI 399 NHG TV +F++I Sbjct: 495 NHGFKTVTSFSQI 507 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,241,250 Number of Sequences: 27288 Number of extensions: 240509 Number of successful extensions: 716 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 715 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 666451400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA8L15.yg.ab1 (493 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g63980.1 expressed protein / similar to hypothetical prote... 84 4e-17 >At1g63980.1 expressed protein / similar to hypothetical protein GB:AAF07360 from [Arabidopsis thaliana]; supported by cDNA: gi_15810007_gb_AY054272.1_ Length = 391 Score = 84.0 bits (206), Expect = 4e-17 Identities = 53/135 (39%), Positives = 77/135 (56%), Gaps = 29/135 (21%) Frame = +1 Query: 1 VHFQGKKTSFS-----------DSESQESESEPEPEPEDNN----------GKRS----- 102 V ++GKKTSF D E E E E E E +D++ KR Sbjct: 254 VRYEGKKTSFDNSDDDDDDDDDDDEEDEEEDEDESEADDDDKDSVIESSLPAKRKHDEII 313 Query: 103 ESKLKLKKLCKKLLSQEPERS--LKLKQLMALVDEHH-SIFNNFSSKKHALAFFKNKLES 273 E K+KLK LCK+++ ++ + +KLKQL +L+DE S+ + FSS+K A+A+ K KLE Sbjct: 314 EPKIKLKNLCKQIVKKDAGKGGFMKLKQLKSLIDEQAPSVLSEFSSRKDAIAYLKLKLER 373 Query: 274 SSKFIVEGKRVRLMS 318 S KF+VEGK++ L+S Sbjct: 374 SGKFVVEGKKISLVS 388 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,153,187 Number of Sequences: 27288 Number of extensions: 179135 Number of successful extensions: 1043 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1024 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 639433100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA8M14.yg.ab1 (397 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76150.1 hypothetical protein / contains similarity to 17-... 116 4e-27 >At1g76150.1 hypothetical protein / contains similarity to 17-beta-hydroxysteroid dehydrogenase type IV GI:2315980 from [Gallus gallus]; supported by cDNA: gi_17979530 Length = 309 Score = 116 bits (290), Expect = 4e-27 Identities = 55/77 (71%), Positives = 64/77 (82%) Frame = +1 Query: 1 LCTLGFAVRAIIKTICNGDANLVKAISGRFLLHVYPGETLITEMWLQGSRVLYQTKVKER 180 LCTLGFA++AIIK +C GD VK ISGRFL V+PGETLITEMWL+G RV+YQTKVKER Sbjct: 232 LCTLGFAIKAIIKCVCKGDPTAVKTISGRFLTTVFPGETLITEMWLEGLRVIYQTKVKER 291 Query: 181 NRAVLAGFVDLDQLRSS 231 N+ VLAG+VD+ L SS Sbjct: 292 NKTVLAGYVDIRGLSSS 308 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,708,315 Number of Sequences: 27288 Number of extensions: 167577 Number of successful extensions: 417 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 391955836 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA9A15.yg.ab1 (769 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34280.1 putative protein / damage-specific DNA binding pr... 271 3e-73 >At4g34280.1 putative protein / damage-specific DNA binding protein 2, Homo sapiens ,PIR2:I38909 Length = 748 Score = 271 bits (693), Expect = 3e-73 Identities = 135/190 (71%), Positives = 155/190 (81%), Gaps = 2/190 (1%) Frame = +3 Query: 3 HINVVKFANHSPSMFATSSFDHDVKMWDLRQKPIHPCYTVSSGRGNVMVCFSPDDHYLLA 182 HINVVKF+NHSP +FATSSFD DVK+WDLRQ+P PCYT SS +GNVMVCFSPDD YLLA Sbjct: 538 HINVVKFSNHSPFLFATSSFDKDVKLWDLRQEPSRPCYTASSTKGNVMVCFSPDDRYLLA 597 Query: 183 SAVDNEVKQLLAVDGRLHLDFGIPPTGSSQNYTRSYYMNGRDYILSGSCDEHVVRICSAQ 362 SAVDNEV+QLL VDGRLHL+F I P SS NYTRSYYMNG DYI+SGSCDE+V+R+C AQ Sbjct: 598 SAVDNEVRQLLTVDGRLHLNFEIVPRVSSMNYTRSYYMNGNDYIISGSCDENVIRVCCAQ 657 Query: 363 TGRRLRDISLEGRSSG-SSMFVQSLRGDPFRDFNLSVLAAYLSPNSSPEIVKVNM-LTSK 536 TGRRLRD++LEG S S M+VQSLRGDPFRDFN+SVLAAY +S EIVK+ + S Sbjct: 658 TGRRLRDVTLEGNGSDFSMMYVQSLRGDPFRDFNMSVLAAYARSSSLSEIVKIKFPILST 717 Query: 537 DADKDSLSDE 566 DK+ + E Sbjct: 718 VDDKNVTAGE 727 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,976,240 Number of Sequences: 27288 Number of extensions: 377162 Number of successful extensions: 1049 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 983 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1041 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1401406280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA9D19.yg.ab1 (664 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25605.1 hypothetical protein / predicted by genscan+ 195 2e-50 >At2g25605.1 hypothetical protein / predicted by genscan+ Length = 191 Score = 195 bits (495), Expect = 2e-50 Identities = 98/159 (61%), Positives = 112/159 (69%), Gaps = 12/159 (7%) Frame = +1 Query: 1 KRPFGPRLSFNAEECVQYQLDALMLNDQPRPDYGVEVMYRFAGFDPFERSLYFGPSFDLG 180 KRPFGPRL F+AE+ V++QLDAL ND PR DYG+EVMYRF Sbjct: 54 KRPFGPRLDFSAEDAVRHQLDALKYNDHPRDDYGIEVMYRF------------------- 94 Query: 181 QFERFRRIFHHSSYRVLLNHKERKILSTLNVEE------------NRYKQRVWIRGARPE 324 ERFRRIFHHSSYRVLL HK+RK+LS+L VEE NR+KQR+WI+G RPE Sbjct: 95 --ERFRRIFHHSSYRVLLGHKDRKLLSSLFVEESSPHDILFFDMQNRFKQRIWIQGNRPE 152 Query: 325 EEETFQFTMVQRVGGFWDGYWLTESLHHDGDSFSGGVAY 441 EEE F+FTM QR+GG WDGYWLTESL HDGD FSGG+AY Sbjct: 153 EEEIFEFTMFQRIGGSWDGYWLTESLLHDGDVFSGGMAY 191 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,929,805 Number of Sequences: 27288 Number of extensions: 343669 Number of successful extensions: 774 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 772 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1103221552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHA9N04.yg.ab1 (224 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63690.1 unknown protein / 93 3e-20 >At5g63690.1 unknown protein / Length = 139 Score = 92.8 bits (229), Expect = 3e-20 Identities = 43/72 (59%), Positives = 57/72 (78%) Frame = +2 Query: 8 DIVRLSNGIFSYNRSNHLLLRAGKRGKVDKAGEFTMAFVESSNMTEISWVPDPNNSSIYI 187 DIV+L+NGIFSY R++ L+LRAGKRGK++K GEFT+AFVE+ N++EI W+PDP N YI Sbjct: 64 DIVKLTNGIFSYVRNSGLILRAGKRGKMEKMGEFTVAFVETPNISEIQWIPDPENPKRYI 123 Query: 188 LHPIISPLSFIF 223 ++S S IF Sbjct: 124 QSGVVSAYSRIF 135 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,987,242 Number of Sequences: 27288 Number of extensions: 91249 Number of successful extensions: 200 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 200 length of database: 11,516,596 effective HSP length: 50 effective length of database: 10,152,196 effective search space used: 243652704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB10C12.yg.ab1 (635 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g06160.1 splicing factor 3a / ; supported by cDNA: gi_145... 251 3e-67 >At5g06160.1 splicing factor 3a / ; supported by cDNA: gi_14532639_gb_AY039944.1_ Length = 504 Score = 251 bits (640), Expect = 3e-67 Identities = 118/192 (61%), Positives = 151/192 (78%) Frame = +2 Query: 2 TNVFSAFYDRLKEIREYHRRHPSARVLDTTDELEQLLEEEPQIEFSGEEAYGRYLDLHEL 181 TNVFS FYDRLKEIREYH+RHPS R++D ++ E L+EEP I FSGEE GRYLDLH++ Sbjct: 84 TNVFSEFYDRLKEIREYHKRHPSGRLVDANEDYEARLKEEPIIAFSGEEGNGRYLDLHDM 143 Query: 182 YNDYINSKFGKKIDYTAYLDVFSQPQHIPRKLKMTRQYKDYLSKMTEYLVYFLERTEPLQ 361 YN YINSKFG++++Y+AYLDVFSQP+ IPRKLK++RQY Y+ + EYLVYF +RTEPLQ Sbjct: 144 YNQYINSKFGERVEYSAYLDVFSQPEKIPRKLKLSRQYMKYMEALLEYLVYFFQRTEPLQ 203 Query: 362 DLDRLFLKVTAEFEEQWADGKVDGWKDEAQENGHATDKNTSELDLEYYSTVNDLVIIGPE 541 DLDR+ KV ++FEEQ+ADG V+G +E + H +DL+YYSTV +LV +GPE Sbjct: 204 DLDRILSKVCSDFEEQYADGIVEGLDNELIPSQHTV------IDLDYYSTVEELVDVGPE 257 Query: 542 RLKEAIGCTGIK 577 +LKEA+G G+K Sbjct: 258 KLKEALGALGLK 269 Score = 51.6 bits (122), Expect = 3e-07 Identities = 24/29 (82%), Positives = 25/29 (85%) Frame = +3 Query: 549 RRPLGALGLKTGGTVQQRAERLFLTKHTP 635 + LGALGLK GGT QQRAERLFLTKHTP Sbjct: 260 KEALGALGLKVGGTPQQRAERLFLTKHTP 288 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,451,093 Number of Sequences: 27288 Number of extensions: 285862 Number of successful extensions: 975 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 942 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 970 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB10J02.yg.ab1 (609 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21150.1 putative protein / ribophorin II precursor, Homo ... 253 5e-68 >At4g21150.1 putative protein / ribophorin II precursor, Homo sapiens, PIR2:B26168; supported by cDNA: gi_16604453 Length = 691 Score = 253 bits (646), Expect = 5e-68 Identities = 124/197 (62%), Positives = 154/197 (77%), Gaps = 2/197 (1%) Frame = +3 Query: 3 LEGDI--VESEKKLDLPGKNDLALSANHLQKLHVSFLLTTPFGKPFKPHQALLKLRHESG 176 L+ DI VES+KKLDL ++LSANHLQKL +SF LTTP G FKPHQA KL+HES Sbjct: 433 LDSDIGSVESQKKLDLTKDGAVSLSANHLQKLRLSFQLTTPLGNAFKPHQAFFKLKHESQ 492 Query: 177 VEHIFVVGNSGTHFEITLDFLSLVEKFYYLSGQYDIELTVGDAVMENSFLQPLGSIELDL 356 VEHIF+V SG E+ LDFL LVEK YYLSG+Y+I+LT+GDA MENS L +G IELDL Sbjct: 493 VEHIFLVKTSGKKSELVLDFLGLVEKLYYLSGKYEIQLTIGDASMENSLLSNIGHIELDL 552 Query: 357 PKAPEKSTQPPPQAVNPYLRYGPKPEIAHIFRVPEKLPPQEVSFAFLGLVLVPFLAFLGG 536 P+ PEK+T+PP Q+ PY RYGPK EI+HIFR+PEKLP +++S FLG++++PF+ FL G Sbjct: 553 PERPEKATRPPLQSTEPYSRYGPKAEISHIFRIPEKLPAKQLSLVFLGVIVLPFIGFLIG 612 Query: 537 LLRLGVNLKNFPTSAHS 587 L RLGVN+K+FP+S S Sbjct: 613 LTRLGVNIKSFPSSTGS 629 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,526,258 Number of Sequences: 27288 Number of extensions: 346518 Number of successful extensions: 1232 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1228 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 966764592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB10J12.yg.ab1 (729 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g10370.1 putative glycerol-3-phosphate dehydrogenase / sim... 244 3e-65 >At3g10370.1 putative glycerol-3-phosphate dehydrogenase / similar to glycerol-3-phosphate dehydrogenase GB:BAA08926 [Mus musculus]; supported by cDNA: gi_17380777 Length = 629 Score = 244 bits (624), Expect = 3e-65 Identities = 114/152 (75%), Positives = 136/152 (89%) Frame = +1 Query: 4 GWDPAYFTVLSQEYVRMKVSHTGKVVPGVMDTAVAKHLSHSYGTMAEKVAAIAQNENLGK 183 GW+P+ FT L+Q+YVRMK ++ GKVVPG MDTA AKHLSH+YG+MA++VA IAQ E LGK Sbjct: 477 GWEPSSFTTLAQQYVRMKKTYGGKVVPGAMDTAAAKHLSHAYGSMADRVATIAQEEGLGK 536 Query: 184 RLAHGYPYLEAEVAYCARNEYCESATDFIARRSRLAFLDTDAAGRAVPRVIQILASEHQW 363 RLAHG+P+LEAEVAYCAR+EYCESA DFIARR R+AFLDTDAA RA+ RV++ILASEH+W Sbjct: 537 RLAHGHPFLEAEVAYCARHEYCESAVDFIARRCRIAFLDTDAAARALQRVVEILASEHKW 596 Query: 364 DKGRQKQELESATKFLESFKSSKNAQFHDGKH 459 DK RQKQEL+ A +FLE+FKSSKNAQF+DGKH Sbjct: 597 DKSRQKQELQKAKEFLETFKSSKNAQFNDGKH 628 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,650,100 Number of Sequences: 27288 Number of extensions: 361279 Number of successful extensions: 960 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 959 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1286100700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB10J15.yg.ab1 (695 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g15140.1 expressed protein / Contains a PF|00175 Oxidoredu... 317 3e-89 >At1g15140.1 expressed protein / Contains a PF|00175 Oxidoreductase FAD/NADH-binding domain. ESTs gb|H76345 and gb|AA651465 come from this gene; supported by cDNA: gi_15451091_gb_AY054626.1_ Length = 295 Score = 317 bits (813), Expect(2) = 3e-89 Identities = 153/209 (73%), Positives = 181/209 (86%) Frame = +3 Query: 3 VRQPDTTLWTPSPLAGVKPAAESLFHVTIDVSDSPDLASTYTVAGQYLQIRIPNVEKPSF 182 VRQ D +LWTP+PL+ ++ AAESLFH++ID+S++PDL ++YT GQYLQIR+P+VEKPSF Sbjct: 51 VRQ-DASLWTPAPLSLIESAAESLFHISIDISNAPDLVASYTRPGQYLQIRVPDVEKPSF 109 Query: 183 LAIASPPSVAVTNGVFEFLVKSIAGSTAELLCGLGKGDVVELSPVMGKGFGVDQISPPED 362 +AIASPPS+A + G FEFLVKSIAGSTAE+LCGL KG+ VELS VMG GF +D I PPE+ Sbjct: 110 MAIASPPSLASSRGAFEFLVKSIAGSTAEILCGLKKGETVELSSVMGNGFNIDLIDPPEE 169 Query: 363 YQSVFIFATGSGISPIRSLIESGFSADKRSDVRLYYGARNLQRMAYQDRFKAWESSGVTI 542 Y +V IFATGSGISPIRSLIESGF AD+RSDVRLYYGARNL RMAYQ++FK WES+GV + Sbjct: 170 YPTVLIFATGSGISPIRSLIESGFGADRRSDVRLYYGARNLNRMAYQEKFKEWESAGVKV 229 Query: 543 VPVLSQPDDGWAGEAGYVQAAFARANNFT 629 VPVLSQPDDGW GE GYVQAAFARA + Sbjct: 230 VPVLSQPDDGWKGETGYVQAAFARAKQLS 258 Score = 29.3 bits (64), Expect(2) = 3e-89 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +2 Query: 614 SEQLYAPDSTGAVLCGQNK 670 ++QL AP +TGAVLCGQ + Sbjct: 254 AKQLSAPKATGAVLCGQKQ 272 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,828,322 Number of Sequences: 27288 Number of extensions: 407993 Number of successful extensions: 1139 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1076 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1135 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1201087980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB10K16.yg.ab1 (669 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28430.1 expressed protein / ;supported by full-length cD... 99 5e-28 At5g58000.1 putative protein / similar to unknown protein (gb... 62 4e-10 >At4g28430.1 expressed protein / ;supported by full-length cDNA: Ceres:1885. Length = 457 Score = 99.0 bits (245), Expect(2) = 5e-28 Identities = 67/171 (39%), Positives = 84/171 (48%) Frame = +1 Query: 67 VNDLIMWNDVAKSTL*FGFG*LCILSSCFTTGVSFR*FILLRLFWFLQNFSFIKGT***K 246 ++DLIMW DVAKSTL FGFG +C FL KG Sbjct: 195 ISDLIMWRDVAKSTLWFGFGCIC----------------------FLSTCFAAKG----- 227 Query: 247 PHNILYIIDQLYIGIH*RCYNKPELKCFIFVFSMVALVSQLGLLCLCVLFISNMIAQRNG 426 F FS+ + +S LGLL L V F+SN + QR Sbjct: 228 -----------------------------FNFSVFSAISYLGLLFLGVSFLSNTLRQRVT 258 Query: 427 IESKRELKLKEEDILRAARVILPAVNFAISKARKLFSGQPSTTLKVAPLLL 579 E++RELKL E+D+LR AR +LP N AISK +LFSG+P+ TLKVAP +L Sbjct: 259 EEARRELKLSEDDVLRIARRMLPITNLAISKTSELFSGEPAMTLKVAPFVL 309 Score = 42.7 bits (99), Expect(2) = 5e-28 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = +3 Query: 570 IVASEYGHIATFKRLCALGFFIGFTGPKLDSLY 668 ++ +EYG++ T RLCA GFF+ FT PKL S Y Sbjct: 309 LMGAEYGYLITLWRLCAFGFFLSFTIPKLYSCY 341 >At5g58000.1 putative protein / similar to unknown protein (gb|AAD25584.1) Length = 1008 Score = 61.6 bits (148), Expect = 4e-10 Identities = 30/81 (37%), Positives = 54/81 (66%), Gaps = 2/81 (2%) Frame = +1 Query: 340 FSMVALVSQLGLLCLCVLFISNMIAQRNGIESKRE--LKLKEEDILRAARVILPAVNFAI 513 FS +++V+ +GL+ L ++F+ + R +E +R + ++EED+ R R+I+P +N ++ Sbjct: 367 FSFISVVAYMGLIYLGLMFVLKSLIHRGMVEEERHKVVGVREEDVKRMLRLIMPYLNESL 426 Query: 514 SKARKLFSGQPSTTLKVAPLL 576 + R LFSG PSTTLK+ +L Sbjct: 427 HQLRALFSGDPSTTLKMGVVL 447 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,162,609 Number of Sequences: 27288 Number of extensions: 335346 Number of successful extensions: 865 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 831 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB10N19.yg.ab1 (573 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13750.1 hypothetical protein / 107 5e-28 >At4g13750.1 hypothetical protein / Length = 2137 Score = 107 bits (266), Expect(2) = 5e-28 Identities = 49/85 (57%), Positives = 67/85 (78%), Gaps = 1/85 (1%) Frame = +1 Query: 1 RTGEVVAFKYYLSKIG-EKCVKWVNEVKESGLPYDIVVKGENNKKEYIEVKATSNARKDW 177 R GE +A++Y+++K G E VKWVN+ E+GLPYD++++ KKEY+EVKAT + RKD+ Sbjct: 2014 RKGEEIAYRYFVAKYGNEALVKWVNDQSETGLPYDLMIENRGGKKEYVEVKATVSTRKDY 2073 Query: 178 FVITVREWQFAVEKGESFSIARVVL 252 F +TVREWQFA EKGES+ IA V+L Sbjct: 2074 FNLTVREWQFANEKGESYIIAHVLL 2098 Score = 34.3 bits (77), Expect(2) = 5e-28 Identities = 14/24 (58%), Positives = 19/24 (78%) Frame = +2 Query: 266 SAQITIYRNPFKLCQSGHLQLAIL 337 +A +T +RNP KLCQ GHL+L +L Sbjct: 2102 NAILTQHRNPVKLCQEGHLRLLVL 2125 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,733,658 Number of Sequences: 27288 Number of extensions: 267283 Number of successful extensions: 724 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 859346304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB11B14.yg.ab1 (748 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g06510.1 hypothetical protein / predicted by genemark.hmm 140 5e-34 >At1g06510.1 hypothetical protein / predicted by genemark.hmm Length = 265 Score = 140 bits (354), Expect = 5e-34 Identities = 80/188 (42%), Positives = 125/188 (65%), Gaps = 1/188 (0%) Frame = +2 Query: 23 GKENEARDMLFQKKKVMQALDNTKSQIELLDELAAKLIEAISLKERQLVTTVSSDLEIEK 202 GKEN+ARD+L QKKKVMQALD K++IELLD L++KL EAIS+KE QL+ +S DLE + Sbjct: 81 GKENDARDLLLQKKKVMQALDKAKARIELLDTLSSKLNEAISVKETQLIGNISLDLEEDG 140 Query: 203 EDDESPVRVMSPSSENSEKDSLNMNDNQEPQERTNELSTEHETDDLEGFLEDHGIDKNDD 382 E+ + ++SP E++E D + ND+ +L E +D + L+ + D Sbjct: 141 ENTSGGIHIVSPKPESTE-DGVE-NDHTHLDSEGIQL-IERNVEDYQELLDTNNNVLEDV 197 Query: 383 LISS-LTGLTSFVDFLDRVDEQLNKVEAEVFTVMKFSNLILESEERPTNPKVQQLMEILD 559 I S L ++S+ FL+ +D++L+++EAE+ TV+ ++L+L E++P N KVQQ EIL+ Sbjct: 198 SIGSILKEVSSYESFLENLDQKLSRIEAELVTVVNVASLVLNHEDKPKNLKVQQTAEILE 257 Query: 560 AVQRIRKR 583 ++R+R+R Sbjct: 258 EIRRVRER 265 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,141,033 Number of Sequences: 27288 Number of extensions: 319245 Number of successful extensions: 1596 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1585 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB11H08.yg.ab1 (238 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g30610.1 unknown protein / 61 1e-10 >At2g30610.1 unknown protein / Length = 114 Score = 61.2 bits (147), Expect = 1e-10 Identities = 24/36 (66%), Positives = 27/36 (74%) Frame = +2 Query: 5 NALLPFRYFRVALVAPTTDNINPWTLCICFLELYGY 112 NALLPFR+FR+ L PT D PW CIC+LELYGY Sbjct: 77 NALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGY 112 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,872,678 Number of Sequences: 27288 Number of extensions: 80843 Number of successful extensions: 185 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 185 length of database: 11,516,596 effective HSP length: 54 effective length of database: 10,043,044 effective search space used: 241033056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB11K02.yg.ab1 (700 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g64050.1 unknown protein / 100 1e-21 >At1g64050.1 unknown protein / Length = 668 Score = 99.8 bits (247), Expect = 1e-21 Identities = 72/227 (31%), Positives = 115/227 (49%), Gaps = 9/227 (3%) Frame = +2 Query: 11 PRNGEAFVDHDMVSGQEAKQSQRKTGKSSRSN-GNGS-RRSRVAQMGASLNVTGVADTSD 184 P+NG + ++ E+ +S RK GK SRS+ GNG+ RR+++ + ++ DT + Sbjct: 102 PQNG-----YSPIASPESAESPRKRGKLSRSSSGNGTPRRTKLILLDETVRTQRDNDTKE 156 Query: 185 LHKELGSYSGKYNIAEKTQTAKPKTAVSGKRSEKRNGKIPKNKCDSFSVKAGLSSFSSAA 364 + + G + +K K +++ +GKR +KR K+P LS+ +SA Sbjct: 157 ICGQ-----GSTSCLDKPFVVKQRSSYNGKRGDKRISKVPVRT---------LSTINSAT 202 Query: 365 GGNNILGVYGSKHDIRDLVKHVEDVSLNELLDGSYKCPNSVKVKEKSTEALNGSILQSVR 544 G N G YG K I D+ K VED SL LL+GSY+CP+ K K K +E N ++L V+ Sbjct: 203 GENAFFGAYGLKPAINDVTKLVEDFSLKSLLEGSYECPSLGKDKMKKSENTNNTLLSVVK 262 Query: 545 EACSVLHLQKLSQTPKVPAADTTYN-------YSASSFLPNTSTNDE 664 S+L ++ Q+ DT + S S+ LPN+ D+ Sbjct: 263 NVWSILPTKRPVQSQSSTELDTCLSRTLGSPPSSISATLPNSENIDK 309 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,639,541 Number of Sequences: 27288 Number of extensions: 334066 Number of successful extensions: 1103 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1053 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1101 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1209984928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB12D22.yg.ab1 (760 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g62840.1 putative protein / ;supported by full-length cDN... 233 2e-80 >At5g62840.1 putative protein / ;supported by full-length cDNA: Ceres:5589. Length = 297 Score = 233 bits (595), Expect(2) = 2e-80 Identities = 121/198 (61%), Positives = 145/198 (73%) Frame = +3 Query: 18 ATTYSSDITPPPYPTTVVTSTNHPQPPQTTIKPIHRRHILASLAATITPFFAPHPHPNSD 197 A T +S + PPP P T N P T RR + +L+ I Sbjct: 7 AVTTASHLHPPPSPETYQIPLNLLSSPHIT-----RRDLFKTLSVCIA------------ 49 Query: 198 QSPHIPISVLPSANARGLFQMPPVRLTNRYFLVRAGESEYESLGVINTNPVAKTSVDNGL 377 +P + +S+ ANARGLFQMPP+RL+NRY+LVRAGES+YESLG+INTNPVAKTSVD+GL Sbjct: 50 -TPSLSVSIAAPANARGLFQMPPLRLSNRYYLVRAGESDYESLGIINTNPVAKTSVDSGL 108 Query: 378 STIGKKQTVRAALRLKEMGACENSCWIWPSITQRAYQAAEIIAAVNGVNRSNIVPEYSFL 557 S GKKQT+RAAL+LK MGAC+ +CW+WPSITQRAYQAAEIIAA+NG++RS IVPEYSFL Sbjct: 109 SEKGKKQTLRAALQLKAMGACDRNCWLWPSITQRAYQAAEIIAAINGISRSYIVPEYSFL 168 Query: 558 DARGLGAYEGKALQSFSE 611 DARGLGAYEGK L+S SE Sbjct: 169 DARGLGAYEGKKLESISE 186 Score = 84.0 bits (206), Expect(2) = 2e-80 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +2 Query: 611 IYASDLVSPDIKPPPINDGTPNESVADVFVRVTQLMSILETQYSEDTVII 760 +YA D +S KPPPI+DGTPNESV+DVFVRVTQLMSILETQYSEDT++I Sbjct: 187 VYALDSISMKTKPPPISDGTPNESVSDVFVRVTQLMSILETQYSEDTIVI 236 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,197,353 Number of Sequences: 27288 Number of extensions: 520501 Number of successful extensions: 3229 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2061 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2931 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1374797300 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB13M09.yg.ab1 (669 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g17610.1 putative protein / 260 5e-70 >At4g17610.1 putative protein / Length = 1850 Score = 260 bits (664), Expect = 5e-70 Identities = 135/226 (59%), Positives = 164/226 (71%), Gaps = 10/226 (4%) Frame = +3 Query: 18 SLQSGKLFLLELLQSVVSDTDLAKELYKKCSATHRRKVRAWQMICILSRFVDEDIISQVM 197 +L +GKLFLLELL + V D DLAKELYKK SA HRRK+RAWQMICI+SRFV DI+ QVM Sbjct: 1330 ALVAGKLFLLELLDAAVHDKDLAKELYKKYSAIHRRKIRAWQMICIMSRFVCNDIVGQVM 1389 Query: 198 DHLHTALY--------RNNMPGVRQYMETFAIHVYLKFPLLVGEQLVPMARKYDMRTQA- 350 D +H L+ RNN+P VRQY+ETFAI++YLKFP LV EQLVP+ + YD + Q Sbjct: 1390 DSVHICLHVSLQEQTERNNLPAVRQYLETFAINIYLKFPALVKEQLVPILKNYDSKAQVN 1449 Query: 351 -LSSYVFIAANVILHATKDTQSRHLDELLPPIVPLLTSHHHSLRGFTQLLVYQVLSKLLP 527 + + + ANVILHA K Q HL ELLPPI+PLLTSHHHSLRGF QLLV++VL +L P Sbjct: 1450 LRKTKMIVFANVILHAEKIAQQTHLRELLPPILPLLTSHHHSLRGFAQLLVHRVLFRLFP 1509 Query: 528 SINSYANGTLPLEKRCFMELQSYLQVTSDCARLRVSMEVHLHAFDP 665 + S ++ T+ LEK F L+SYL DC+RLR SME L A+DP Sbjct: 1510 PVESTSSHTISLEKLSFENLKSYLDKNPDCSRLRASMEGFLDAYDP 1555 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,509,643 Number of Sequences: 27288 Number of extensions: 343701 Number of successful extensions: 784 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB14B08.yg.ab1 (654 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g03910.1 hypothetical protein / predicted by genscan 308 1e-84 >At1g03910.1 hypothetical protein / predicted by genscan Length = 672 Score = 308 bits (790), Expect = 1e-84 Identities = 141/201 (70%), Positives = 169/201 (83%), Gaps = 2/201 (0%) Frame = +3 Query: 57 DLEGDEVPEAIPRSEQQEMEDEEAGSFSPELLHGDEDEEAIDPEEDRAILERNRIQVVEE 236 D E PE + E+ + E AGSFSPEL+HGD+ EEAIDPEED+ +L+ R+ V+E+ Sbjct: 436 DAEEAFSPEPVAEEEEADEAAEAAGSFSPELMHGDDREEAIDPEEDKKLLQMKRMIVLEK 495 Query: 237 QQRKLQEAMALPPP--EDSLEMRAVKAMGAMDNGDEVFGNSDEVNVDSQVYWWHDKYRPR 410 Q+++L+EAM P ED+LE++A+KAMGAM+ GD +FG++ EVN+DS+VYWWHDKYRPR Sbjct: 496 QKKRLKEAMDSKPAPVEDNLELKAMKAMGAMEEGDAIFGSNAEVNLDSEVYWWHDKYRPR 555 Query: 411 KPKYFNRVHTGYEWNKYNQTHYDHDNPPPKIVQGYKFNIFYPDLVDKTKAPVYTIERDGD 590 KPKYFNRVHTGYEWNKYNQTHYDHDNPPPKIVQGYKFNIFYPDLVDK KAP+YTIE+DG Sbjct: 556 KPKYFNRVHTGYEWNKYNQTHYDHDNPPPKIVQGYKFNIFYPDLVDKIKAPIYTIEKDGT 615 Query: 591 SAXTCIIRFHAGPTYEDIAFR 653 SA TC+IRFHAGP YEDIAFR Sbjct: 616 SAETCMIRFHAGPPYEDIAFR 636 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,325,939 Number of Sequences: 27288 Number of extensions: 409978 Number of successful extensions: 2681 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1987 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2401 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1088756792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB14G10.yg.ab1 (744 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g46450.1 SEC14 cytosolic factor, putative / supported by c... 162 6e-59 >At3g46450.1 SEC14 cytosolic factor, putative / supported by cDNA: gi_20453103 Length = 486 Score = 162 bits (410), Expect(2) = 6e-59 Identities = 80/174 (45%), Positives = 114/174 (64%), Gaps = 8/174 (4%) Frame = +1 Query: 10 VFLLTTAALEIVRRFSSAHCPFIWRGIQALQILCCPPFKWIQKWAPFTGLVKGMQTLSKP 189 VFLL A LE+VRR S A CP +W +QALQ LC PP KWIQ+WAPF L+ MQ LS+P Sbjct: 62 VFLLKIAVLEVVRRVSKAKCPHLWNSLQALQCLCYPPLKWIQRWAPFKELINAMQMLSRP 121 Query: 190 LLLLSVATGLFSELDSPKGTLSGSGAEL-TELSSQLATQDTRPANKVSRH-------VAE 345 LL++++A L + + + G+ + +E SQ +Q + + + +++ Sbjct: 122 LLVITIAEALTDQSELKQEASGGTNSHASSESESQSDSQTLQSPSDIRIEDEAPLPVISQ 181 Query: 346 NWLVQLYAELDKEGLTIPERMNEEELRRFYAVSDGDFALFLSSVKKTILWRQTY 507 +WL +LY EL+K+ L++PER+NE+EL RFY VS+GDF LSS+KKTI WR+TY Sbjct: 182 DWLRKLYEELEKQRLSLPERLNEDELHRFYRVSNGDFTSLLSSIKKTIHWRETY 235 Score = 83.2 bits (204), Expect(2) = 6e-59 Identities = 38/76 (50%), Positives = 57/76 (75%), Gaps = 1/76 (1%) Frame = +2 Query: 518 SPQELDAWANFVFWHGSDSMQRPCLIVRIGLA-ADLASIAQAQFVRAVVSQVEYXSINLL 694 S +EL+ W++ +FWHG D QRPCLIVR+GLA L S + +F +A++SQVE+ ++LL Sbjct: 239 SEEELETWSSLLFWHGYDKNQRPCLIVRLGLAFLKLPSHERPRFAQAIISQVEHGVLHLL 298 Query: 695 DAEHPQVTVLMDCDGL 742 E+ ++TVL+DC+GL Sbjct: 299 TPENSELTVLVDCEGL 314 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,623,429 Number of Sequences: 27288 Number of extensions: 413821 Number of successful extensions: 1213 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1167 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1209 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1330449000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB14K03.yg.ab1 (669 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60340.1 putative protein / predicted proteins from variou... 150 4e-37 >At5g60340.1 putative protein / predicted proteins from various species, Human, yeast, Oryctolagus sp. Length = 337 Score = 150 bits (380), Expect = 4e-37 Identities = 70/94 (74%), Positives = 83/94 (87%) Frame = +2 Query: 2 TGKTTTSSALAEATHLRHINIGDLVKDKKLHDGWDDHLQCYIINEDLVCDELEDIMEEGG 181 TGK+TT+SALAEAT+LR+I IGDLVK+K+ + GWD+ L+C+ INED V DEL+D M EGG Sbjct: 24 TGKSTTASALAEATNLRYICIGDLVKEKEFYHGWDNELECHFINEDSVIDELDDAMIEGG 83 Query: 182 IIVDYHGCDFFPERWFDRVVVLRTETSVLYDRLS 283 IVDYHGCDFFP+RWFDRVVVLRTE SVLYDRL+ Sbjct: 84 NIVDYHGCDFFPQRWFDRVVVLRTENSVLYDRLT 117 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,747,740 Number of Sequences: 27288 Number of extensions: 370029 Number of successful extensions: 1218 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1216 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB14L12.yg.ab1 (790 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16620.1 translocon Tic40-like protein / ; supported by c... 256 1e-68 At4g27850.1 putative proline-rich protein / extensin - Volvox... 52 4e-07 At5g38560.1 putative protein / contains similarity to protein... 51 6e-07 At3g28790.1 unknown protein / 51 6e-07 At1g68725.1 arabinogalactan-protein, putative (AGP19) / non-c... 51 6e-07 At3g24400.1 protein kinase, putative / similar to protein kin... 50 2e-06 At2g14890.1 arabinogalactan-protein (AGP9) / identical to gi|... 49 4e-06 At1g26150.1 Pto kinase interactor, putative / similar to Pto ... 47 9e-06 At3g50580.1 proline-rich protein / 47 9e-06 At3g24550.1 protein kinase, putative / similar to GB:BAA24694... 47 9e-06 >At5g16620.1 translocon Tic40-like protein / ; supported by cDNA: gi_16226312_gb_AF428299.1_AF428299 Length = 447 Score = 256 bits (653), Expect = 1e-68 Identities = 143/254 (56%), Positives = 170/254 (66%), Gaps = 14/254 (5%) Frame = +1 Query: 70 PFPFPPSPAPATSAPRPAATSAPAS-QRTVTVDVPPPKTEAPPAPAYS----------EG 216 PFPFPP +PA+S + + S+ A+ T T PP T+ P PA E Sbjct: 164 PFPFPPQTSPASSPFQSQSQSSGATVDVTATKVETPPSTKPKPTPAKDIEVDKPSVVLEA 223 Query: 217 EFESLKEPKKSAFIDVSPEETLKTS-FEKLEESTDTESPKDSQFPNQVSQNGSAFKPMDS 393 E KE K AF D+SPEET K S F E ++T SPK+++ V QNG+ + Sbjct: 224 SKEK-KEEKNYAFEDISPEETTKESPFSNYAEVSETNSPKETRLFEDVLQNGAGPANGAT 282 Query: 394 SFEGASSTG--TKGPAMSVEALEKMMEDPTVQKMVYPYLPEEMRNPTSFKWMLQNPQYRQ 567 + E S G GP +SVEALEKMMEDPTVQKMVYPYLPEEMRNP +FKWML+NPQYRQ Sbjct: 283 ASEVFQSLGGGKGGPGLSVEALEKMMEDPTVQKMVYPYLPEEMRNPETFKWMLKNPQYRQ 342 Query: 568 QLQDMLNNMGGSPEWDSRMMDSLXNFDISSPEVKEQFDQIGLTPERSISKIMANP*CALA 747 QLQDMLNNM GS EWD RM D+L NFD++SPEVK+QF+QIGLTPE ISKIM NP A+A Sbjct: 343 QLQDMLNNMSGSGEWDKRMTDTLKNFDLNSPEVKQQFNQIGLTPEEVISKIMENPDVAMA 402 Query: 748 FQNPRKSAAIMDCS 789 FQNPR AA+M+CS Sbjct: 403 FQNPRVQAALMECS 416 >At4g27850.1 putative proline-rich protein / extensin - Volvox carteri (fragment), Pir2:S22697 Length = 577 Score = 52.0 bits (123), Expect = 4e-07 Identities = 29/77 (37%), Positives = 36/77 (46%), Gaps = 1/77 (1%) Frame = +1 Query: 13 PGSPFPFP-PPATPGTTPGSPFPFPPSPAPATSAPRPAATSAPASQRTVTVDVPPPKTEA 189 P SP P P PP +P TPG P P P+P +P P P+S T D P P Sbjct: 195 PDSPLPLPGPPPSPSPTPG---PDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGP 251 Query: 190 PPAPAYSEGEFESLKEP 240 PP+P+ + G L P Sbjct: 252 PPSPSPTPGPDSPLPSP 268 >At5g38560.1 putative protein / contains similarity to protein kinase; supported by cDNA: gi_15983496_gb_AF424623.1_AF424623 Length = 681 Score = 51.2 bits (121), Expect = 6e-07 Identities = 31/70 (44%), Positives = 35/70 (49%), Gaps = 7/70 (10%) Frame = +1 Query: 13 PGSPFPFPP---PATPGTTPGSPFPFPPSPAPAT--SAPRPAATSA--PASQRTVTVDVP 171 P P P PP P+ PG TP P P P +P P T S P P ATSA P+S T + Sbjct: 134 PPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLA 193 Query: 172 PPKTEAPPAP 201 PP T P P Sbjct: 194 PPPTPLPVVP 203 >At3g28790.1 unknown protein / Length = 608 Score = 51.2 bits (121), Expect = 6e-07 Identities = 38/148 (25%), Positives = 64/148 (42%), Gaps = 4/148 (2%) Frame = +1 Query: 16 GSPFPFPPPATPGT-TPGSPFPFPPSPA---PATSAPRPAATSAPASQRTVTVDVPPPKT 183 GSP P P TP T TP +P P P+P+ P+T AP A + + + + + Sbjct: 277 GSPTPTPSTPTPSTPTPSTPTPSTPTPSTPTPSTPAPSTPAAGKTSEKGSESASMKKESN 336 Query: 184 EAPPAPAYSEGEFESLKEPKKSAFIDVSPEETLKTSFEKLEESTDTESPKDSQFPNQVSQ 363 + + + G KE K + D + T +S + + SP S P+ + Sbjct: 337 SKSESESAASGSVSKTKETNKGSSGDTYKDTTGTSS------GSPSGSPSGSPTPSTSTD 390 Query: 364 NGSAFKPMDSSFEGASSTGTKGPAMSVE 447 ++ K S+ GAS++ + G + S E Sbjct: 391 GKASSKGSASASAGASASASAGASASAE 418 >At1g68725.1 arabinogalactan-protein, putative (AGP19) / non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 51.2 bits (121), Expect = 6e-07 Identities = 24/55 (43%), Positives = 29/55 (52%) Frame = +1 Query: 28 PFPPPATPGTTPGSPFPFPPSPAPATSAPRPAATSAPASQRTVTVDVPPPKTEAP 192 P P P +P TP SP P P SP PA ++P PA S P Q + +PP AP Sbjct: 118 PPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAPAP 172 Score = 49.3 bits (116), Expect = 2e-06 Identities = 25/62 (40%), Positives = 31/62 (49%) Frame = +1 Query: 19 SPFPFPPPATPGTTPGSPFPFPPSPAPATSAPRPAATSAPASQRTVTVDVPPPKTEAPPA 198 +P PPP +P P SP P P SP PA ++P PA S P + + P PPA Sbjct: 108 APTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPA 167 Query: 199 PA 204 PA Sbjct: 168 PA 169 >At3g24400.1 protein kinase, putative / similar to protein kinase GB:BAA24694 from [Arabidopsis thaliana] Length = 694 Score = 49.7 bits (117), Expect = 2e-06 Identities = 46/156 (29%), Positives = 57/156 (36%), Gaps = 7/156 (4%) Frame = +1 Query: 13 PGSPFPFPPPATPGTTPGSPFPFPPSPAPATSAPRPAATSAPASQRTVTVDVPPPKTEAP 192 P SP PP TP T SP P PSP PA + P P T +P T PPP P Sbjct: 84 PPSPTTPSPPLTPSPTTPSP-PLTPSPPPAIT-PSPPLTPSPLPPSPTTPSPPPPSPSIP 141 Query: 193 PAPAYSEGEFESLKEPKKSAFIDVSPEETLKTSFEKLEESTDTESPKDSQFPNQVSQNGS 372 P + P S SP + ST SP P + GS Sbjct: 142 SPPL-------TPSPPPSSPLRPSSPPPPSPAT-----PSTPPRSPPPPSTPTPPPRVGS 189 Query: 373 AFKPMDSSFEG-------ASSTGTKGPAMSVEALEK 459 P +S G +++ G+ PA S + L K Sbjct: 190 LSPPPPASPSGGRSPSTPSTTPGSSPPAQSSKELSK 225 >At2g14890.1 arabinogalactan-protein (AGP9) / identical to gi|10880495|gb|AAG24277; supported by cDNA: gi_13265425_gb_AF324669.2_AF324669 Length = 191 Score = 48.5 bits (114), Expect = 4e-06 Identities = 40/143 (27%), Positives = 56/143 (38%), Gaps = 3/143 (2%) Frame = +1 Query: 22 PFPFPPPATPGTTPGSPFPFPPS-PAPATSAPRPAATSAPASQRTVTVDVPPPKTEAP-- 192 P P P TP T P + P P S P P T++P P T+ P + V PPP + P Sbjct: 27 PTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPAT 86 Query: 193 PAPAYSEGEFESLKEPKKSAFIDVSPEETLKTSFEKLEESTDTESPKDSQFPNQVSQNGS 372 P P S + P + P L + +P + P+ S + S Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPPPAPLAS------PPAQVPAPAPTTKPDSPSPSPS 140 Query: 373 AFKPMDSSFEGASSTGTKGPAMS 441 + P+ SS ST + PA S Sbjct: 141 SSPPLPSSDAPGPSTDSISPAPS 163 >At1g26150.1 Pto kinase interactor, putative / similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 47.4 bits (111), Expect = 9e-06 Identities = 25/61 (40%), Positives = 29/61 (46%) Frame = +1 Query: 19 SPFPFPPPATPGTTPGSPFPFPPSPAPATSAPRPAATSAPASQRTVTVDVPPPKTEAPPA 198 SP P P P +P T P P SP P S P P T AP V+ PPP++ PP Sbjct: 70 SPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVS--SPPPESSPPPP 127 Query: 199 P 201 P Sbjct: 128 P 128 >At3g50580.1 proline-rich protein / Length = 265 Score = 47.4 bits (111), Expect = 9e-06 Identities = 26/68 (38%), Positives = 33/68 (48%), Gaps = 3/68 (4%) Frame = +1 Query: 13 PGSPFPFPPPATPGTTPGSPFPFP---PSPAPATSAPRPAATSAPASQRTVTVDVPPPKT 183 P P P P+ P TP P P P PSP P S P PA +P+ T ++ P PK Sbjct: 99 PPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPS---TPSLPPPTPKK 155 Query: 184 EAPPAPAY 207 PP P++ Sbjct: 156 SPPPPPSH 163 >At3g24550.1 protein kinase, putative / similar to GB:BAA24694 from [Arabidopsis thaliana] (Plant Cell Physiol. 38 (3), 248-258 (1997));supported by full-length cDNA: Ceres:17909. Length = 652 Score = 47.4 bits (111), Expect = 9e-06 Identities = 43/146 (29%), Positives = 58/146 (39%), Gaps = 10/146 (6%) Frame = +1 Query: 46 TPGTTPGSPFPFPPS------PAPATSAPRPAAT-SAPASQRTVTVDVPPPKTEAPPA-- 198 +PGTTP P PP+ P PA S+P P T S+P + PPP + PP+ Sbjct: 6 SPGTTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLP 65 Query: 199 -PAYSEGEFESLKEPKKSAFIDVSPEETLKTSFEKLEESTDTESPKDSQFPNQVSQNGSA 375 P+ L +P SA I SP T +P+ PNQ G Sbjct: 66 PPSPPGSLTPPLPQPSPSAPITPSP-----------PSPTTPSNPRSPPSPNQ----GPP 110 Query: 376 FKPMDSSFEGASSTGTKGPAMSVEAL 453 P S+ S+T P+ S + L Sbjct: 111 NTPSGSTPRTPSNTKPSPPSDSSDGL 136 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.313 0.130 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,272,749 Number of Sequences: 27288 Number of extensions: 603450 Number of successful extensions: 10302 Number of sequences better than 1.0e-05: 20 Number of HSP's better than 0.0 without gapping: 2529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5600 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1463493900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB14N11.yg.ab1 (347 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g36930.1 expressed protein / ; supported by cDNA: gi_1502... 137 1e-33 >At2g36930.1 expressed protein / ; supported by cDNA: gi_15027948_gb_AY045831.1_ Length = 198 Score = 137 bits (345), Expect = 1e-33 Identities = 59/73 (80%), Positives = 68/73 (92%) Frame = +1 Query: 19 PLPLDEDLPGMGQYYCLHCDRYFANVAVRDEHFKTKRHKKRLKVMAGPAPHTQIDADLAA 198 PL LDEDLPGMGQ+YCLHCDRYF+NV+VRD+HFKTK+HKKR+ +M G APH+Q+DADLA Sbjct: 45 PLQLDEDLPGMGQFYCLHCDRYFSNVSVRDDHFKTKKHKKRVNMMMGQAPHSQLDADLAG 104 Query: 199 GMGMPDNGPKLMS 237 GMGMPDNGPKLMS Sbjct: 105 GMGMPDNGPKLMS 117 Score = 110 bits (276), Expect = 1e-25 Identities = 50/71 (70%), Positives = 58/71 (81%) Frame = +1 Query: 25 PLDEDLPGMGQYYCLHCDRYFANVAVRDEHFKTKRHKKRLKVMAGPAPHTQIDADLAAGM 204 P EDLPGMGQ+ CL C R F+N +V D HFKTK+HKKR+K + PAPH+Q+DADLA GM Sbjct: 127 PETEDLPGMGQFNCLLCHRNFSNASVMDYHFKTKKHKKRVKKIERPAPHSQLDADLAGGM 186 Query: 205 GMPDNGPKLMS 237 GMPDNGPKLMS Sbjct: 187 GMPDNGPKLMS 197 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,032,064 Number of Sequences: 27288 Number of extensions: 170925 Number of successful extensions: 394 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 394 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 216801312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB15J02.yg.ab1 (649 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57850.1 branched-chain amino acid aminotransferase-like prot... 291 3e-79 At3g05190.1 putative branched-chain amino acid aminotransferase ... 59 2e-09 At5g27410.1 putative amino acid aminotransferase / branched-c... 57 6e-09 >At5g57850.1 branched-chain amino acid aminotransferase-like protein / ; supported by cDNA: gi_20466633 Length = 373 Score = 291 bits (744), Expect = 3e-79 Identities = 143/210 (68%), Positives = 171/210 (81%), Gaps = 1/210 (0%) Frame = +3 Query: 18 QRYLAMYSSVFGGITTDQGAMVIPMDDHMVHRGHGVFDTAAIVDGFLYELEQHLDRFLGS 197 Q++LAMYSSV GITTD AMV+P+DDHMVHRGHGVFDTA I++G+LYEL+QHLDR L S Sbjct: 73 QQFLAMYSSVVDGITTDPAAMVLPLDDHMVHRGHGVFDTALIINGYLYELDQHLDRILRS 132 Query: 198 ASKAKIKPPFDKETTKRILVQTASASSCKNGSLRYWLSSGPGDFQLSPSGCHQSTLYAIV 377 AS AKI PFD+ET KRIL+QT S S C++GSLRYWLS+GPGDF LSPS C + TLYAIV Sbjct: 133 ASMAKIPLPFDRETIKRILIQTVSVSGCRDGSLRYWLSAGPGDFLLSPSQCLKPTLYAIV 192 Query: 378 IQDLSPPNYNGIKVITSSVPIKPPQFATMKSVNYLPNVLSKMEAEENGAYAAIWLDEQGF 557 I+ N G+KV+TSS+PIKPP+FAT+KSVNYLPNVLS+MEAE GAYA IW+ + GF Sbjct: 193 IKTNFAINPIGVKVVTSSIPIKPPEFATVKSVNYLPNVLSQMEAEAKGAYAGIWVCKDGF 252 Query: 558 VAEGPNMNVAFVA-PESDLLMPPFEKYSAG 644 +AEGPNMNVAFV +L+MP F+ +G Sbjct: 253 IAEGPNMNVAFVVNGGKELVMPRFDNVLSG 282 >At3g05190.1 putative branched-chain amino acid aminotransferase / ; supported by cDNA: gi_18087611 Length = 555 Score = 59.3 bits (142), Expect = 2e-09 Identities = 50/187 (26%), Positives = 82/187 (43%), Gaps = 12/187 (6%) Frame = +3 Query: 96 DHMVHRGHGVFDTAAIVDGFLYELEQHLDRFLGSASKAKIKPPFDKETTKRILVQTASAS 275 D +V G V++ I G +++LE+HLDR SA +E K + +T + Sbjct: 282 DSVVQGGDSVWEGLRIYKGKIFKLEEHLDRLFDSAKALAFDNVPAREEVKEAIFRTLITN 341 Query: 276 SC-KNGSLRYWLSSGPGDFQLSPSGCHQSTLYAIVIQDLSPPNYN---GIKVITSSVPIK 443 N +R L+ G ++ IV+ + PP Y+ GI ++T++ Sbjct: 342 GMFDNTHIRLSLTRGKKVTSGMSPAYNRYGCTLIVLAEWKPPVYDNEGGIVLVTATTRRN 401 Query: 444 PPQFATMK--SVNYLPNVLSKMEAEENGAYAAIWLDEQGFVAEGPNMNVAFV------AP 599 P K N L N+L+K+E+ A AI LD+ G+V+E N+ V P Sbjct: 402 SPNNLDSKIHHNNLLNNILAKIESNNTNAADAIMLDKDGYVSETNATNIFMVKKGCVLTP 461 Query: 600 ESDLLMP 620 +D +P Sbjct: 462 HADYCLP 468 >At5g27410.1 putative amino acid aminotransferase / branched-chain amino acid aminotransferase - Pseudomonas aeruginosa, SWISSPROT:ILVE_PSEAE; supported by cDNA: gi_13605848_gb_AF367323.1_AF367323 Length = 559 Score = 57.4 bits (137), Expect = 6e-09 Identities = 50/186 (26%), Positives = 82/186 (43%), Gaps = 6/186 (3%) Frame = +3 Query: 96 DHMVHRGHGVFDTAAIVDGFLYELEQHLDRFLGSASKAKIKPPFDKETTKRILVQTASAS 275 D +V G V++ I G +++LE+HLDR SA +E K + +T + Sbjct: 279 DSVVQGGDSVWEGLRIYKGKVFKLEEHLDRLSDSAKALAFNNVPTREEIKEAIFRTLITN 338 Query: 276 SC-KNGSLRYWLSSGPGDFQLSPSGCHQSTLYAIVIQDLSPPNYN---GIKVITSSVPIK 443 N +R L+ G ++ IV+ + PP Y+ GI ++T++ Sbjct: 339 GMFDNTHIRLSLTRGKKVTSGMSPAFNRYGCTLIVLAEWKPPVYDNDGGIVLVTATTRRN 398 Query: 444 PPQFATMK--SVNYLPNVLSKMEAEENGAYAAIWLDEQGFVAEGPNMNVAFVAPESDLLM 617 P K N L N+L+K+E+ AI LD+ GFV+E N+ V + D ++ Sbjct: 399 SPNNLDSKIHHNNLLNNILAKIESNNANVDDAIMLDKDGFVSETNATNIFMV--KKDRVL 456 Query: 618 PPFEKY 635 P Y Sbjct: 457 TPHADY 462 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,312,946 Number of Sequences: 27288 Number of extensions: 393177 Number of successful extensions: 1172 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 1114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1170 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1070908320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB15M19.yg.ab1 (667 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13330.1 hypothetical protein / predicted by genscan+ 327 4e-90 >At3g13330.1 hypothetical protein / predicted by genscan+ Length = 1709 Score = 327 bits (837), Expect = 4e-90 Identities = 157/210 (74%), Positives = 184/210 (86%) Frame = -3 Query: 632 QEEGFFSDTFDSLSNIHIISDNENSSRGGHGNSSFQSLADKSITRFYFDFSSSWPRTPTW 453 +EEGFF +TF+SLS+IHI +D ++SSRG HG+SSFQS+ADKSITRFYF+FS+SWPRTP+W Sbjct: 1124 REEGFFKETFESLSHIHI-TDTDSSSRGNHGSSSFQSMADKSITRFYFEFSASWPRTPSW 1182 Query: 452 ISLFGTDTFYSSFARIFKRLVQECGVPVLLSLKTALNEFVNAKERSKQCVAAEAFAGLLH 273 ISL G+D FY SFARIFKRL QECGVPVLL+LK+ L EF NAKER KQCVAAEA AG+LH Sbjct: 1183 ISLLGSDIFYPSFARIFKRLAQECGVPVLLALKSPLEEFCNAKERPKQCVAAEALAGVLH 1242 Query: 272 ADVVGLVEAWDSWMMAQLQNILLAPSVESIHEWAACIRYAVTGKGKYGIKVPLLRQRILD 93 +DV GL WDSW+M QLQN++L SVESI EWAACIRYAVTGKGK G K+P++RQ+ILD Sbjct: 1243 SDVNGLFNEWDSWIMVQLQNVILGQSVESIPEWAACIRYAVTGKGKQGTKIPVMRQQILD 1302 Query: 92 CLVEPLPQTVTTTVVAKRYSFLSAALIEVS 3 C+V PLP T TTTVVAKRY+FLSAALIE+S Sbjct: 1303 CIVAPLPPTATTTVVAKRYAFLSAALIELS 1332 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,061,957 Number of Sequences: 27288 Number of extensions: 334817 Number of successful extensions: 1199 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1192 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1112118500 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB15P11.yg.ab1 (616 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g21860.1 expressed protein / ;supported by full-length cDN... 80 9e-17 >At2g21860.1 expressed protein / ;supported by full-length cDNA: Ceres:38497. Length = 522 Score = 79.7 bits (195), Expect(2) = 9e-17 Identities = 35/55 (63%), Positives = 42/55 (75%) Frame = +1 Query: 73 VSRDGEYPNEMP*DRLYSALDRCCIKEWELFEVDNCSCEGAPLGLPEGSRLHMTV 237 V+ DG YP E +RL SAL++C IKEWELF VDNCSCE PLG+P+GSRLH + Sbjct: 455 VTPDGSYPAEKDKERLQSALEKCGIKEWELFAVDNCSCENPPLGIPQGSRLHSRI 509 Score = 23.9 bits (50), Expect(2) = 9e-17 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 Query: 36 RTAGRSYTGAVL 71 R AG+SYTGAVL Sbjct: 443 RVAGQSYTGAVL 454 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,811,253 Number of Sequences: 27288 Number of extensions: 348321 Number of successful extensions: 893 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 856 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 892 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 972741724 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB15P21.yg.ab1 (498 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g67030.1 zeaxanthin epoxidase precursor (LOS6/ABA1)(ZEP) / ... 114 4e-26 >At5g67030.1 zeaxanthin epoxidase precursor (LOS6/ABA1)(ZEP) / identical to GI:9857296 AtABA1; supported by cDNA: gi_10444087_gb_AF281655.1_AF281655 Length = 667 Score = 114 bits (284), Expect = 4e-26 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 3/87 (3%) Frame = -3 Query: 472 EVSKLHARISCKDGAFFVTDLRSEHGTWITDNEDRRYRVPPNFPARFHPSDVIDFGANKK 293 +VSK+HAR+ KDGAFF+ DLRSEHGT++TDNE RRYR PNFPARF SD+I+FG++KK Sbjct: 579 QVSKMHARVIYKDGAFFLMDLRSEHGTYVTDNEGRRYRATPNFPARFRSSDIIEFGSDKK 638 Query: 292 VAFRVKVMRYPPKI---SEGAGDRVFQ 221 AFRVKV+R PK +E D++ Q Sbjct: 639 AAFRVKVIRKTPKSTRKNESNNDKLLQ 665 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,507,940 Number of Sequences: 27288 Number of extensions: 258406 Number of successful extensions: 620 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 620 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 657445300 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB16I04.yg.ab1 (660 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24830.1 argininosuccinate synthase -like protein / argini... 233 7e-62 >At4g24830.1 argininosuccinate synthase -like protein / argininosuccinate synthase, Aquifex aeolicus, PIR2:B70398; supported by cDNA: gi_17529035 Length = 494 Score = 233 bits (594), Expect = 7e-62 Identities = 122/209 (58%), Positives = 138/209 (65%) Frame = +3 Query: 33 GAVYERKYLLGTSMARPVIAKAMVDVAKEVGADAVGHGCTGKGNDQVRIELTFFSLNPDL 212 GA+YERKYLLGTSMARPVIAKAMVDVA EVGADAV HGCTGKGNDQVR ELTFFSLNP+L Sbjct: 174 GAIYERKYLLGTSMARPVIAKAMVDVAAEVGADAVAHGCTGKGNDQVRFELTFFSLNPEL 233 Query: 213 QVVAPWREWDITR*GRCY*ICQKTQCSRPITKKSIYTRDRNLWHLRHDGDILEYPANEPN 392 +VVAPWREW+I +K P+TKKSIY+RDRNLWHL H+GD+LE PANEP Sbjct: 234 KVVAPWREWEIQGREDAIEYAKKHNVPVPVTKKSIYSRDRNLWHLSHEGDLLEDPANEPK 293 Query: 393 KDMYMMSVDPEDAPDEPE*GLFALYPFC**RF*FKHYFNCFTHIWAHYDSTHCWITFSSY 572 KDMYMMSVDPEDAPD+PE Sbjct: 294 KDMYMMSVDPEDAPDQPE------------------------------------------ 311 Query: 573 *SYYVRYLEIGIVSGIPVSIHGKELSPAS 659 Y+EIGI SG+PV+++GK LSPA+ Sbjct: 312 ------YIEIGIESGLPVALNGKALSPAT 334 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,560,641 Number of Sequences: 27288 Number of extensions: 405882 Number of successful extensions: 1151 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1149 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1106605264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB16N08.yg.ab1 (785 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09210.1 expressed protein / ; est match;supported by full... 77 3e-28 >At3g09210.1 expressed protein / ; est match;supported by full-length cDNA: Ceres:3820. Length = 333 Score = 77.4 bits (189), Expect(3) = 3e-28 Identities = 47/117 (40%), Positives = 65/117 (55%), Gaps = 30/117 (25%) Frame = +1 Query: 127 GNTKRQINKPRPVSKDDMESIFEEVKEKQEAADRAFEE----EQASSV------------ 258 GNTKRQINKPRPV D+E+IF++ KE QE AD FEE E+ +S+ Sbjct: 187 GNTKRQINKPRPVDDSDLEAIFKQAKEAQEKADSEFEEADRAEEEASILASQELLALSNS 246 Query: 259 -------------SPSVKKTSDKTKSTKRTL-LGSTVRIVSGDFVDFSGTVKKLDKK 387 +P + +TK+ K+ L GSTVR++SG F +F G +KKL++K Sbjct: 247 DVIETVAESKPKRAPRKATLATETKAKKKKLAAGSTVRVLSGTFAEFVGNLKKLNRK 303 Score = 45.4 bits (106), Expect(3) = 3e-28 Identities = 21/37 (56%), Positives = 27/37 (72%) Frame = +3 Query: 27 PGGVFIHCILNRELHNFIREDCEGVGGFVGRMVRKYK 137 PG +FI CILN+E+H+ IR D +GVGGF+G V K Sbjct: 155 PGCIFIRCILNKEIHDSIR-DVDGVGGFIGSKVGNTK 190 Score = 40.4 bits (93), Expect(3) = 3e-28 Identities = 17/29 (58%), Positives = 24/29 (82%) Frame = +2 Query: 383 RKRGLATVGFTLFGKETIADLNLSEIVQE 469 RK ATVGFTLFGKET+ +++++E+V E Sbjct: 302 RKTAKATVGFTLFGKETLVEIDINELVPE 330 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,504,075 Number of Sequences: 27288 Number of extensions: 392005 Number of successful extensions: 1272 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1219 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1266 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB16N24.yg.ab1 (809 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g01000.1 putative protein / ; supported by cDNA: gi_16209... 115 3e-26 At5g06160.1 splicing factor 3a / ; supported by cDNA: gi_145... 56 3e-08 >At4g01000.1 putative protein / ; supported by cDNA: gi_16209706 Length = 415 Score = 115 bits (288), Expect = 3e-26 Identities = 56/77 (72%), Positives = 68/77 (87%) Frame = +3 Query: 495 EEKVSTKSDCDDILKPLNFDEFNSAAELEVLGMERLKTELQERGLKCGGTLQERAARLYL 674 +E VS + C ++PLNFD+FNS A++EVLGMERLKTELQ RGLKCGGTL+ERAARL+L Sbjct: 339 KETVSVDAVCCKPVEPLNFDDFNSPADMEVLGMERLKTELQSRGLKCGGTLRERAARLFL 398 Query: 675 LKTTPVEKLPKKLLAKK 725 LK+TP++KLPKKLLAKK Sbjct: 399 LKSTPLDKLPKKLLAKK 415 >At5g06160.1 splicing factor 3a / ; supported by cDNA: gi_14532639_gb_AY039944.1_ Length = 504 Score = 55.8 bits (133), Expect = 3e-08 Identities = 29/60 (48%), Positives = 40/60 (66%) Frame = +3 Query: 543 LNFDEFNSAAELEVLGMERLKTELQERGLKCGGTLQERAARLYLLKTTPVEKLPKKLLAK 722 ++ D +++ EL +G E+LK L GLK GGT Q+RA RL+L K TP+EKL KK A+ Sbjct: 240 IDLDYYSTVEELVDVGPEKLKEALGALGLKVGGTPQQRAERLFLTKHTPLEKLDKKHFAR 299 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,463,615 Number of Sequences: 27288 Number of extensions: 443366 Number of successful extensions: 7189 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 3176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5301 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1512045612 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB16O17.yg.ab1 (787 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56720.1 putative protein / 144 7e-35 >At3g56720.1 putative protein / Length = 390 Score = 144 bits (362), Expect = 7e-35 Identities = 110/281 (39%), Positives = 148/281 (52%), Gaps = 31/281 (11%) Frame = +1 Query: 37 GSNRRSYNDRRRDDYRKREKYAEEDHINSYYKLSPHTRGGSDHSRRESGSRDGSGHIIKY 216 G R YN RD H + + ++R +D R SGH +K Sbjct: 102 GYKRDEYNRHGRDARSTSRDSRGGRHSDRRRVETEYSRLRNDSDRSSHDKYSNSGHRVKS 161 Query: 217 KKDDEKRSSWR---DSKELDDMK----------YTRFEKGKSYDQQTRGVKDRYFKEPRQ 357 + E SS R DS+ D+ K ++R E+ + D + K+ + K R Sbjct: 162 NEKGEDLSSGRRHSDSRVEDNEKRGSRWGFGDRHSRVERKEHEDPEISKEKEVHVKSSRD 221 Query: 358 LLDDRSGATANKSN------------FSVGKDTNDASKHVHHEVQSSSSKQ--GQELAAQ 495 D + AT ++ F+ G +TNDA+ E Q+S K G AA+ Sbjct: 222 RSDGKCLATEDRDTHSKKLKGFISDKFTTG-NTNDAAAE---EKQTSILKPSPGDVDAAK 277 Query: 496 VAAMKAAELVNRNLIGTGVGMSTDQKKKLLWGSKKTTPTQEVAHRWD--TSMFSDRERQE 669 VAAM+AAELVN+NL+GTG ++TDQKKKLLWG KK+T ++E AHRWD +++ D ERQE Sbjct: 278 VAAMQAAELVNKNLVGTGY-LTTDQKKKLLWGKKKSTASEESAHRWDNASALIGDPERQE 336 Query: 670 KFNKLMGVKVEPKPEIQD--SSLAEKQIELQMDLEKQYTAG 786 KFNKLMGVK + + Q+ AEKQ ELQMDLEKQYTAG Sbjct: 337 KFNKLMGVKAKVVNQEQNLGEVEAEKQKELQMDLEKQYTAG 377 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.309 0.127 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,985,883 Number of Sequences: 27288 Number of extensions: 457690 Number of successful extensions: 1173 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1163 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1454624240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB16P11.yg.ab1 (401 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g58470.1 putative protein / several hypothetical proteins ... 104 2e-23 >At3g58470.1 putative protein / several hypothetical proteins - Saccharomyces cerevisiae; supported by cDNA: gi_16648682_gb_AY058117.1_ Length = 248 Score = 104 bits (259), Expect = 2e-23 Identities = 49/75 (65%), Positives = 60/75 (79%) Frame = +2 Query: 14 RECLEKVSETVSFLKKPGESYLLLLTGAVQHDRAAQLLGLRPCGFRPQHSSKLGNEFRLF 193 RECLE+VS+T+ FL P +S LLLLTG VQ + AA+LLG+RPC F+P HSSKLGNEFRLF Sbjct: 173 RECLERVSQTILFLASPVDSLLLLLTGEVQREHAAELLGVRPCVFKPHHSSKLGNEFRLF 232 Query: 194 TNYHPGLRLCGWEQE 238 +Y PG RL G E++ Sbjct: 233 ISYDPGTRLGGLEED 247 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,993,971 Number of Sequences: 27288 Number of extensions: 190092 Number of successful extensions: 389 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 389 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 410186340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB17C03.yg.ab1 (657 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39070.1 unknown protein / 155 1e-38 At2g39080.1 unknown protein / 69 2e-12 >At2g39070.1 unknown protein / Length = 124 Score = 155 bits (393), Expect = 1e-38 Identities = 74/104 (71%), Positives = 84/104 (80%) Frame = +1 Query: 346 LYKLDRGMHLYYLKQGTIEANPHHLVNLIHYEDAASLCVAILKKKLCGRLFLGCDNHPVS 525 LY RG H Y+L + TI+A P H++NLIHYEDAASL VAI+KKK R+FLGCDNHP+S Sbjct: 7 LYTETRGAHTYWLSKETIDARPDHILNLIHYEDAASLAVAIMKKKAGARIFLGCDNHPLS 66 Query: 526 RQEVMDLVAKSGKFDNTFVGFTGTDGVLGKKLNNSKTREEIGWE 657 RQEVMDL+A+SGKFD F GFT T G LGKKLNNSKTR EIGWE Sbjct: 67 RQEVMDLMAQSGKFDKKFKGFTSTSGPLGKKLNNSKTRAEIGWE 110 >At2g39080.1 unknown protein / Length = 167 Score = 68.9 bits (167), Expect = 2e-12 Identities = 30/48 (62%), Positives = 39/48 (80%) Frame = +1 Query: 1 ETVTTDHHDELIKMGINPTLKGVKREHKFPYVIYCAPPSRSSDYAGDV 144 +TVTT+HH EL +GI P+LKG + KF YVI+CAPPS+S+DYAG+V Sbjct: 119 QTVTTNHHGELENLGIKPSLKGTEYGGKFSYVIFCAPPSQSADYAGEV 166 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,217,565 Number of Sequences: 27288 Number of extensions: 342854 Number of successful extensions: 898 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 871 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 898 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1097681028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB17C14.yg.ab1 (562 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g22570.1 expressed protein / ; supported by full-length cD... 244 2e-68 >At2g22570.1 expressed protein / ; supported by full-length cDNA: Ceres: 117955. Length = 244 Score = 244 bits (624), Expect(2) = 2e-68 Identities = 109/172 (63%), Positives = 143/172 (82%), Gaps = 1/172 (0%) Frame = +1 Query: 1 LPVDEDS-MTLTGDVTIGLVLVDIVNGFCTVGAGHLAPKVPDKQISRMVDESTQLARTFC 177 +PVDE+ + L D ++GLV+VD+VNGFCT+G+G++AP ++QIS+MV+ES +LAR FC Sbjct: 15 IPVDEEEPLILNRDSSVGLVIVDVVNGFCTIGSGNMAPTKHNEQISKMVEESAKLAREFC 74 Query: 178 EKKWPVFAFLDTHHPDVPEPPYPPHCIAGTDEANLVPALQWLENESNVTLRRKDCIDGFV 357 ++KWPV AF+D+HHPD+PE PYPPHCI GT+E+ LVPAL+WLE+E TLRRKDCI+GFV Sbjct: 75 DRKWPVLAFIDSHHPDIPERPYPPHCIIGTEESELVPALKWLESEDCATLRRKDCINGFV 134 Query: 358 GSFEKHGSNVFVHWVKKHQIEAVLVVGICTDICVLDFRCSALSAKNRGHVTP 513 GS E GSNVFV WVK+ QI+ ++VVGICTDICV DF +ALSA+N G ++P Sbjct: 135 GSMESDGSNVFVDWVKEKQIKVIVVVGICTDICVFDFVATALSARNHGVLSP 186 Score = 32.0 bits (71), Expect(2) = 2e-68 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 Query: 503 MLLPLRDVIVYSGACATFDL 562 +L P+ DV+VYS CATFDL Sbjct: 183 VLSPVEDVVVYSRGCATFDL 202 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,191,919 Number of Sequences: 27288 Number of extensions: 352191 Number of successful extensions: 1105 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1053 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1105 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 835029516 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18A13.yg.ab1 (237 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46540.1 expressed protein / ; supported by full-length c... 74 1e-14 >At2g46540.1 expressed protein / ; supported by full-length cDNA: Ceres: 25575. Length = 65 Score = 73.9 bits (180), Expect = 1e-14 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -2 Query: 176 PIVAASCLIGGFGLALPAFVRPMLDSFESTKQAPQPALSDVVAGMTGKKE 27 P+VAASCLIGG GL LPA VRP+LDS E++KQ P L+DV+AG+TGKK+ Sbjct: 15 PVVAASCLIGGVGLFLPAVVRPILDSLEASKQVKAPPLTDVIAGVTGKKQ 64 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,159,556 Number of Sequences: 27288 Number of extensions: 89889 Number of successful extensions: 240 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 240 length of database: 11,516,596 effective HSP length: 54 effective length of database: 10,043,044 effective search space used: 241033056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18B14.yg.ab1 (675 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66680.1 dolichyl-di-phosphooligosaccharide-protein glycotran... 329 9e-91 >At5g66680.1 dolichyl-di-phosphooligosaccharide-protein glycotransferase (oligosaccharyltransferase)-like / ;supported by full-length cDNA: Ceres:18419. Length = 437 Score = 329 bits (843), Expect = 9e-91 Identities = 152/175 (86%), Positives = 165/175 (93%) Frame = +2 Query: 23 AGSSNKYAKSGNEQFVTELSKWVFHERGHLKAVNVKHHRVGETDEPAIYRINDDLEYSVE 202 AGS N+Y KSGNEQFVTELSKWVFHERGHLKA N+ HHRVGETDEPAIYRI DDLE+SVE Sbjct: 263 AGSPNQYEKSGNEQFVTELSKWVFHERGHLKAGNLVHHRVGETDEPAIYRIKDDLEFSVE 322 Query: 203 IYEWSGSSWEPYVANDVQVQFYMMSPYVLKTMSTDKKGLYHASFKVPDVYGVFQFKVEYQ 382 IYEWSG SWEPYVANDVQVQFYMMSPYVLKT+STDKKGL+H SFKVPDVYGVFQFKVEY+ Sbjct: 323 IYEWSGKSWEPYVANDVQVQFYMMSPYVLKTLSTDKKGLFHTSFKVPDVYGVFQFKVEYE 382 Query: 383 RLGYTSLSLAKQIPVRPFRHNEYERFIPTAFPYYGASFSTMAAFFIFSFVYLYSK 547 +LGYT+LSL+KQIPVRP+RHNEYERFIPTA+PYYGA F+TMA FF+FSFVYLY K Sbjct: 383 KLGYTTLSLSKQIPVRPYRHNEYERFIPTAYPYYGACFTTMAGFFVFSFVYLYHK 437 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,879,381 Number of Sequences: 27288 Number of extensions: 318389 Number of successful extensions: 790 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 790 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1138809344 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18E01.yg.ab1 (596 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g13840.1 expressed protein / ; supported by cDNA: gi_1545... 270 4e-73 >At2g13840.1 expressed protein / ; supported by cDNA: gi_15450376_gb_AY052289.1_ Length = 434 Score = 270 bits (690), Expect = 4e-73 Identities = 127/198 (64%), Positives = 167/198 (84%) Frame = +1 Query: 1 LHVARAMVEAGHVENLKQAFSRYLYDGGPAYSTGSEPDAEEAVRLVCETGGVAVLAHPWA 180 +HVARA++EAG+VENL+QAF++YL+DGGPAY+TG+EP AEEAV+L+C+TGGVAVLAHPWA Sbjct: 209 MHVARALLEAGYVENLRQAFTKYLHDGGPAYATGTEPMAEEAVKLICKTGGVAVLAHPWA 268 Query: 181 LKNPVAIIRRLKEAGLHGLEVYRSDGKLAAFSDLADTYDLLKLGGSDYHARGGSSESALG 360 LKN V IIRRLK+AGLHG+EVYRSDGKL FS+LADTY+LLKLGGSDYH +GG +ES LG Sbjct: 269 LKNHVGIIRRLKDAGLHGVEVYRSDGKLEVFSELADTYNLLKLGGSDYHGKGGRNESELG 328 Query: 361 SVSLPMVAVHEFLKVARPIWCGAIKKTVDQYITEPTESNLEHILRYAKIKVVKGGGVSSI 540 SV+LP+ A+ +FL V RPIWC AIK T+ ++ +P++SNL +ILR+ K +++KG +S Sbjct: 329 SVNLPVTALQDFLNVGRPIWCEAIKATMRAFLDQPSDSNLSNILRFDKARILKG---NSA 385 Query: 541 TTRNVEIIHECLSQWLTN 594 + E++ CL+ WLT+ Sbjct: 386 WSCGKELMDRCLAIWLTS 403 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,833,121 Number of Sequences: 27288 Number of extensions: 330159 Number of successful extensions: 979 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 902 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 976 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 930958496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18E18.yg.ab1 (757 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20990.1 MOLYBDOPTERIN BIOSYNTHESIS CNX1 PROTEIN / ; supp... 302 1e-82 >At5g20990.1 MOLYBDOPTERIN BIOSYNTHESIS CNX1 PROTEIN / ; supported by cDNA: gi_1263313_gb_L47323.1_ATHCNX1R Length = 670 Score = 302 bits (774), Expect = 1e-82 Identities = 152/253 (60%), Positives = 190/253 (75%), Gaps = 2/253 (0%) Frame = +3 Query: 3 SNRAMIVAAATQHKCKIVDLGIARDDEDEISAGLDKALAADIDILLTSGGVSMGDRDFVK 182 SNRAM+VAA Q +CK+VDLGI RDD E+ LD+A+++ +DI+LTSGGVSMGDRDFVK Sbjct: 218 SNRAMLVAAVMQQQCKVVDLGIVRDDRKELEKVLDEAVSSGVDIILTSGGVSMGDRDFVK 277 Query: 183 PYFQNRGRVYFDKVTMKPGKPLTFAEIVTQSGEKV--KKVLAFGLPGNPVSCLVCFNLFV 356 P + +G+VYF KV MKPGKPLTFAEI + E + K VLAFGLPGNPVSCLVCFN+FV Sbjct: 278 PLLEEKGKVYFSKVLMKPGKPLTFAEIRAKPTESMLGKTVLAFGLPGNPVSCLVCFNIFV 337 Query: 357 VPSVRNLSGWKNPHLPRVHAYIKHSIKTDPARKEFHRAIIKWENDAGLGFPGFVAESTGH 536 VP++R L+GW +PH RV ++ IK+DP R EFHRAIIKW+++ G G PGFVAESTGH Sbjct: 338 VPTIRQLAGWTSPHPLRVRLRLQEPIKSDPIRPEFHRAIIKWKDNDGSGTPGFVAESTGH 397 Query: 537 QMSSRLLSMKSANALLELPQSGREIPYGTSVSAILISDIVGIALGNDLLSSKPDIATQNT 716 QMSSRLLSM+SANALLELP +G + G+SVSAI++SDI ++ S+P + Sbjct: 398 QMSSRLLSMRSANALLELPATGNVLSAGSSVSAIIVSDISAFSIDKKASLSEPGSIRKEK 457 Query: 717 VPIKLPDTPYKVA 755 ++P YKVA Sbjct: 458 KYDEVPGPEYKVA 470 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,995,577 Number of Sequences: 27288 Number of extensions: 416907 Number of successful extensions: 1238 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1198 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1237 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18F15.yg.ab1 (544 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g38900.1 frnE protein - like / frnE protein, Deinococcus r... 271 1e-73 >At5g38900.1 frnE protein - like / frnE protein, Deinococcus radiodurans, PIR:E75491;supported by full-length cDNA: Ceres:10982. Length = 217 Score = 271 bits (694), Expect = 1e-73 Identities = 128/181 (70%), Positives = 152/181 (83%) Frame = +1 Query: 1 KKLIKIDVTSDSVCPWCFVGKKGLDKAVALSKDQYNFEIKWHPFLLDPSAPKEGVNKKDH 180 KKLI+IDV+SDSVCPWCFVGKK LDKA+ SKDQYNFEI+W PF LDPSAPKEGV+KK+ Sbjct: 11 KKLIQIDVSSDSVCPWCFVGKKNLDKAIEASKDQYNFEIRWRPFFLDPSAPKEGVSKKEF 70 Query: 181 YKNKFGSRADQMHARMTQVFKGHGLDYDLSGLTGSSLDSHRLILFAGKQGLDKQHNLVEE 360 Y K+G+R M ARM++VFKG GL++D +GLTG+SLDSHRLI + GKQ +KQH LVEE Sbjct: 71 YLQKYGNRYQGMFARMSEVFKGLGLEFDTAGLTGNSLDSHRLIHYTGKQAPEKQHTLVEE 130 Query: 361 LMNGYFTQGKFIGDKEFLVESARKVGLEGAAEFLQDPNNGLQEVNEQLGKDAANISGVPH 540 L GYFTQGKFIGD+EFLVE+A KVG+EGA EFL DPNNG+ EV E+L K + NI+GVP+ Sbjct: 131 LFIGYFTQGKFIGDREFLVETANKVGIEGAEEFLSDPNNGVTEVKEELAKYSKNITGVPN 190 Query: 541 Y 543 Y Sbjct: 191 Y 191 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,623,738 Number of Sequences: 27288 Number of extensions: 276897 Number of successful extensions: 718 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 718 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 781156644 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18F22.yg.ab1 (708 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08530.1 NADH dehydrogenase / ;supported by full-length c... 425 e-119 >At5g08530.1 NADH dehydrogenase / ;supported by full-length cDNA: Ceres:38092. Length = 486 Score = 425 bits (1093), Expect(2) = e-119 Identities = 199/213 (93%), Positives = 210/213 (98%) Frame = +3 Query: 45 RLFSTQSATTANTAQPPPPPPPPEKTHFGGLKDEDRIFTNLYGIHDPFLKGAMKRGDWHR 224 R FSTQ+A+T+ T QPPPPPPPPEKTHFGGLKDEDRIFTNLYG+HDPFLKGAMKRGDWHR Sbjct: 28 RSFSTQAASTSTTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPFLKGAMKRGDWHR 87 Query: 225 TKDLVIKGSDWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGT 404 TKDLV+KG+DWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGT Sbjct: 88 TKDLVLKGTDWIVNEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGT 147 Query: 405 CKDREIMRNDPHKLLEGCLIAGVGMRATAAYIYIRGEYVNERLNLEKARKEAYAAGLLGK 584 CKDREIMR+DPHKLLEGCLIAGVGMRA+AAYIYIRGEYVNERLNLEKAR+EAYAAGLLGK Sbjct: 148 CKDREIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERLNLEKARREAYAAGLLGK 207 Query: 585 NACGSGYDFDVHIHFGAGAYICGEETALLESLE 683 NACGSGYDF+V+IHFGAGAYICGEETALLESLE Sbjct: 208 NACGSGYDFEVYIHFGAGAYICGEETALLESLE 240 Score = 21.2 bits (43), Expect(2) = e-119 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 683 GKQGKPRL 706 GKQGKPRL Sbjct: 241 GKQGKPRL 248 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,673,443 Number of Sequences: 27288 Number of extensions: 426620 Number of successful extensions: 5961 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4465 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1236675772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18G01.yg.ab1 (446 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01180.1 hypothetical protein / identical to hyothetical p... 166 5e-47 >At1g01180.1 hypothetical protein / identical to hyothetical protein GB:AAF26464 GI:6715637 from [Arabidopsis thaliana] Length = 478 Score = 166 bits (419), Expect(2) = 5e-47 Identities = 73/94 (77%), Positives = 86/94 (90%) Frame = +3 Query: 90 SIIFLPFSTGSTLERLCEWGVLADLIEVDAGHDFHSAWSDINRAYKLLRPGGVIFGHDYF 269 SI+ +PFSTGS LE+LCEWGV ADL+E+DAGHDF+SAW+DINRA ++LRPGGVIFGHDYF Sbjct: 210 SILPVPFSTGSALEKLCEWGVTADLVEIDAGHDFNSAWADINRAVRILRPGGVIFGHDYF 269 Query: 270 TVADNRGVRRAVNMFARVNGLRVKADGQHWVLDS 371 T ADNRGVRRAVN+FA +N L+VK DGQHWV+DS Sbjct: 270 TAADNRGVRRAVNLFAEINRLKVKTDGQHWVIDS 303 Score = 38.5 bits (88), Expect(2) = 5e-47 Identities = 14/23 (60%), Positives = 21/23 (90%) Frame = +2 Query: 2 QFRDIKMINGDTMLLYQFMQNVV 70 +F+D+ ++NGD +L+YQFMQNVV Sbjct: 181 RFKDMALVNGDVLLMYQFMQNVV 203 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,389,988 Number of Sequences: 27288 Number of extensions: 188912 Number of successful extensions: 632 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 631 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 525519208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18J12.yg.ab1 (731 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g08520.1 Mg-chelatase, putative / similar to Mg-chelatase ... 438 e-123 >At1g08520.1 Mg-chelatase, putative / similar to Mg-chelatase GB:AF014399 GI:2318116 from [Pisum sativum]; supported by cDNA: gi_16649072_gb_AY059906.1_ Length = 471 Score = 438 bits (1127), Expect = e-123 Identities = 229/244 (93%), Positives = 238/244 (96%), Gaps = 1/244 (0%) Frame = +1 Query: 1 RAKNVIFSEDRGRYIKPMLPKGPVKRLAVDATLRAAAPYQRLRREQDIQKTRKVFVEKTD 180 RAKNVIFSEDRGRYIKPMLPKGPVKRLAVDATLRAAAPYQ+LRRE+DI TRKVFVEKTD Sbjct: 197 RAKNVIFSEDRGRYIKPMLPKGPVKRLAVDATLRAAAPYQKLRREKDISGTRKVFVEKTD 256 Query: 181 MRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVAIIPFRGDAA 360 MRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQV+IIPFRGDAA Sbjct: 257 MRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVSIIPFRGDAA 316 Query: 361 EVLLPPSRSISMARKRLERLPCGGGSPLAHGLTTAVRVGMNAEKSGDVGRIMIVAITDGR 540 EVLLPPSRSI+MAR RLERLPCGGGSPLAHGLTTAVRVG+NAEKSGDVGRIMIVAITDGR Sbjct: 317 EVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDVGRIMIVAITDGR 376 Query: 541 ANISLKRSNDPE-MASDAPRPSSQELKDEILEVAGKIYKAGMSLLVIDTENKFVSTGFAK 717 ANI+LKRS DPE +A DAPRP+S+ELKDEILEVAGKIYKAGMSLLVIDTENKFVSTGFAK Sbjct: 377 ANITLKRSTDPESIAPDAPRPTSKELKDEILEVAGKIYKAGMSLLVIDTENKFVSTGFAK 436 Query: 718 EIAR 729 EIAR Sbjct: 437 EIAR 440 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,438,422 Number of Sequences: 27288 Number of extensions: 372256 Number of successful extensions: 1072 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1071 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1294970360 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB18M16.yg.ab1 (657 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49990.1 putative protein / putative protein - Drosophila ... 198 2e-51 >At3g49990.1 putative protein / putative protein - Drosophila melanogaster, EMBL:AF132172 Length = 502 Score = 198 bits (503), Expect = 2e-51 Identities = 110/206 (53%), Positives = 137/206 (66%), Gaps = 2/206 (0%) Frame = +2 Query: 2 NSSLPDDVRREILELGFPDDGYNYLSHLREIRVTGGGSSFYQNPKARPDQLPRDVKAYDA 181 +SSLP VR+EILELG+PDDGYNYL HLREI+ TGGGS+FY NPK QLPRDVKAYDA Sbjct: 82 SSSLPAHVRKEILELGYPDDGYNYLEHLREIKNTGGGSNFYVNPKYEVAQLPRDVKAYDA 141 Query: 182 SRIDVS-KANDEDSYKNSIYGVAVKTVPVRIQKAIDPEVAALLDDSDQSRFGSDVEDLEE 358 SR+ +S N+E + +Y VA KTV V++QKAIDPEVAALL++SD S FGSDVEDLEE Sbjct: 142 SRVKISGMVNEEGNDNKLMYSVASKTVNVKVQKAIDPEVAALLENSDGSEFGSDVEDLEE 201 Query: 359 DFVINANLPDESEDVQLDN-KLTSTEKSYANSKEDDYYTKPSQDNFLHNIASSETLVNAK 535 DFV+ ANL + E + N +L + + +E D +P +N Sbjct: 202 DFVVQANLTQKGESSGVSNGELEFSVRREVRERESD---EPVAEN--------------- 243 Query: 536 PRERRPLDEQFDMLELQEYGTDDESE 613 PR R +DE FD LEL EYG+D + + Sbjct: 244 PRVPRQIDELFDQLELNEYGSDSDGD 269 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,962,331 Number of Sequences: 27288 Number of extensions: 302260 Number of successful extensions: 1266 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1174 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1233 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1097681028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB19A09.yg.ab1 (701 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54520.1 expressed protein / ;supported by full-length cDN... 260 6e-70 >At1g54520.1 expressed protein / ;supported by full-length cDNA: Ceres:13758. Length = 391 Score = 260 bits (664), Expect = 6e-70 Identities = 127/172 (73%), Positives = 150/172 (86%) Frame = +2 Query: 185 VGLLGMGRTLQRDLNRIAEAADTSTPEGLSFVLQETTLALLRHPDYCISGYSSADVKKSV 364 VGLLG+GRTLQ+D NR+AE++DTSTPEGLS+VL E TLALLRHPDYCIS YSS DVK S+ Sbjct: 216 VGLLGLGRTLQQDFNRLAESSDTSTPEGLSYVLTEATLALLRHPDYCISCYSSVDVKPSI 275 Query: 365 EEGEKRFNQLSIEERGKFDEETLVNVNNIRKQSTTSQRSNGFRNEYIVITIIVAAGGVHK 544 E+GEKRFNQLSIEERGKFDEETLVNVN+I++QS+ ++++GF NEYIV+TI++AA G+HK Sbjct: 276 EKGEKRFNQLSIEERGKFDEETLVNVNSIKRQSSKIRKASGFSNEYIVVTILMAAEGIHK 335 Query: 545 LPPINSSAQLKETLQKLASIPSCRIMAVDVLWTPPNENDTLSERELLEDYSL 700 LPPIN + LKE L KL SIP +IMAV+VLWTP NE D LSERELLEDY L Sbjct: 336 LPPINGTTDLKEALLKLGSIPRNKIMAVEVLWTPQNEADALSERELLEDYPL 387 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,962,825 Number of Sequences: 27288 Number of extensions: 316716 Number of successful extensions: 851 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 837 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 850 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1218881876 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB19B05.yg.ab1 (733 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g15660.1 hypothetical protein / predicted by genemark.hmm 92 4e-19 >At1g15660.1 hypothetical protein / predicted by genemark.hmm Length = 710 Score = 91.7 bits (226), Expect = 4e-19 Identities = 65/233 (27%), Positives = 111/233 (46%), Gaps = 6/233 (2%) Frame = -2 Query: 690 NPQKNRPALARKRAKFSMKPDTSQSSTILEPTFQMDQLHDPADFFAAYEKFEN-----TR 526 N ++ RP L RKR FS+ TSQ + P+F + DFFAAY+KFE Sbjct: 86 NKRERRPGLDRKRKSFSLHLTTSQPPPVA-PSFDPSKYPRSEDFFAAYDKFEPGFETVAN 144 Query: 525 KELKKQRGEDPNE-PRIPTTARQRRPEIPRRKTSYQHHVYSSQPENDVLSSQEALQDTVE 349 +E +KQ G + P + R RRP IP RK ++ DV++ + + ++ Sbjct: 145 REWQKQTGSSVIDIQENPPSRRPRRPGIPGRKRRPFKESFTDSYFTDVINLEASEKEIPI 204 Query: 348 SQPIHDSQHEAVTPNSQPKEKVAGSVTKAEDRDKLFDDLMSSNIADLDGNEALSYLQNRL 169 + A + +E +V +D + + DL++ + +L+G+ A+ L+ RL Sbjct: 205 ASEQSLESATAAHVTTVDREVDDSTVDTDKDLNNVLKDLLACSREELEGDGAIKLLEERL 264 Query: 168 NIKPVSINKLQLPNFHDIPTVNLLSSVNSIKDQNILPDIRALSDNLNEITPAK 10 IK +I K +P F D+ +NL +S ++ ++ L DI+ + N + K Sbjct: 265 QIKSFNIEKFSIPEFQDVRKMNLKASGSNPPNRKSLSDIQNILKGTNRVAVRK 317 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,328,433 Number of Sequences: 27288 Number of extensions: 327963 Number of successful extensions: 1268 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1204 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1262 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1294970360 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB19B07.yg.ab1 (599 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11770.1 NADH dehydrogenase (ubiquinone) / ;supported by ... 268 2e-72 >At5g11770.1 NADH dehydrogenase (ubiquinone) / ;supported by full-length cDNA: Ceres:13161. Length = 218 Score = 268 bits (685), Expect = 2e-72 Identities = 133/161 (82%), Positives = 140/161 (86%), Gaps = 6/161 (3%) Frame = +3 Query: 135 RLALLASSQRAAAS-----IHTTLPVLADGFSSPAPYSRPGPPATGSPA-GLSKTAEFVI 296 RL LL SQRA A+ +HT+LP L+ +SP Y+RPGPP+T P GLSK AEFVI Sbjct: 11 RLPLLLQSQRAVAAASVSHLHTSLPALSPS-TSPTSYTRPGPPSTSPPPPGLSKAAEFVI 69 Query: 297 SKVDDLMNWARRGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMIVAG 476 SKVDDLMNWAR GSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMIVAG Sbjct: 70 SKVDDLMNWARTGSIWPMTFGLACCAVEMMHTGAARYDLDRFGIIFRPSPRQSDCMIVAG 129 Query: 477 TLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYS 599 TLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYS Sbjct: 130 TLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYS 170 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,378,362 Number of Sequences: 27288 Number of extensions: 428028 Number of successful extensions: 2741 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2644 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 939910020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB19E06.yg.ab1 (659 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g31870.1 unknown protein / 263 6e-71 >At1g31870.1 unknown protein / Length = 561 Score = 263 bits (672), Expect = 6e-71 Identities = 130/205 (63%), Positives = 163/205 (79%), Gaps = 2/205 (0%) Frame = +3 Query: 51 DLSPPMEESDRPKTGLVSGKDIKEEITKAKKEDWLRFQKMDPSISGRNAEGIRRDKKTGA 230 D SPP ++ KTGL+SGKDI E K K+++ LRF+ MD ++G+NAE + RDK TG Sbjct: 335 DSSPPQISKEQRKTGLISGKDIGSEYRKKKEDEKLRFKNMDSELTGQNAEAVFRDKITGK 394 Query: 231 RLTKEQ-IEALQKKD-EKPKEIKLEWGKGLAQKREAEARQKELELEKAKPFARTRDDDDL 404 R++KE+ +++ QKK EKPKEIKLEWGKGLAQKREAEAR +ELELEK KPFARTRDD +L Sbjct: 395 RISKEEYLKSKQKKVIEKPKEIKLEWGKGLAQKREAEARLQELELEKDKPFARTRDDPEL 454 Query: 405 NDIQKNAIRWGDPMAHLVKKKQSEVFLPDIGDNEKMKESGFIVPQQIPNHSWLKRGLDAA 584 + + K +R+GDPMAHLVKK++ E L D+GD+E+MK+SGFI+PQ +P HSWL R L+AA Sbjct: 455 DQMMKERVRFGDPMAHLVKKRKYETTLVDLGDDEEMKKSGFIIPQSVPKHSWLTRRLEAA 514 Query: 585 PNRYGIKPGRHXDGVDRSNGFEKQM 659 NRYGIKPGRH DGVDRSNG EK + Sbjct: 515 SNRYGIKPGRHWDGVDRSNGTEKDL 539 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,930,876 Number of Sequences: 27288 Number of extensions: 343924 Number of successful extensions: 1356 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1332 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1106605264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB19F10.yg.ab1 (728 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g05990.1 enoyl-ACP reductase (enr-A) / 227 6e-60 >At2g05990.1 enoyl-ACP reductase (enr-A) / Length = 390 Score = 227 bits (578), Expect = 6e-60 Identities = 123/201 (61%), Positives = 146/201 (72%), Gaps = 1/201 (0%) Frame = +3 Query: 129 TNITNMHLAIAKASAFSSHQVSKSSIADFSSGAKGASCAKLRSSCHIASTK-LSSQNVKF 305 T +++ +A + S S ++ K+ + AS KL + +++ L + + Sbjct: 4 TAASSLQIATRRPSMSSPSKILKAGTYIVGANPGNASWDKLSCTRQLSNLGCLRNHSAVP 63 Query: 306 SDSRFERVITKAVSASSDTKPLPGLPVDLRGKRAFIAGIADDNGYGWAIAKSLAAAGAEI 485 + R T+A+S SS+ K GLP+DLRGKRAFIAGIADDNGYGWAIAKSLAAAGAEI Sbjct: 64 TCKRPFSFSTRAMSESSENKAPSGLPIDLRGKRAFIAGIADDNGYGWAIAKSLAAAGAEI 123 Query: 486 LVGTWVPALNIFETSLRRGKFDESRVLPDGSLMEITKVYPLDAVYDTPEDVHEDVKTNKR 665 LVGTWVPALNIFETSLRRGKFD+SRVLPDGSLMEI KVY LDAV+D PEDV EDVKTNKR Sbjct: 124 LVGTWVPALNIFETSLRRGKFDQSRVLPDGSLMEIKKVYALDAVFDNPEDVPEDVKTNKR 183 Query: 666 YAGSSKWTVNEVAESVKEDFG 728 YAGSS WTV E AE VK+DFG Sbjct: 184 YAGSSNWTVQEAAECVKKDFG 204 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,652,297 Number of Sequences: 27288 Number of extensions: 339810 Number of successful extensions: 946 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 945 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1286100700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB19J05.yg.ab1 (692 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11240.1 expressed protein / ;supported by full-length cDN... 164 4e-41 At3g56150.1 PROBABLE EUKARYOTIC TRANSLATION INITIATION FACTOR 3 ... 47 7e-06 At3g28770.1 hypothetical protein / 47 1e-05 >At1g11240.1 expressed protein / ;supported by full-length cDNA: Ceres:111951. Length = 200 Score = 164 bits (415), Expect = 4e-41 Identities = 100/196 (51%), Positives = 124/196 (63%), Gaps = 8/196 (4%) Frame = +1 Query: 34 AHHIKKRALKNKALSISFDEKGLSDFVTGFHKRKKKRRKEAQNQQQEALRRKRIELRKKR 213 A HI KRA KNK+L++SFDEK L DFVTGFHKRKKKRRKEAQ QQ+EA RRKRIE RK R Sbjct: 19 ARHIGKRARKNKSLTVSFDEKDLKDFVTGFHKRKKKRRKEAQKQQEEAFRRKRIEARKNR 78 Query: 214 KLDREYVLYGGAAPDPEGESNKNDEVEDDEQDNNNDDDDDEEEENPTSVSGTKVYDTGNV 393 KL+ E ++ G GE N++ E ED+ D +DEE E S S T +YDTG + Sbjct: 79 KLE-ELMVAG------NGEDNEDGEAEDEV------DAEDEEAEPDASTSATTMYDTGEL 125 Query: 394 KVMVTTSEISREDDFAEVPKLTLGSEK--------KPNLPVIKKKPLKKVERRRSRPKAL 549 KV VTTSEISRE++ + T +E K +PV K KP+K+ RRRS K + Sbjct: 126 KVTVTTSEISREEEEPIRKEKTQSTESGSTAKASTKQPVPVRKTKPMKQ-SRRRSTTKTM 184 Query: 550 TKRDKRKGKTKVEKRR 597 KRDK+K ++ R Sbjct: 185 KKRDKKKQARGIKTSR 200 >At3g56150.1 PROBABLE EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 8 / ; supported by cDNA: gi_2789659_gb_AF040102.1_AF040102 Length = 900 Score = 47.4 bits (111), Expect = 7e-06 Identities = 24/80 (30%), Positives = 41/80 (51%) Frame = +1 Query: 136 KKRRKEAQNQQQEALRRKRIELRKKRKLDREYVLYGGAAPDPEGESNKNDEVEDDEQDNN 315 K+ +K+ +AL + +L+K KL + + AP+ E E D+ +DD+ D+ Sbjct: 127 KEAKKKMSTSNSKALNSMKQKLKKNNKLYEDDINKYREAPEVEEEKQPEDDDDDDDDDDE 186 Query: 316 NDDDDDEEEENPTSVSGTKV 375 +DDDD + PT G+ V Sbjct: 187 VEDDDDSSIDGPTVDPGSDV 206 >At3g28770.1 hypothetical protein / Length = 2081 Score = 47.0 bits (110), Expect = 1e-05 Identities = 41/198 (20%), Positives = 83/198 (41%) Frame = +1 Query: 1 DDVQSQQHGVQAHHIKKRALKNKALSISFDEKGLSDFVTGFHKRKKKRRKEAQNQQQEAL 180 +D S+ + + KK K +A EK S K ++R+ + + ++ L Sbjct: 1003 EDSASKNREKKEYEEKKSKTKEEAKK----EKKKSQDKKREEKDSEERKSKKEKEESRDL 1058 Query: 181 RRKRIELRKKRKLDREYVLYGGAAPDPEGESNKNDEVEDDEQDNNNDDDDDEEEENPTSV 360 + K+ E K K + E E E NK+ + E+D+++ ++ ++ Sbjct: 1059 KAKKKEEETKEKKESENHKSKKKEDKKEHEDNKSMKKEEDKKEKKKHEESKSRKKEEDKK 1118 Query: 361 SGTKVYDTGNVKVMVTTSEISREDDFAEVPKLTLGSEKKPNLPVIKKKPLKKVERRRSRP 540 K+ D + K +E + V K + EKK N +K K++E +S+ Sbjct: 1119 DMEKLEDQNSNKKKEDKNEKKKSQHVKLVKKESDKKEKKEN---EEKSETKEIESSKSQK 1175 Query: 541 KALTKRDKRKGKTKVEKR 594 + K++K+ K + +K+ Sbjct: 1176 NEVDKKEKKSSKDQQKKK 1193 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.315 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,589,790 Number of Sequences: 27288 Number of extensions: 386958 Number of successful extensions: 8293 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 3591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5862 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1192191032 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB19P08.yg.ab1 (527 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58220.1 similar to unknown protein (pir||T34863) / ; supp... 135 1e-32 >At5g58220.1 similar to unknown protein (pir||T34863) / ; supported by cDNA: gi_17065389 Length = 324 Score = 135 bits (341), Expect = 1e-32 Identities = 67/108 (62%), Positives = 81/108 (74%) Frame = +2 Query: 17 PVAGIEVQLEMYNAKQPGPVFGESDKDKWILQGSSTTDKDGRSGQLMKIVNDLSPGVYRI 196 P AG+EV LE+++ GP F W G+S TD+DGRSG LM +V+ L+PG YRI Sbjct: 218 PAAGVEVHLEVWSGTT-GPSFVHGGGGVWSSVGTSATDRDGRSGPLMDLVDALNPGTYRI 276 Query: 197 SFNTGKYNPDGFFPFVSIVFKVKESQKMEHFHVPLLLSPFSFSTYRGS 340 SF+T KY+P FFP+VSIVF+V ESQK EHFHVPLLL+PFSFSTYRGS Sbjct: 277 SFDTAKYSPGCFFPYVSIVFQVTESQKWEHFHVPLLLAPFSFSTYRGS 324 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,196,468 Number of Sequences: 27288 Number of extensions: 267684 Number of successful extensions: 682 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 682 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 736262584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB1b06.yg.ab1 (595 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49555.1 phytoene dehydrogenase [phytoene desaturase](PDS)-re... 328 1e-90 >At5g49555.1 phytoene dehydrogenase [phytoene desaturase](PDS)-related / similar to several microbial phytoene dehydrogenase-like proteins; contains PF02032: Phytoene dehydrogenase related enzyme domain Length = 556 Score = 328 bits (841), Expect = 1e-90 Identities = 148/180 (82%), Positives = 166/180 (92%) Frame = +2 Query: 2 PQHMGTIHIGSETIEEIETACQEARNGLPSRRPVIEMTIPSVLDKTISPPGKHVINLFVQ 181 P+H GTIHIG+E+++E+ +AC ++ NGLPSRRPVIEMTIPS LD TISPPGKHVINLF+Q Sbjct: 375 PEHFGTIHIGAESMDEVHSACHDSENGLPSRRPVIEMTIPSTLDNTISPPGKHVINLFIQ 434 Query: 182 FTPYKPNDGSWEDTAYRESFAQRCFNLIDEYAPGFSSSVIGYDMLAPPDLERIIGLTGGN 361 +TPYKP+DGSWED YRE+FAQRCF LIDEYAPGFSSS+I YDML PPDLER IGLTGGN Sbjct: 435 YTPYKPSDGSWEDPTYREAFAQRCFKLIDEYAPGFSSSIISYDMLTPPDLEREIGLTGGN 494 Query: 362 IFHGAMGLDSLFLMRPVKGWSNYRTPLRGLYLCGSGAHPGGGVMGAPGRNAARVVIDDIK 541 IFHGAMGLDSLFLMRPVKGWSNYR+PL+GLYLCGSGAHPGGGVMGAPGRNAA VV+ D+K Sbjct: 495 IFHGAMGLDSLFLMRPVKGWSNYRSPLKGLYLCGSGAHPGGGVMGAPGRNAAHVVLQDLK 554 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,621,481 Number of Sequences: 27288 Number of extensions: 349688 Number of successful extensions: 1055 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 991 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1053 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 922006972 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20A01.yg.ab1 (743 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32770.1 putative protein / predicted protein, Synechocyst... 332 e-103 >At4g32770.1 putative protein / predicted protein, Synechocystis sp., PIR2:S74814; supported by cDNA: gi_14334011_gb_AF302188.1_AF302188 Length = 488 Score = 332 bits (851), Expect(2) = e-103 Identities = 150/195 (76%), Positives = 168/195 (85%) Frame = +1 Query: 73 VNPVYVPTPTNRPLRPPHSGYHFDGTTRKFFEGWYFKVSIPEQRQSFCFMYSVENPAFKK 252 V PVYVPT NR LR PHSGYHFDGT RKFFEGWYF+VSIPE+R+SFCFMYSVENPAF++ Sbjct: 62 VKPVYVPTSPNRELRTPHSGYHFDGTPRKFFEGWYFRVSIPEKRESFCFMYSVENPAFRQ 121 Query: 253 DLNILEQLQHGPRFTGVGAQILGAHDKYICQYSKESHNFWGSRHELMLGNSFSVQTGKQP 432 L+ LE +GPRFTGVGAQILGA+DKY+CQY ++SHNFWG RHEL+LGN+FS G + Sbjct: 122 SLSPLEVALYGPRFTGVGAQILGANDKYLCQYEQDSHNFWGDRHELVLGNTFSAVPGAKA 181 Query: 433 PNSEVPPQVFNQRVIEGFQVTPLWHQGFIRDDGRTSYAETVKTARWEYSTRPVYGWGDVG 612 PN EVPP+ FN+RV EGFQ TP WHQG I DDGRT YAETVK+ARWEYSTRPVYGWGDVG Sbjct: 182 PNKEVPPEEFNRRVSEGFQATPFWHQGHICDDGRTDYAETVKSARWEYSTRPVYGWGDVG 241 Query: 613 SKQKSTAGWLAAFPV 657 +KQKSTAGW AAFPV Sbjct: 242 AKQKSTAGWPAAFPV 256 Score = 62.4 bits (150), Expect(2) = e-103 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 648 FSCIEPHWRICMAGGLSTGWIEWGDERYEFEN 743 F EPHW+ICMAGGLSTGWIEWG ER+EF + Sbjct: 254 FPVFEPHWQICMAGGLSTGWIEWGGERFEFRD 285 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,009,858 Number of Sequences: 27288 Number of extensions: 430116 Number of successful extensions: 1183 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1183 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1330449000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20F24.yg.ab1 (730 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g38630.1 26S proteasome regulatory subunit S5A (RPN10) / i... 292 1e-79 >At4g38630.1 26S proteasome regulatory subunit S5A (RPN10) / identical to multiubiquitin chain binding protein (MBP1) SP:P55034, GI:1165206; supported by full-length cDNA: Ceres:6757. Length = 386 Score = 292 bits (748), Expect = 1e-79 Identities = 159/243 (65%), Positives = 194/243 (79%), Gaps = 1/243 (0%) Frame = +1 Query: 1 IQVAQLALKHRQNKKQQQRIIVFAGGPVKYDKKVLEMIGKKLKKNSVALDVVNFGE-EDE 177 IQ+AQLALKHRQNK Q+QRIIVFAG P+KY+KK LE++GK+LKKNSV+LD+VNFGE +DE Sbjct: 91 IQIAQLALKHRQNKNQRQRIIVFAGSPIKYEKKALEIVGKRLKKNSVSLDIVNFGEDDDE 150 Query: 178 SKTEKLEALVAAVNNNDSSHIVHVPAGANALSDVLLSTPIFTGDGEGGSGFAAAAAAAAA 357 K +KLEAL+ AVNNND SHIVHVP+GANALSDVLLSTP+FTGD EG SG+ +AAAAAAA Sbjct: 151 EKPQKLEALLTAVNNNDGSHIVHVPSGANALSDVLLSTPVFTGD-EGASGYVSAAAAAAA 209 Query: 358 GGVSGFDFGVDPNLDPELALALRVSMEEERARQEAAAKKAADDSSKQGKEGESTSQDATM 537 G FDFGVDPN+DPELALALRVSMEEERARQEAAAKKAAD++ ++ K+G++ S Sbjct: 210 AG-GDFDFGVDPNIDPELALALRVSMEEERARQEAAAKKAADEAGQKDKDGDTASASQ-- 266 Query: 538 LENVGTSVSESENKKDDLMDDENALLQQAPGMSMDDPSATVTTRDPDMSEAAADDQDLAL 717 +V+ + +K + MD+++ALL QA MS+ D +MSEAA +DQDLAL Sbjct: 267 -----ETVARTTDKNAEPMDEDSALLDQAIAMSVG---------DVNMSEAADEDQDLAL 312 Query: 718 ALQ 726 ALQ Sbjct: 313 ALQ 315 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.307 0.125 0.328 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,287,149 Number of Sequences: 27288 Number of extensions: 432046 Number of successful extensions: 2853 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2718 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1286100700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20I23.yg.ab1 (715 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15680.1 hypothetical protein / 341 3e-94 >At5g15680.1 hypothetical protein / Length = 2163 Score = 341 bits (874), Expect = 3e-94 Identities = 169/218 (77%), Positives = 190/218 (86%) Frame = +1 Query: 34 ESETTGGKVPAFEGVQPLVLKGLMSTVSHGVSIEVLSQITVHSCDSIFGDPETRLLMHII 213 E + G +P FEGVQPLVLKGLMSTVSH SIEVLS+ITV SCDSIFGD ETRLLMHI Sbjct: 1846 EMPPSSGTLPKFEGVQPLVLKGLMSTVSHEFSIEVLSRITVPSCDSIFGDAETRLLMHIT 1905 Query: 214 GLLPWLCLQLNQDAVAGPASPLLHQYQKACSVSTNLAIWCRAKSLDELATVFMAYSQGGI 393 GLLPWLCLQL QD V A PL QYQKACSV++N+A+WCRAKSLDELATVF+AY++G I Sbjct: 1906 GLLPWLCLQLTQDQVMVSALPLQQQYQKACSVASNIAVWCRAKSLDELATVFVAYARGEI 1965 Query: 394 KTIDNLLASVSPLLCNEWLPKHSALAFGHLLKLLERGPVEYQRVILLLMKALLQHTPTDA 573 K ++NLLA VSPLLCN+W PKHSALAFGHLL+LL++GPV+YQRVILL++KALLQHTP DA Sbjct: 1966 KRVENLLACVSPLLCNKWFPKHSALAFGHLLRLLKKGPVDYQRVILLMLKALLQHTPMDA 2025 Query: 574 AQSPHMYAIVSQLVESTLCXEALSVLEALLQSCSSLTG 687 +QSPHMY IVSQLVESTLC EALSVLEALLQSCS + G Sbjct: 2026 SQSPHMYTIVSQLVESTLCWEALSVLEALLQSCSPVQG 2063 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,194,240 Number of Sequences: 27288 Number of extensions: 346944 Number of successful extensions: 993 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 958 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 992 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1254469668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20J03.yg.ab1 (560 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g54690.1 sugar-phosphate isomerase - like protein / gutq/k... 189 8e-72 >At3g54690.1 sugar-phosphate isomerase - like protein / gutq/kpsf family sugar-p isomerase, Chlamydia pneumoniae, PIR:E72068;supported by full-length cDNA: Ceres:36743. Length = 350 Score = 189 bits (481), Expect(2) = 8e-72 Identities = 95/119 (79%), Positives = 105/119 (87%) Frame = +3 Query: 204 KKQEELPVCRQGDLIMDQLLELTSKGCGRLLVIDDDYHLIGTFTDGDLRRTLKASKEGIF 383 KKQEELPVC++GDLIMDQL+ELTSKGCG LLV+D+ LIGTFTDGDLRRTLKAS E IF Sbjct: 230 KKQEELPVCKEGDLIMDQLVELTSKGCGCLLVVDEHSRLIGTFTDGDLRRTLKASGEAIF 289 Query: 384 KLTVGEMRSRNPRTITA*RMAAEAMQKMEAPPSPVQFLPVINEDNTLIGIATLHGLVSA 560 KL+VGEM +R PRTI MA EAM+KME+PPSPVQFLPV+NEDNTLIGI TLHGLVSA Sbjct: 290 KLSVGEMCNRKPRTIGPETMAVEAMKKMESPPSPVQFLPVVNEDNTLIGIVTLHGLVSA 348 Score = 98.2 bits (243), Expect(2) = 8e-72 Identities = 47/62 (75%), Positives = 56/62 (89%) Frame = +2 Query: 23 RELCPFDLAPTTSTAIQMVFGCTVAIAMMDAKCLTKEGYAANHPAGRIGKSLIFKVNDVI 202 RELCPF+LAP TSTAIQMVFG T+A+A+M A+ L+KE YAANHPAGRIGKSLIFKV DV+ Sbjct: 170 RELCPFNLAPVTSTAIQMVFGDTIAVALMAARNLSKEEYAANHPAGRIGKSLIFKVKDVM 229 Query: 203 EE 208 ++ Sbjct: 230 KK 231 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,766,000 Number of Sequences: 27288 Number of extensions: 326939 Number of successful extensions: 1247 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1244 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 835029516 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20J17.yg.ab1 (757 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g45380.1 urea active transporter-like protein / 314 1e-88 >At5g45380.1 urea active transporter-like protein / Length = 694 Score = 314 bits (804), Expect(2) = 1e-88 Identities = 156/233 (66%), Positives = 181/233 (76%), Gaps = 5/233 (2%) Frame = +2 Query: 2 KQILKVSRTVVFSFGCFMGILAVILNKAGVSLGWMYLAMGVLIGSAVIPIAFLLLWRKAN 181 +QILK+SR V FGCFMGILAV+LNKAGVSLGWMYLAMGVLIGSAVIPIAF+LLW KAN Sbjct: 426 RQILKISRCAVLGFGCFMGILAVVLNKAGVSLGWMYLAMGVLIGSAVIPIAFMLLWSKAN 485 Query: 182 AFGAILGTIVGCVLGIITWLLVTSVEYGRVNLDTTGRNAPMLAGNLVSILTGGAVHAICS 361 AFGAILG GCV GIITWL +YGRV+LD+TG+N PMLAGNLV+ILT Sbjct: 486 AFGAILGATSGCVFGIITWLTTAKTQYGRVDLDSTGKNGPMLAGNLVAILT--------- 536 Query: 362 FLRPQNYDWETTKQITIVE-----KEKSELAVDEFKEEKLISAKKWIVKWGVGFTFVIVV 526 +RPQNYDW TT++I +VE E ++ +E +EEKL AK WIVKWG+ FT +IVV Sbjct: 537 -VRPQNYDWSTTREIKVVEAYASGDEDVDVPAEELREEKLRRAKAWIVKWGLVFTILIVV 595 Query: 527 LWPLFSLPAKEFSKGYFTFWAVVAIAWGTIGSAVIIILPLAESWQTIQSVIDG 685 +WP+ SLPA+ FS+GYF FWA+VAIAWGTIGS VII LPL ESW TI+SV G Sbjct: 596 IWPVLSLPARVFSRGYFWFWAIVAIAWGTIGSIVIIGLPLVESWDTIKSVCMG 648 Score = 30.4 bits (67), Expect(2) = 1e-88 Identities = 11/21 (52%), Positives = 19/21 (90%) Frame = +3 Query: 681 MGMVTNDKLVEKIDELNLKLK 743 MGM TND++++K+D+LN +L+ Sbjct: 647 MGMFTNDRVMKKLDDLNHRLR 667 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,364,727 Number of Sequences: 27288 Number of extensions: 398523 Number of successful extensions: 1111 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1077 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1109 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20L24.yg.ab1 (730 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57460.1 unknown protein / 303 5e-83 >At5g57460.1 unknown protein / Length = 646 Score = 303 bits (777), Expect = 5e-83 Identities = 153/238 (64%), Positives = 188/238 (78%), Gaps = 1/238 (0%) Frame = +1 Query: 19 DLVTKKPEMKGPEMYISEVINAEFRESLLARVGLMGTVYLKTLPPKPSNDT-ETESSFKV 195 D + KKPEMKGPEMYISE I EFRESLLARVG+MG +YLKT+PPK S + ETE SF+V Sbjct: 399 DNLVKKPEMKGPEMYISEEIRTEFRESLLARVGVMGVIYLKTMPPKGSGEEKETEFSFRV 458 Query: 196 QNTNGVKRFVMHNSSVSSLGDQMFHVKTAPSDQPIPIMKYSFLPRATPLPLRVRLVKRHS 375 + T VKRF M +S +SSLG+ +FHV+TAPS++PIPI+KYS P+ TPLPLRVR+VKR S Sbjct: 459 EGTTAVKRFAMQSSRISSLGNGLFHVRTAPSEEPIPILKYSLQPKLTPLPLRVRMVKRIS 518 Query: 376 GTLLSVMIQYVSNPDLPAPLTDVTFTLKLPVDPRLLKVSPKAVLNRSERELQWHVDEIPL 555 GTLLS+MIQYVSNPDLP PL +V F LKLPVDP LLKVSPKA+LNR++REL+W + EIPL Sbjct: 519 GTLLSLMIQYVSNPDLPQPLKNVDFILKLPVDPTLLKVSPKAILNRTDRELKWQIPEIPL 578 Query: 556 KGNPVRLRARMPVDTSEDDGGDELEVVGFVKFSYQGTKSXVGDFAASCFRG*TDFYEV 729 G+P RLRARMP+D+ D+ +E +++ +VKFS QG S G + G TDF+EV Sbjct: 579 NGSPGRLRARMPIDS--DNSEEEPDIICYVKFSVQGNTSLSGISLRAAAEGNTDFFEV 634 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,409,274 Number of Sequences: 27288 Number of extensions: 340769 Number of successful extensions: 1079 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1041 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1075 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1286100700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20M17.yg.ab1 (471 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20890.1 expressed protein / ;supported by full-length cD... 168 1e-42 >At2g20890.1 expressed protein / ;supported by full-length cDNA: Ceres:34875. Length = 300 Score = 168 bits (425), Expect = 1e-42 Identities = 84/112 (75%), Positives = 96/112 (85%) Frame = +2 Query: 2 ECEDILKDIAERAGGSGSFSYSRFFAVGLFRFLELANATEPTILEKLCAALNINKKSVDR 181 + E +LKDIA RAG FSYSRFFAVGLFR LELA+AT+PT+L+KLCA+LNINKKSVDR Sbjct: 179 DIEAVLKDIAGRAGSKEGFSYSRFFAVGLFRLLELASATDPTVLDKLCASLNINKKSVDR 238 Query: 182 DLDVYRNLLSKLVQAKELLKEYVEREKKKREERSEPQKANEAVKNFLAENLY 337 DLDVYRNLLSKLVQAKELLKEYVEREKKK+ ER++ QKANE + L + LY Sbjct: 239 DLDVYRNLLSKLVQAKELLKEYVEREKKKQGERAQSQKANETISKCLGDTLY 290 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,651,464 Number of Sequences: 27288 Number of extensions: 196217 Number of successful extensions: 943 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 941 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 587170220 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20O21.yg.ab1 (439 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g44920.1 expressed protein / ; supported by cDNA: gi_13878... 128 1e-30 >At1g44920.1 expressed protein / ; supported by cDNA: gi_13878106_gb_AF370316.1_AF370316 Length = 258 Score = 128 bits (322), Expect = 1e-30 Identities = 59/93 (63%), Positives = 74/93 (79%) Frame = +1 Query: 1 RGLNGKTNAITAAVKSWALGIPLGIIIRATSIGHIPPTRFIAVTMGSTALLLIGWRALLS 180 RG+ GK+ A+ AA KSW +G PLGIIIR+ S GHIP F+ VTMGSTA+LLIGWRALL Sbjct: 166 RGMKGKSKAVVAAAKSWIVGTPLGIIIRSASSGHIPAYSFVLVTMGSTAVLLIGWRALLF 225 Query: 181 NILAEDKNKKNDVYKRGNPFELFELLTSLVRRW 279 ++L + KK+D Y++G+ FELFELLTSL+RRW Sbjct: 226 SVLPTESKKKDDTYRKGSAFELFELLTSLIRRW 258 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,561,007 Number of Sequences: 27288 Number of extensions: 197581 Number of successful extensions: 532 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 498337180 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB20P14.yg.ab1 (712 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g28320.1 unknown protein / ; supported by cDNA: gi_18086452 268 3e-72 >At1g28320.1 unknown protein / ; supported by cDNA: gi_18086452 Length = 709 Score = 268 bits (684), Expect = 3e-72 Identities = 142/262 (54%), Positives = 167/262 (63%), Gaps = 45/262 (17%) Frame = +1 Query: 58 VELAMSSICLITINDGVWASGVLLNNHGLILTNAHLLEPWRFKKT-------------AP 198 +E AM S+CLIT+NDGVWASG++LN HGLILTNAHLLEPWR+ K A Sbjct: 358 IEKAMESVCLITVNDGVWASGIILNEHGLILTNAHLLEPWRYGKGGVYGEGFKPYVLGAE 417 Query: 199 SHKTVSNIFFTPSNDTAAFESKRNHQS--------------------IRVRVDYLERWIW 318 + + F+ + T ++ RNH S IRVR+ +L+ W W Sbjct: 418 EFSSTGSKFWEQKSQTLPRKAPRNHYSSVGENIREYKHNFLQTGHRDIRVRLCHLDSWTW 477 Query: 319 CDASVVYVSKGPLDIAVLQLEFVPDKLVPIVMDFTCPSPGSKVYVTGHGLFGPRCDFLPS 498 C A+VVY+ K LDIA+LQLE+VP KL PI +F+ P G+ +V GHGLFGPRC PS Sbjct: 478 CPANVVYICKEQLDIALLQLEYVPGKLQPITANFSSPPLGTTAHVVGHGLFGPRCGLSPS 537 Query: 499 SCVGVVAKVVKAQ------------GEAPAMIETTAAVHPGGSGGAVLNSDGHMISLVTS 642 C GVVAKVV A+ E PAM+ETTAAVHPGGSGGAVLNS GHMI LVTS Sbjct: 538 ICSGVVAKVVHAKRRLNTQSISQEVAEFPAMLETTAAVHPGGSGGAVLNSSGHMIGLVTS 597 Query: 643 NARHGGGTVIPHLNFSIPCAAL 708 NARHG GTVIPHLNFSIPCA L Sbjct: 598 NARHGAGTVIPHLNFSIPCAVL 619 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,413,626 Number of Sequences: 27288 Number of extensions: 412839 Number of successful extensions: 1315 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1309 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1245572720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB21C14.yg.ab1 (392 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g30540.1 expressed protein / almost identical to hypotheti... 141 3e-42 >At1g30540.1 expressed protein / almost identical to hypothetical protein GB:AAF19757 GI:6634777 from [Arabidopsis thaliana];supported by full-length cDNA: Ceres:103989. Length = 351 Score = 141 bits (356), Expect(2) = 3e-42 Identities = 64/88 (72%), Positives = 76/88 (85%) Frame = +1 Query: 43 LKAMFPNDVKCFIHNDAVAAMASGTMGKLHGCVLIAGTGTIAYGYTEDGREAHASGAGPV 222 ++ MFP+ VK ++ NDA+ A+ASGTMGKLHGCVLIAGTG IAYG+ EDG+EA ASG GP+ Sbjct: 126 IRDMFPSHVKVYVQNDAIVALASGTMGKLHGCVLIAGTGCIAYGFDEDGKEARASGGGPI 185 Query: 223 LRDWGSGYAIAAMALTSVIRAYDGRGPQ 306 L DWGSGY IAA ALT+VIRA+DGRGPQ Sbjct: 186 LGDWGSGYGIAAQALTAVIRAHDGRGPQ 213 Score = 46.2 bits (108), Expect(2) = 3e-42 Identities = 22/29 (75%), Positives = 24/29 (81%) Frame = +2 Query: 305 KTTLTSRILHELELSSPNELIGWTYADPS 391 +T LTS IL L LSSP+ELIGWTYADPS Sbjct: 213 QTMLTSTILKALGLSSPDELIGWTYADPS 241 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,901,737 Number of Sequences: 27288 Number of extensions: 228751 Number of successful extensions: 683 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 683 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 382840584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB21F22.yg.ab1 (274 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59490.1 putative protein / 110 2e-25 >At3g59490.1 putative protein / Length = 281 Score = 110 bits (274), Expect = 2e-25 Identities = 51/90 (56%), Positives = 73/90 (80%) Frame = +2 Query: 2 MRPVIMIDYGGKMPELRDRLCAFLKFSQEESSIFENLRVMVIEDMIYLICVRELAELIKL 181 MRPV+MIDYGGKMPEL++RL + L+ +E +F++L+VMVIEDMIYLI VR L + + Sbjct: 81 MRPVVMIDYGGKMPELQNRLLSLLELIREGLPVFKDLKVMVIEDMIYLINVRSLPKFVSS 140 Query: 182 TINKELELYFVDLEQDPPKMVTEVQQISVG 271 +++ E EL+F+DLEQDPPKMVT+ ++ ++G Sbjct: 141 SLDSEPELFFIDLEQDPPKMVTQSKESNLG 170 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,769,389 Number of Sequences: 27288 Number of extensions: 98472 Number of successful extensions: 305 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 305 length of database: 11,516,596 effective HSP length: 66 effective length of database: 9,715,588 effective search space used: 233174112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB21I12.yg.ab1 (481 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46060.1 hypothetical protein / predicted by genscan; supp... 120 3e-28 >At2g46060.1 hypothetical protein / predicted by genscan; supported by cDNA: gi_18087618 Length = 766 Score = 120 bits (301), Expect = 3e-28 Identities = 57/95 (60%), Positives = 71/95 (74%) Frame = +1 Query: 4 TRSSNIVLVIAIGAAGLLIGFLIEFFRHYRRFSFSAELLLNMLHRWQTVKDWFHNLIKTI 183 TR+SNI++V+AIG+ GLLIGFL+EF YR + SA LNML R + VK+WF NLIKT+ Sbjct: 667 TRASNIIIVLAIGSLGLLIGFLVEFVTKYRSYCGSAGFSLNMLDRPRAVKEWFSNLIKTL 726 Query: 184 VKRFRWFFVVAGFGALAMAAISWNLESTESYWFWH 288 KRFRW FV AG A MAAIS+ +E++ SYW WH Sbjct: 727 KKRFRWGFVAAGLVAFTMAAISFKVETSSSYWMWH 761 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,245,463 Number of Sequences: 27288 Number of extensions: 252640 Number of successful extensions: 712 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 699 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 712 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 614270384 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB21M05.yg.ab1 (606 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g56730.1 zinc protease PQQL-like protein / 80 4e-22 >At5g56730.1 zinc protease PQQL-like protein / Length = 956 Score = 79.7 bits (195), Expect(3) = 4e-22 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 197 MSEIKSAYLERDQVQSISLCEEYLHHFLRKVPVVGIEYEAQLQKTILP 340 MSEI+SAYLERDQVQS SL +EY+ HFL K PV+GIEYEAQLQKT+LP Sbjct: 367 MSEIESAYLERDQVQSTSLRDEYIQHFLHKEPVIGIEYEAQLQKTLLP 414 Score = 37.4 bits (85), Expect(3) = 4e-22 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +3 Query: 135 IARVRLHGFSEREISVARA 191 +ARVRLHGFSEREISV RA Sbjct: 346 VARVRLHGFSEREISVVRA 364 Score = 24.6 bits (52), Expect(3) = 4e-22 Identities = 15/32 (46%), Positives = 19/32 (58%), Gaps = 1/32 (3%) Frame = +1 Query: 1 EPRISCFMEFEAAG-MLLFSQ*RPI**LPLVK 93 E R SCF+E EAAG ++ S P+ L VK Sbjct: 274 ETRFSCFVESEAAGSAVMISYKMPVSDLKTVK 305 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,946,133 Number of Sequences: 27288 Number of extensions: 239315 Number of successful extensions: 589 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 588 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 957813068 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB22K18.yg.ab1 (312 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g15240.1 expressed protein / ;supported by full-length cD... 150 9e-45 >At2g15240.1 expressed protein / ;supported by full-length cDNA: Ceres:120231. Length = 252 Score = 150 bits (380), Expect(2) = 9e-45 Identities = 65/87 (74%), Positives = 80/87 (91%) Frame = +2 Query: 50 FFPLFIVLYVIHFFISPLLVAHGFVPLLLSNLIFMAAASHYHYLNFLGYEVLPFLEKTAF 229 FFP+F++LYV+H+F+SPLL+AHGF+PLLLSNL+FM AS+YHYLNFLGY+VLPFLE+T F Sbjct: 158 FFPMFVLLYVVHYFLSPLLIAHGFIPLLLSNLLFMVGASYYHYLNFLGYDVLPFLERTTF 217 Query: 230 FLYPIVIVIIFTPILILSGFTPSRYLM 310 FLYPI +VI+ +PILILSGF PSRY M Sbjct: 218 FLYPIGVVIVLSPILILSGFNPSRYFM 244 Score = 44.7 bits (104), Expect(2) = 9e-45 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +1 Query: 4 QRVEWLYAFDVHCNSFFPV 60 QRVEWLY FDVHCNSFFP+ Sbjct: 143 QRVEWLYTFDVHCNSFFPM 161 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,356,267 Number of Sequences: 27288 Number of extensions: 148467 Number of successful extensions: 417 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 408 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 11,516,596 effective HSP length: 79 effective length of database: 9,360,844 effective search space used: 224660256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB22O21.yg.ab1 (683 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48020.1 expressed protein / ;supported by full-length cD... 360 e-100 >At5g48020.1 expressed protein / ;supported by full-length cDNA: Ceres:40096. Length = 355 Score = 360 bits (923), Expect = e-100 Identities = 165/226 (73%), Positives = 196/226 (86%) Frame = +2 Query: 5 DLKWRYMWRIGPRPSVTRFQDLNSDHIVPEGFPDWEETMNSWGYKLLSAVEAVAEMAAVG 184 D KWRYMWR+GPRPS TRF++LNS+ +VPEGFP WEE M+SWGYK++SAVE VAEMAA+G Sbjct: 120 DHKWRYMWRVGPRPSNTRFKELNSEPVVPEGFPGWEEVMDSWGYKMISAVEVVAEMAAIG 179 Query: 185 FGLPKDAFTNLMKNGPHLLSPTGGDLGSHGKEGTVFAGYHYDLNFLTIHYRSKFPGLYIW 364 FGLPKDAFT+LMK GPHLL+PTG DL + +EGT+FAGYHYDLNFLTIH RS+FPGLYIW Sbjct: 180 FGLPKDAFTSLMKQGPHLLAPTGSDLNCYNEEGTIFAGYHYDLNFLTIHGRSRFPGLYIW 239 Query: 365 LRNGEKVEVKVPEGCLLIQTGKQLEWVTAGECMAGLHEVVVTKRTIEAIKEAEKANRSLW 544 LRNGEKV VKVP GCLLIQ GKQ+EW+TAGEC+AG+HEVVVT +T +AI A++ NRSLW Sbjct: 240 LRNGEKVAVKVPVGCLLIQAGKQIEWLTAGECIAGMHEVVVTSKTKDAITLAKEQNRSLW 299 Query: 545 RISSTLFSSVASDAVMKPLGHFAKSPHAHEYPPVHAGEYYPKELVV 682 R+SSTLF+ +ASDA +KPLGHFA+S A +YP + AGEY +EL V Sbjct: 300 RVSSTLFAHIASDAELKPLGHFAESSLASKYPAIPAGEYVEQELSV 345 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,386,503 Number of Sequences: 27288 Number of extensions: 375345 Number of successful extensions: 1160 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1159 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1165500188 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB23B20.yg.ab1 (659 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08740.1 Expressed protein / ; supported by cDNA: gi_15912... 118 3e-27 At2g20800.1 putative NADH-ubiquinone oxireductase / 55 4e-08 >At5g08740.1 Expressed protein / ; supported by cDNA: gi_15912292_gb_AY056424.1_ Length = 257 Score = 118 bits (295), Expect = 3e-27 Identities = 56/91 (61%), Positives = 77/91 (84%) Frame = +1 Query: 385 VLSLGAEPKLDIIPGAVEYALPFSTLDDALKVNDKLTKLERENFGKANPIRVVVVGLGYS 564 VL+LGAE KLD++PGA+E A PF TL+DA++VN+KL+KLER+NF + I+V VVG GY+ Sbjct: 27 VLALGAESKLDVVPGAMELAFPFYTLEDAIRVNEKLSKLERKNFKDGSAIKVAVVGCGYA 86 Query: 565 GVELAATVSERLEGKGVVQAISVDSSILPTA 657 GVELAAT+SERL+ +G+VQ+I+V +IL +A Sbjct: 87 GVELAATISERLQDRGIVQSINVSKNILTSA 117 >At2g20800.1 putative NADH-ubiquinone oxireductase / Length = 582 Score = 54.7 bits (130), Expect = 4e-08 Identities = 50/203 (24%), Positives = 89/203 (43%), Gaps = 13/203 (6%) Frame = +1 Query: 31 KRPRVCILGGGFGGLYTALRLESLTWPEDKKPQVILVDQSERFVFKPMLYELLTGEVDAW 210 ++ +V +LG G+ G L++ + V +V F+F P+L + G V+A Sbjct: 62 RKKKVVVLGSGWSGY------SFLSYLNNPNYDVQVVSPRNFFLFTPLLPSVTNGTVEAR 115 Query: 211 EIAPRFSDLLVNTGVQFLKDK-VKVLSPCDHVGINGPNVSGCGGTVQLESGLAIEYDWSV 387 I L+ G ++ + + VK+ + + S GT + + ++YD + Sbjct: 116 SIVEPIRGLMRKKGFEYKEAECVKIDASNKKIHCRSKEGSSLKGTTEFD----MDYDILI 171 Query: 388 LSLGAEPKLDIIPGAVEYALPFSTLDDALKVN------------DKLTKLERENFGKANP 531 L++GA+P PG E+A +DAL + LT+ ER+ Sbjct: 172 LAVGAKPNTFNTPGVEEHAYFLKEAEDALNIRHSVIDCFERASLPNLTEEERKKI----- 226 Query: 532 IRVVVVGLGYSGVELAATVSERL 600 + VVVG G +GVE +A + + L Sbjct: 227 LHFVVVGGGPTGVEFSAELHDFL 249 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.139 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,401,095 Number of Sequences: 27288 Number of extensions: 356351 Number of successful extensions: 1392 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1381 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1106605264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB23C03.yg.ab1 (763 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g21350.1 hypothetical protein / predicted by genemark.hmm 215 2e-56 >At1g21350.1 hypothetical protein / predicted by genemark.hmm Length = 199 Score = 215 bits (547), Expect = 2e-56 Identities = 123/232 (53%), Positives = 143/232 (61%), Gaps = 5/232 (2%) Frame = +2 Query: 35 TMASVTSSAFLLPSVSHNKCWSSALRR-----NPKKLIVRAARTESKGVSLGSRAPHFEL 199 T +V+S F S S ++ S LRR +P++L+VRAARTES GV LG+RAP+FE Sbjct: 22 TALAVSSRRF--SSFSPSRLDFSNLRRRVNAPSPRRLVVRAARTESAGVKLGARAPNFE- 78 Query: 200 EEPLSGNMWKLDDFESYPALLVMFICNHCPFVKHLKKDIVKLTNLYMKKGLGVVAISSNS 379 KGL VVAISSNS Sbjct: 79 ------------------------------------------------KGLAVVAISSNS 90 Query: 380 IVTHPQDGPVFMAEDARTFNYPFPYLYDPSQDVARAYGAVCTPEFYLFKKDGRRPFELVY 559 +VTHPQDGP FMAEDA+ F YPFPYLYD SQ+VAR +GAVCTPEF+L+KKDGRRPFELVY Sbjct: 91 VVTHPQDGPEFMAEDAKVFKYPFPYLYDESQEVAREFGAVCTPEFFLYKKDGRRPFELVY 150 Query: 560 HGQFDDSRPSNNVTVTGRDLSLAIDCVLSGQPVPPNHKPSVGCSI*WHADGK 715 HGQFDDSRPS+N VTGRDLSLAID LS QP+P N KPS+ WH + K Sbjct: 151 HGQFDDSRPSSNSPVTGRDLSLAIDLSLSCQPIPSNQKPSIK----WHPETK 198 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,013,371 Number of Sequences: 27288 Number of extensions: 449356 Number of successful extensions: 1104 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1054 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1104 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1383666960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB23C08.yg.ab1 (736 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g09860.1 expressed protein / ; supported by cDNA: gi_1598... 215 2e-56 >At5g09860.1 expressed protein / ; supported by cDNA: gi_15983383_gb_AF424566.1_AF424566 Length = 599 Score = 215 bits (548), Expect = 2e-56 Identities = 110/185 (59%), Positives = 142/185 (76%), Gaps = 4/185 (2%) Frame = +1 Query: 1 EQNPDALTDPKRVRTPAVREHWKKLADDMDPEAGIGAEYSHKNNRVYCWKGLRFSARQDL 180 +QNP+ALTD +RVRTP + ++WK LA+DMDP AGI EY HKNNRVYCWKGLRF+ARQDL Sbjct: 411 DQNPNALTDSQRVRTPDIADYWKPLAEDMDPSAGIEDEYHHKNNRVYCWKGLRFTARQDL 470 Query: 181 EGFSRFTDHGVEGVVPLELLPPDVRAKYQSKPNDKSKRAKKEETKTVANQAEENQI--AT 354 EGFSRFT+ G+EGVVP+ELLPP+VR+KYQ+KPN+K+KRAKKEETK +++ E NQI + Sbjct: 471 EGFSRFTEMGIEGVVPVELLPPEVRSKYQAKPNEKAKRAKKEETKGGSHETEGNQIGVSN 530 Query: 355 READGEGNRPDIDLSATPMDTADAASISPEEQQK-QTPDTDGGQEPGQIDEPD-PEPGMI 528 EA+ EG R D + T A A + +PEEQQ+ DT+ GQE GQI++ + E G++ Sbjct: 531 SEAEAEGGRGDAE---TMESDAIADTPTPEEQQRLGGSDTENGQEAGQIEDGETEEAGLM 587 Query: 529 DAETD 543 D + D Sbjct: 588 DTDLD 592 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,784,355 Number of Sequences: 27288 Number of extensions: 377955 Number of successful extensions: 1551 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1539 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB23D04.yg.ab1 (701 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g04790.1 hypothetical protein / predicted by genefinder 137 4e-33 >At2g04790.1 hypothetical protein / predicted by genefinder Length = 145 Score = 137 bits (346), Expect = 4e-33 Identities = 73/133 (54%), Positives = 95/133 (70%), Gaps = 1/133 (0%) Frame = +2 Query: 29 GSEVFVAAVPLTAAKGPPQLVMSAAYSLSLSWDLQHFMVLSTLPTLPSQVLVFDFQPQDP 208 G ++VAAVPL AA GPPQL+MS AYSL++S +LQHFMVL P+ P + +P++P Sbjct: 16 GDTIYVAAVPLKAAAGPPQLIMSMAYSLNIS-NLQHFMVLIK-PSSPIRQ-----EPRNP 68 Query: 209 ENVYAALAALSGRKIPGVLLTRKMKKLPNMRCWKVG-SCNVDVEDVIHGFNSSWDTDLIV 385 E++ AA++ LSG IPGV+L R++K +P RCW VG S D ++ FN SW+TDL V Sbjct: 69 ESIEAAISLLSGNLIPGVVLQRRLKNVPRQRCWMVGPSKGNDAMEMAMEFNKSWETDLRV 128 Query: 386 GQHDCRHYTNGLV 424 G HDCRHYTNGLV Sbjct: 129 GFHDCRHYTNGLV 141 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,716,891 Number of Sequences: 27288 Number of extensions: 397163 Number of successful extensions: 1142 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1140 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1218881876 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB23D17.yg.ab1 (709 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56510.1 putative protein / TATA-binding protein-binding p... 253 9e-68 >At3g56510.1 putative protein / TATA-binding protein-binding protein, ABT1 - Mus musculus, EMBL:AB021860 Length = 266 Score = 253 bits (645), Expect = 9e-68 Identities = 128/210 (60%), Positives = 158/210 (74%), Gaps = 9/210 (4%) Frame = +3 Query: 3 PPRMDPLKLRHILSQYGDIERIWLTPE---------DPAALVHRKKAGGFRGQGFTEGWV 155 PP MD ++LRHIL+QYG++ RI+L PE D A VHRK+AGGFRGQ F+EGWV Sbjct: 58 PPHMDHVRLRHILAQYGELGRIYLAPEADTFVYCYSDSEAQVHRKRAGGFRGQRFSEGWV 117 Query: 156 EFTNKNVAKRVASTLNGEQIGGKKKSSFYYDLWNIKYLSKFKWDHLTEEIAYKNATREQK 335 EF K+VAKRVA LNGEQIGGKKKSS YYD+WNIKYL+KFKWD LTEEIAYK+A REQK Sbjct: 118 EFAKKSVAKRVADMLNGEQIGGKKKSSVYYDIWNIKYLTKFKWDDLTEEIAYKSAIREQK 177 Query: 336 LALELSAAKKERDFYLAKVDQSRALSSIDERLKKKRKIQQANGTSEVQGDHQQAAKVIRQ 515 L + LSAAK+E+DFYL+K+++SRA++ ID R++KKRKIQ+ +G S + + I Q Sbjct: 178 LNMVLSAAKREKDFYLSKIEKSRAMTEIDARMEKKRKIQEESG-SNAEAAPVFPPRAIFQ 236 Query: 516 FPQTKPVRDGGEKQKPGLSKDLLAGVFGGS 605 F Q K + + + KPGLS D LA VFGGS Sbjct: 237 FRQKKSIENETSQSKPGLSTDFLASVFGGS 266 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,631,487 Number of Sequences: 27288 Number of extensions: 345763 Number of successful extensions: 1113 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1110 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1236675772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB23J15.yg.ab1 (618 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09180.1 expressed protein / ; supported by full-length cD... 172 1e-51 >At3g09180.1 expressed protein / ; supported by full-length cDNA: Ceres: 119803. Length = 402 Score = 172 bits (435), Expect(2) = 1e-51 Identities = 92/178 (51%), Positives = 121/178 (67%), Gaps = 10/178 (5%) Frame = +1 Query: 4 KKQRGTHTSTQH--EEFSDLKTMSDVLTELEKEIPEVKTSTYQRLEWSKRASLLPNDTFD 177 KK R +H ++ EE D KT+ D+ + LEK +P VK STY RL W KRA+ LP D Sbjct: 175 KKHRASHLLLENGREEPVDYKTLPDIQSRLEKLVPSVKVSTYGRLNWLKRANSLPGSGSD 234 Query: 178 ESPKDHNN-FQSSRNIIS-------DQIGVIELLIPSVFRAVISLYPTGSLLPDAVAFFS 333 + + FQSS + S D+I VIEL PS+FRA++SL P GS+ PDAVAFFS Sbjct: 235 DPTEASKPIFQSSSKLRSGLQTEVVDKIAVIELSFPSLFRAIVSLSPAGSVDPDAVAFFS 294 Query: 334 PDEGGSYVHARGVSAFNVFRNITEHAAMAPQHFIGVNAETALYKLLHWICSYQTLFTK 507 PDEGGSY+HARG S ++V+++ITEHAA A Q+F+G TALY LL WICS++++F+K Sbjct: 295 PDEGGSYLHARGFSVYHVYKHITEHAATALQYFLGFGTGTALYSLLLWICSFESVFSK 352 Score = 48.9 bits (115), Expect(2) = 1e-51 Identities = 20/35 (57%), Positives = 28/35 (79%) Frame = +2 Query: 506 KSCRKCGKLLSMDKESALLLPPVQRAYRNFSVSKN 610 K C KCG+LL+MDK+SAL+LPP+ RAY+ ++ N Sbjct: 352 KPCTKCGRLLAMDKKSALILPPLHRAYQELPLALN 386 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,974,434 Number of Sequences: 27288 Number of extensions: 263807 Number of successful extensions: 781 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 780 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 981665960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB23L02.yg.ab1 (656 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21320.1 hypothetical protein / 218 2e-62 >At4g21320.1 hypothetical protein / Length = 320 Score = 218 bits (554), Expect(2) = 2e-62 Identities = 115/174 (66%), Positives = 132/174 (75%), Gaps = 32/174 (18%) Frame = +2 Query: 74 LRYIRLIKSHGLKAKPQFAVKFNKADIPPTRARAYGAYVVPTPRTSERVEDVDLLIRKAE 253 LRY+RLIK+ GL+AKP FAVKFNK+DIP R RA+G+YVVP PR+SE VED+DLLIRKAE Sbjct: 131 LRYVRLIKNGGLRAKPMFAVKFNKSDIPG-RNRAFGSYVVPEPRSSEFVEDIDLLIRKAE 189 Query: 254 RCLEAGADMIVIDAEDVCKYADSVRADIIAKVIGRLGIEKTMFEASNAKTSEWFIKQYGP 433 RCLEAGAD I+IDA+DVCKYADS+RADIIAKVIGRLGIEKTMFEAS+AK EWFIK+YGP Sbjct: 190 RCLEAGADTIMIDADDVCKYADSLRADIIAKVIGRLGIEKTMFEASDAKLVEWFIKRYGP 249 Query: 434 N--------------------------------VNLFVDHSQVLDLECLRGRNL 499 N VNL+VDHSQ++DLECLRGR+L Sbjct: 250 NVFADTLVLSIIFNLLFEWSPSQDSYLFVLVFQVNLYVDHSQIMDLECLRGRHL 303 Score = 39.3 bits (90), Expect(2) = 2e-62 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = +1 Query: 7 KQLGFDTVELNTGSLELPEETLV 75 KQLGFDT+ELN LE+PEETL+ Sbjct: 109 KQLGFDTIELNANLLEVPEETLL 131 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,047,178 Number of Sequences: 27288 Number of extensions: 294140 Number of successful extensions: 867 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 830 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 865 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1097681028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB24O22.yg.ab1 (681 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26970.1 hypothetical protein / predicted by grail; suppor... 211 3e-55 >At2g26970.1 hypothetical protein / predicted by grail; supported by cDNA: gi_17381149 Length = 222 Score = 211 bits (537), Expect = 3e-55 Identities = 104/174 (59%), Positives = 132/174 (75%) Frame = +3 Query: 159 MDHLSNTFSLLEMDVEDDRIETTSSANDPEKPNGDAKKETDSHKNVLEGDYRLPLVWIDL 338 M+ LSN FS+L ED + ++SS K+E + ++ +GDY+ PLVWIDL Sbjct: 1 MNKLSNAFSVLAFADEDAPMASSSSTG---------KQEESVNGSLEDGDYKQPLVWIDL 51 Query: 339 EMTGLNIEVDRILEIACIITDGKLNKSIEGPDLVIHQPKKCLDEMGEWCTEHHAASGLTE 518 EMTGLN+EVDRILEIACIIT+G L +S+EGPDLV+ Q K CLD+M +WC HH ASGLT+ Sbjct: 52 EMTGLNVEVDRILEIACIITNGDLTQSVEGPDLVVRQTKDCLDKMDDWCQTHHGASGLTK 111 Query: 519 KVIQSTISAKEAEQRAVEFVKKHVGTYTPLLAGNSAYVEFMFLKKYMPELASLF 680 KV+ S I+ +EAEQ+ +EFVKKHVG+ PLLAGNS YV+F+FLKKYMPELA+LF Sbjct: 112 KVLLSAITEREAEQKVIEFVKKHVGSGNPLLAGNSVYVDFLFLKKYMPELAALF 165 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,498,605 Number of Sequences: 27288 Number of extensions: 343943 Number of successful extensions: 1015 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 980 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1015 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1156603240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB25E24.yg.ab1 (747 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g45900.1 ubiquitin activating enzyme E1-like protein / ; ... 182 7e-87 >At5g45900.1 ubiquitin activating enzyme E1-like protein / ; supported by cDNA: gi_14334507_gb_AY034945.1_ Length = 697 Score = 182 bits (461), Expect(2) = 7e-87 Identities = 91/132 (68%), Positives = 108/132 (80%) Frame = +3 Query: 336 FLLTDTRESRWLPTLLCANANKLTITAALGFDSFMVMRHGAGPLSAADESKTEPDSSLSA 515 FLLTDTRESRWLP+LLCANANK+ I AALGFDS+MVMRHGAGP +SLS Sbjct: 472 FLLTDTRESRWLPSLLCANANKIAINAALGFDSYMVMRHGAGP------------TSLSD 519 Query: 516 DVEKMSLSHSDSKPRLGCYFCNDVVAPVDSTTNRTLDQQCTVTRPGLAPIASALAVELFV 695 D++ + ++ ++++ RLGCYFCNDVVAP DS T+RTLDQQCTVTRPGLAPIA ALAVEL V Sbjct: 520 DMQNLDINKTNTQ-RLGCYFCNDVVAPQDSMTDRTLDQQCTVTRPGLAPIAGALAVELLV 578 Query: 696 GILHHPLGISAE 731 G+L HPLGI+A+ Sbjct: 579 GVLQHPLGINAK 590 Score = 156 bits (395), Expect(2) = 7e-87 Identities = 76/108 (70%), Positives = 90/108 (82%), Gaps = 1/108 (0%) Frame = +1 Query: 19 AGTLGCQVARMLMAWGVRKITLVDNGKVAMSNPLRQSLYTFDDSV-KGDKKAVAAAESLR 195 AGTLGCQVAR LM WG+R IT VD GKVAMSNP+RQSLY F+D + +G+ KAVAA +SL+ Sbjct: 365 AGTLGCQVARTLMGWGIRNITFVDYGKVAMSNPVRQSLYNFEDCLGRGEFKAVAAVKSLK 424 Query: 196 KIFPAVEAEGIVMAIPMPGHPVPSKDERGVLDDCTRLRELIESHDAVF 339 +IFPA+E G+VMAIPMPGHP+ S++E VL DC RL ELIESHDAVF Sbjct: 425 QIFPAMETSGVVMAIPMPGHPISSQEEDSVLGDCKRLSELIESHDAVF 472 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,087,831 Number of Sequences: 27288 Number of extensions: 380974 Number of successful extensions: 1218 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1215 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB27E16.yg.ab1 (569 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g12370.1 expressed protein / ; supported by cDNA: gi_14334... 43 4e-11 >At1g12370.1 expressed protein / ; supported by cDNA: gi_14334575_gb_AY034961.1_ Length = 490 Score = 42.7 bits (99), Expect(2) = 4e-11 Identities = 23/60 (38%), Positives = 33/60 (54%) Frame = +1 Query: 238 YVGCMWTIWCLYLHQGMDNRHPCLGRHHTRITPACERKFDVDGYIRICENLITTSPDTRR 417 YVGCMW+I C QG R P G+ C+RKF+VD YI ++L++ + R+ Sbjct: 416 YVGCMWSI-CGVHDQGWKER-PVFGKIRYMNYAGCKRKFNVDSYISYVKSLVSVTKKKRK 473 Score = 41.6 bits (96), Expect(2) = 4e-11 Identities = 19/46 (41%), Positives = 30/46 (64%) Frame = +2 Query: 86 MAHYGKMHAFMRPYCSSYILQWTSSPQQALEYTLLFS*QWIIIDGQ 223 M + GKMH FMR Y + IL+WT P++AL ++ + ++ IDG+ Sbjct: 367 MVYQGKMHGFMRMYWAKKILEWTKGPEEALSISIYLNNKY-EIDGR 411 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,468,400 Number of Sequences: 27288 Number of extensions: 312865 Number of successful extensions: 828 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 826 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 850394780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB27G09.yg.ab1 (731 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56940.1 leucine zipper-containing protein AT103 / ; suppo... 414 e-116 >At3g56940.1 leucine zipper-containing protein AT103 / ; supported by cDNA: gi_1033194_gb_U38232.1_ATU38232 Length = 409 Score = 414 bits (1063), Expect = e-116 Identities = 195/229 (85%), Positives = 208/229 (90%) Frame = +1 Query: 1 FLNKGLSDFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLKANPQY 180 FLNKGLSDFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLK NP++ Sbjct: 181 FLNKGLSDFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLKENPEF 240 Query: 181 QCYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDWKAKLWARFFCLSVYVTMYLNDTQ 360 QCYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDW+AKLW+RFFCLSVYVTMYLND Q Sbjct: 241 QCYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDWQAKLWSRFFCLSVYVTMYLNDCQ 300 Query: 361 RTAFYEGIGLDTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRKLDRMADLNSKIIAIG 540 RT FYEGIGL+TKEFDMHVIIETNRTTARIFPAVLDVENPEFKRKLDRM K++AIG Sbjct: 301 RTNFYEGIGLNTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRKLDRMVVSYEKLLAIG 360 Query: 541 ETDDIPLVKNLKRVPHIAGLVSELLAAYLMKPIESGSVDIAELDPQLGY 687 ETDD +K LKR+P + L SE+LAAYLM P+ESGSVD AE +P L Y Sbjct: 361 ETDDASFIKTLKRIPLVTSLASEILAAYLMPPVESGSVDFAEFEPNLVY 409 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,879,888 Number of Sequences: 27288 Number of extensions: 395229 Number of successful extensions: 1287 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1222 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1283 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1294970360 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB27I07.yg.ab1 (610 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g12590.1 putative protein / predicted protein, Saccaromyce... 319 6e-88 >At4g12590.1 putative protein / predicted protein, Saccaromyces cerevisiae;supported by full-length cDNA: Ceres:33190. Length = 246 Score = 319 bits (818), Expect = 6e-88 Identities = 156/176 (88%), Positives = 169/176 (95%) Frame = +3 Query: 81 MAEELVLDTAIRDWVLIPLSVVMVLIGILRYFVSKLMRTSQLPDSKIIKEGQVIIRARNL 260 MAE+LVLDTAIRDWVLIPLSVVMVLIGILRYFVSKLMR++ PD+K++KEGQV+IRARNL Sbjct: 1 MAEDLVLDTAIRDWVLIPLSVVMVLIGILRYFVSKLMRSTPTPDAKMVKEGQVVIRARNL 60 Query: 261 RAAANFIPVKAFRARKVYYTNEENGLLHVPKGQAQNPQAQMFSDPNMAMDMMKKNLSMII 440 + ANFIP K+FRAR+ Y++NEENGLLHVPKG+AQNPQA MFSDPNMAMDMMKKNLSMII Sbjct: 61 KVGANFIPPKSFRARRFYFSNEENGLLHVPKGEAQNPQAAMFSDPNMAMDMMKKNLSMII 120 Query: 441 PQTLTFAWVNFFFSGFVAAKIPFPLTQRFRSMLQNGIDLSTVDVSYVSSRSWYFLN 608 PQTLTFAWVNFFFSGFVAAKIPFPLTQRFRSMLQNGIDLSTVDVSYVSSRSWYFLN Sbjct: 121 PQTLTFAWVNFFFSGFVAAKIPFPLTQRFRSMLQNGIDLSTVDVSYVSSRSWYFLN 176 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,989,514 Number of Sequences: 27288 Number of extensions: 316944 Number of successful extensions: 879 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 879 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 966764592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB27I24.yg.ab1 (734 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g09830.1 putative phosphoribosylglycinamide synthetase / I... 401 e-112 >At1g09830.1 putative phosphoribosylglycinamide synthetase / Identical to A. thaliana PUR2 (gb|X74766). ESTs gb|ATTS3927,gb|N96446 come from this gene; supported by cDNA: gi_15292772_gb_AY050820.1_ Length = 532 Score = 401 bits (1030), Expect = e-112 Identities = 196/243 (80%), Positives = 220/243 (89%) Frame = +1 Query: 4 FGKAGSSIIVEEFLEGEEASFFAIVDGENALPLESAQDHKRVGDGDTGPNTGGMGAYCLA 183 FG AG ++VEEFLEGEEASFFA+VDGENA+PLESAQDHKRVGDGDTGPNTGGMGAY A Sbjct: 272 FGSAGCQVVVEEFLEGEEASFFALVDGENAIPLESAQDHKRVGDGDTGPNTGGMGAYSPA 331 Query: 184 PVLTQELQSLVMSSIILPTVTGMAKEGCKFVGVLYAGLMIEKKSGLPKLIEYNVRFGDPE 363 PVLT+ELQ VM SII PTV GMA+EGCKFVGVL+AGLMIEKKSGLPKLIE+NVRFGDPE Sbjct: 332 PVLTKELQDFVMESIIHPTVKGMAEEGCKFVGVLFAGLMIEKKSGLPKLIEFNVRFGDPE 391 Query: 364 CQVLMVRLESDLAQVLLAACKGELNTVSLEWAPGSAMVVVMASNGYPGSYVKGTKIQNLE 543 CQVLM+RLESDLA+VLLAACKGEL+ VSL+W+ SAMVVVMASNGYPGSY KG+ I+NLE Sbjct: 392 CQVLMMRLESDLAKVLLAACKGELSGVSLDWSKDSAMVVVMASNGYPGSYEKGSIIKNLE 451 Query: 544 EAEAAAPGVKIFHAGTAVDADGDYVANGGRVLGVTAKGKDLEEARDRAYRAVEEIKWDGG 723 EAE APGVK+FHAGT +D++G+ VA GGRVLGVTAKGKDLEEAR+RAY AV++I W GG Sbjct: 452 EAERVAPGVKVFHAGTGLDSEGNVVATGGRVLGVTAKGKDLEEARERAYSAVQQINWPGG 511 Query: 724 FYR 732 F+R Sbjct: 512 FFR 514 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.315 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,542,249 Number of Sequences: 27288 Number of extensions: 476872 Number of successful extensions: 1219 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1199 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB27K17.yg.ab1 (755 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g25770.1 putative protein / predicted protein, Oryza sativa 180 8e-46 >At5g25770.1 putative protein / predicted protein, Oryza sativa Length = 318 Score = 180 bits (456), Expect = 8e-46 Identities = 80/120 (66%), Positives = 100/120 (82%) Frame = +2 Query: 389 LLNEENLYLTTEEGEQGHLPVLILSMKESTRSKRPATVFLHSTNKCKEWVRPLLEAYASR 568 +L EEN++L TE+ EQG LP+LILS+KE + KRPA VF+H TN KEW+RP LEAYASR Sbjct: 1 MLKEENIHLHTEDSEQGKLPLLILSLKERSEEKRPAIVFMHGTNTNKEWLRPWLEAYASR 60 Query: 569 GYIAVAIDSRYHGERAKNQTTYEDVLVSSWKNGDTMPFIFDTAWDLVKVADYLTARDDIE 748 GY+A+ +DSRYHGERA +T Y D L+SSW+NG+TMPFIFDT WDL+K+A+YLT RDDI+ Sbjct: 61 GYVAIGLDSRYHGERADCKTAYRDALISSWRNGNTMPFIFDTVWDLIKLAEYLTQRDDID 120 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,419,694 Number of Sequences: 27288 Number of extensions: 432052 Number of successful extensions: 1558 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1547 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB27L12.yg.ab1 (747 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06350.1 dehydroquinate dehydratase/shikimate dehydrogenase, ... 199 1e-51 >At3g06350.1 dehydroquinate dehydratase/shikimate dehydrogenase, putative / similar to dehydroquinate dehydratase/shikimate dehydrogenase [Nicotiana tabacum][GI:535771], dehydroquinate dehydratase/shikimate:NADP oxidoreductase [Lycopersicon esculentum][GI:3169883] Length = 603 Score = 199 bits (507), Expect = 1e-51 Identities = 101/186 (54%), Positives = 136/186 (72%) Frame = +1 Query: 1 KLVGYNTDCDACITAIEDALQERQSSKGEVQNGSSPISGRLFVLVGAGGAGRALAFGAKS 180 KL+GYNTDC I+AIED L+ V + SSP++ + V++GAGGAG+ALA+GAK Sbjct: 416 KLLGYNTDCIGSISAIEDGLRS-SGDPSSVPSSSSPLASKTVVVIGAGGAGKALAYGAKE 474 Query: 181 KGARVVIFNRNFERAESLARAVSGEALPIEQLDTYCPQNGMILANCSAIGMEPDVHLTPV 360 KGA+VVI NR +ERA LA A+ G+AL + LD Y P++GM+LAN +++GM+P+V TP+ Sbjct: 475 KGAKVVIANRTYERALELAEAIGGKALSLTDLDNYHPEDGMVLANTTSMGMQPNVEETPI 534 Query: 361 SKENLRSYDLVFDAVYTPRNTRLLQEAAEVGVTVVSGVEMFVRQALGQFKLFTNGLAPED 540 SK+ L+ Y LVFDAVYTPR TRLL+EA E G VSG EMFVRQA QF++FT AP++ Sbjct: 535 SKDALKHYALVFDAVYTPRITRLLREAEESGAITVSGSEMFVRQAYEQFEIFTGLPAPKE 594 Query: 541 FMRKVV 558 +++ Sbjct: 595 LYWQIM 600 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,697,251 Number of Sequences: 27288 Number of extensions: 415830 Number of successful extensions: 1314 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1312 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB28D24.yg.ab1 (732 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g58610.1 ketol-acid reductoisomerase / ; supported by cDN... 456 e-129 >At3g58610.1 ketol-acid reductoisomerase / ; supported by cDNA: gi_13265432_gb_AF324671.2_AF324671 Length = 591 Score = 456 bits (1174), Expect = e-129 Identities = 226/244 (92%), Positives = 234/244 (95%) Frame = +1 Query: 1 INASFAVHQDVDGRATDVALGWSVALGSPFTFATTLEQEYKSDIFGERGILLGAVHGIVE 180 INASFAVHQDVDGRA DVALGWSVALGSPFTFATTLEQEY+SDIFGERGILLGAVHGIVE Sbjct: 267 INASFAVHQDVDGRAADVALGWSVALGSPFTFATTLEQEYRSDIFGERGILLGAVHGIVE 326 Query: 181 SLFRRYTEQGMTEDLAYKNTVECITGVISKTISTKGMKAVYESLSEEGKKDFLIAYSASY 360 SLFRRYTE GM+EDLAYKNTVECITG IS+TIST+GM AVY SLSEEGKKDF AYSAS+ Sbjct: 327 SLFRRYTENGMSEDLAYKNTVECITGTISRTISTQGMLAVYNSLSEEGKKDFETAYSASF 386 Query: 361 YPCMEILYECYEDVASGSEIRSVVLAGRRFYEKEGLPAFPMGKIDQTRMWKVGERVRATR 540 YPCMEILYECYEDV SGSEIRSVVLAGRRFYEKEGLPAFPMG IDQTRMWKVGERVR +R Sbjct: 387 YPCMEILYECYEDVQSGSEIRSVVLAGRRFYEKEGLPAFPMGNIDQTRMWKVGERVRKSR 446 Query: 541 PAGDLGPLYPFTAGVYVALMMAQIEVLRKKGHSYSEIINESLIESVDSLNPFMHARGVSF 720 PAGDLGPLYPFTAGVYVALMMAQIE+LRKKGHSYSEIINES+IESVDSLNPFMHARGVSF Sbjct: 447 PAGDLGPLYPFTAGVYVALMMAQIEILRKKGHSYSEIINESVIESVDSLNPFMHARGVSF 506 Query: 721 MVDN 732 MVDN Sbjct: 507 MVDN 510 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,117,685 Number of Sequences: 27288 Number of extensions: 389454 Number of successful extensions: 961 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 961 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1294970360 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB28F06.yg.ab1 (723 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g41020.1 unknown protein / 125 2e-29 At2g41030.1 unknown protein / 83 7e-22 At3g19840.1 hypothetical protein / predicted by genemark 47 8e-06 >At2g41020.1 unknown protein / Length = 325 Score = 125 bits (314), Expect = 2e-29 Identities = 55/116 (47%), Positives = 72/116 (61%) Frame = +2 Query: 8 FYYNEKSGISQWEKPVGPSMNSQPQSSSALLEDWQEVLDETSGCKYYYNSKTNVSQWEHP 187 +YYN+ +G QWE+PV S + E+W E DE SG KY+YN++T+VSQWE P Sbjct: 210 YYYNQHTGTCQWERPVELSYATSSAPPVLSKEEWIETFDEASGHKYFYNTRTHVSQWEPP 269 Query: 188 GSSQKSASGQQANVDSRDVSNPKSSDHSLELKKCSGCGGWGLDLVQSWGYCCHCTR 355 S QK A+ N ++ +N K +L +CSGCGGWG+ LVQ WGYC HCTR Sbjct: 270 ASLQKPAATNSNNAVTQSTANGKGEHPPSQLPRCSGCGGWGVGLVQRWGYCVHCTR 325 >At2g41030.1 unknown protein / Length = 132 Score = 82.8 bits (203), Expect(2) = 7e-22 Identities = 37/39 (94%), Positives = 38/39 (96%) Frame = +3 Query: 480 RKRAHTEDDELDPMDPSSYSDAPRGGWVVGLKGVQPRAA 596 +KRAH EDDELDPMDPSSYSDAPRGGWVVGLKGVQPRAA Sbjct: 7 KKRAHAEDDELDPMDPSSYSDAPRGGWVVGLKGVQPRAA 45 Score = 38.5 bits (88), Expect(2) = 7e-22 Identities = 16/24 (66%), Positives = 19/24 (78%) Frame = +2 Query: 623 FNHGPYPSPGAVLRENAEIASQRR 694 F PYPSPGAVLR NAE+AS ++ Sbjct: 85 FQQRPYPSPGAVLRRNAEVASSQK 108 >At3g19840.1 hypothetical protein / predicted by genemark Length = 830 Score = 47.4 bits (111), Expect = 8e-06 Identities = 37/112 (33%), Positives = 51/112 (45%), Gaps = 13/112 (11%) Frame = +2 Query: 5 VFYYNEKSGISQWEKPVG-----PSMNSQPQSSSALL-EDWQEVLDETSGCKYYYNSKTN 166 ++YYN +G S +EKP G + QP S L DW ++ G KYYYN+KT Sbjct: 256 LYYYNSVTGQSTYEKPPGFGGEPDKVPVQPIPVSILPGTDWA-LVSTNDGKKYYYNNKTK 314 Query: 167 VSQWEHPG-------SSQKSASGQQANVDSRDVSNPKSSDHSLELKKCSGCG 301 VS W+ P ++ A A+V S D++ S SL S G Sbjct: 315 VSSWQIPAEVKDFGKKLEERAMESVASVPSADLTEKGSDLTSLSAPAISNGG 366 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,857,445 Number of Sequences: 27288 Number of extensions: 420652 Number of successful extensions: 1413 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 1325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1406 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1268361380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB28H24.yg.ab1 (724 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60990.1 hypothetical protein / predicted by genscan+, sim... 330 6e-91 At1g11860.1 aminomethyltransferase-like precursor protein / v... 47 8e-06 >At1g60990.1 hypothetical protein / predicted by genscan+, similar to aminomethyltransferase GB:CAA20175 from [Streptomyces coelicolor A3(2)] Length = 436 Score = 330 bits (845), Expect = 6e-91 Identities = 168/251 (66%), Positives = 195/251 (76%), Gaps = 13/251 (5%) Frame = +1 Query: 4 KVSEDWVIETFNNDEEALDAVDSGTVVVDLSHYGRIRVSGEDRIKFLHNQSTANFEALSE 183 KVSED V+E+F+ND+EALDA D+G VVVDLSH+GRIRVSG+DR FLHNQ+TANFE+L E Sbjct: 80 KVSEDGVVESFDNDDEALDAFDNGVVVVDLSHFGRIRVSGDDRAHFLHNQTTANFESLYE 139 Query: 184 GGGCDTVFVTPTARTIDLAQAWIMKTAVTLVVSPATSKSISEMLNKYIFFGDNVEIQDIS 363 G GCDTVFVTPTARTID+A AWIMK A+ L VSP T +SI EMLNKYIFF D VEI+DI+ Sbjct: 140 GQGCDTVFVTPTARTIDIAHAWIMKNAILLTVSPTTCQSIIEMLNKYIFFADKVEIKDIT 199 Query: 364 DKTCLFALAGPKSN-------------QVMMDLNLGDLIGQPYGSHKRYNAYMQVGGNPV 504 +TCLFALAGPKSN Q+M LNLGDLIGQPYG H+ Y+ G P+ Sbjct: 200 KQTCLFALAGPKSNQLHYSYATVKNMKQIMSKLNLGDLIGQPYGRHQHYS----FDGMPI 255 Query: 505 TVAVGSVISEEGFSLLMSPSAAGLIWKTILSHGATPMGSNALEIYRIRQGRPAPGSELTD 684 TV VGS+IS+EGF++LMSP A +WKT+L+ GA PMGS A E RI QGRPAP EL+ Sbjct: 256 TVGVGSLISDEGFTMLMSPGGAVSVWKTLLAEGAIPMGSVAWEKLRITQGRPAPERELSK 315 Query: 685 EFNVLEAGLWN 717 EFNVLEAGLWN Sbjct: 316 EFNVLEAGLWN 326 >At1g11860.1 aminomethyltransferase-like precursor protein / very strong similarity to aminomethyltransferase precursor gb|U79769 from Mesembryanthemum crystallinum. ESTs gb|T43167, gb|T21076, gb|H36999, gb|T22773, gb|N38038, gb|T13742, gb|Z26545, gb|T20753 and gb|W43123 come from this gene Length = 408 Score = 47.4 bits (111), Expect = 8e-06 Identities = 55/218 (25%), Positives = 91/218 (41%), Gaps = 10/218 (4%) Frame = +1 Query: 88 DLSHYGRIRVSGEDRIKFLHNQSTANFEALSEGGGCDTVFVTPTARTIDLAQAWIMKTA- 264 D++H + + G+D + FL A+ L+ G G TVF ID + I K Sbjct: 83 DVAHMCGLSLKGKDCVPFLETLVVADVAGLAPGTGSLTVFTNEKGGAID--DSVITKVTD 140 Query: 265 --VTLVVSPATSKS----ISEMLNKYIFFGDNVEIQDISDKTCLFALAGPKSNQVMMDLN 426 + LVV+ I E + + G +V I D+ L AL GP + V+ L Sbjct: 141 EHIYLVVNAGCRDKDLAHIEEHMKAFKSKGGDVS-WHIHDERSLLALQGPLAAPVLQHLT 199 Query: 427 LGDLIGQPYGSHKRYNAYMQVGGNPVTVAVGSVISEEGFSLLMSPSAAGLIWKTIL--SH 600 DL +G+ + + + G+ + E+GF + + A + K IL S Sbjct: 200 KEDLSKLYFGNFQ----ILDINGSTCFLTRTGYTGEDGFEISVPDEHAVDLAKAILEKSE 255 Query: 601 GATPM-GSNALEIYRIRQGRPAPGSELTDEFNVLEAGL 711 G + G A + R+ G G+++ + +EAGL Sbjct: 256 GKVRLTGLGARDSLRLEAGLCLYGNDMEQHISPVEAGL 293 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.133 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,467,130 Number of Sequences: 27288 Number of extensions: 369280 Number of successful extensions: 1062 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1056 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1268361380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB28I02.yg.ab1 (449 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62010.1 putative protein / paladin - Mus musculus, EMBL:M... 67 5e-12 >At3g62010.1 putative protein / paladin - Mus musculus, EMBL:MMPAL Length = 1232 Score = 66.6 bits (161), Expect = 5e-12 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = -2 Query: 373 VIQRCAGAGHLRDDILFYSKELEKFEGNDDEHKAYIMDMGIKALR 239 +++ CAGAGHLR+DI++YSKEL K DE+++YIMDMG+KALR Sbjct: 1167 IVELCAGAGHLREDIVYYSKELNKLPITKDENRSYIMDMGVKALR 1211 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,472,306 Number of Sequences: 27288 Number of extensions: 193974 Number of successful extensions: 486 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 485 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 534579884 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB28K23.yg.ab1 (761 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61450.1 putative protein / ATP GTP nucleotide-binding pro... 307 5e-84 >At5g61450.1 putative protein / ATP GTP nucleotide-binding protein, Leishmania infantum, EMBL:LIIMNBA; supported by cDNA: gi_14423543_gb_AF387009.1_AF387009 Length = 447 Score = 307 bits (786), Expect = 5e-84 Identities = 160/254 (62%), Positives = 192/254 (74%), Gaps = 1/254 (0%) Frame = +3 Query: 3 YGQEYINRYKMMTRFHHQRVPLVILVCGTACVGKSTIATQLAQRLNLPNVLQTDMVYELL 182 YG+EYINRY MMT+FHHQRVPLVILVCGTACVGKSTIATQLAQRLNLPNVLQTDMVYELL Sbjct: 127 YGEEYINRYNMMTKFHHQRVPLVILVCGTACVGKSTIATQLAQRLNLPNVLQTDMVYELL 186 Query: 183 RTSTDAPLTSSPIWARDFSSSEELITEFCRECRIVRKGLAGDLKKAMKDGKPIIIEGMHV 362 RT+TDAPLTS+P+W R+F SSEELITEFCRECRIVRKGL GDLKKAMKDGKPIIIEG H+ Sbjct: 187 RTATDAPLTSTPVWTREFGSSEELITEFCRECRIVRKGLGGDLKKAMKDGKPIIIEGRHL 246 Query: 363 DPSIYLMDEENKSPHNVPANPQESKADENDMTNVEN-NASTIGAQSEDIHPNAENAKTEA 539 DPSIYLM++ENK+P N P D+T+ +N AS+ + D ++ EA Sbjct: 247 DPSIYLMNDENKTPSNDPEKSSSETNSSKDLTSDKNPEASSSNTKETDNSAVKPHSHEEA 306 Query: 540 ISTQELDKISDDLKSVHIVDHAAGSQNDTTKDQVADKKPTLXREKSGVTEPVIIPIVLKM 719 +++ E + +S+ + I A S++ K + AD + KSG EP++I IVLKM Sbjct: 307 VASVEANNLSEKVTQCTI--DAESSKDAEKKSKSADGS---GKTKSG-PEPIVISIVLKM 360 Query: 720 ADFDHKALLEEWIS 761 ++FDHKALLEEWIS Sbjct: 361 SEFDHKALLEEWIS 374 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,326,142 Number of Sequences: 27288 Number of extensions: 388839 Number of successful extensions: 1335 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1332 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1383666960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB29A20.yg.ab1 (559 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56900.1 putative protein / unnamed ORF - Homo sapiens, EM... 228 2e-60 >At3g56900.1 putative protein / unnamed ORF - Homo sapiens, EMBL:AK000833 Length = 440 Score = 228 bits (581), Expect = 2e-60 Identities = 103/148 (69%), Positives = 126/148 (84%) Frame = +2 Query: 14 GRCTGAAWDPDGRMILVAFSESLTLGSIHFATKPPSLDAHLLPVELPELNSLTNSGGIDK 193 G TGA WDP+GR IL++FS+S TLGS+HF++KPPSLDAHLLPVELPE+ SLT GI+K Sbjct: 291 GSVTGAIWDPEGRFILISFSKSSTLGSVHFSSKPPSLDAHLLPVELPEIASLTGCEGIEK 350 Query: 194 MAWDASGERLAVSYKDGNELYNGLIAIYDVKRATLITPSFIGFIRGPGDDIKPLTFSFHD 373 +AWDASGERLAVSYK G+E Y GLIAIYD +R +++ S +GFIRGPG++ K L+FSFHD Sbjct: 351 IAWDASGERLAVSYKGGDENYKGLIAIYDTRRTPIVSASLVGFIRGPGENPKALSFSFHD 410 Query: 374 KYKQGPLLSVCWSSGICITYPLVIRSHL 457 K+KQGPLLSVCWS+G C TYPL+ RSH+ Sbjct: 411 KFKQGPLLSVCWSTGFCCTYPLIFRSHV 438 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,651,937 Number of Sequences: 27288 Number of extensions: 269864 Number of successful extensions: 694 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 671 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 694 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 826050704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB29B16.yg.ab1 (707 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g17690.1 expressed protein / ; supported by cDNA: gi_15810... 245 2e-65 >At1g17690.1 expressed protein / ; supported by cDNA: gi_15810522_gb_AY056300.1_ Length = 754 Score = 245 bits (625), Expect = 2e-65 Identities = 125/220 (56%), Positives = 154/220 (69%), Gaps = 9/220 (4%) Frame = +1 Query: 73 DGDDDDDDDGEEEVAGN------KSEGSSSFSAHLDYELSKEEIENLPTKKMKYKHRLEA 234 D DD + D+ E++ N S S+FS HL ++LS EE+E LP K K+K A Sbjct: 151 DPDDYETDEEVHELSTNGQSFVDASSSISAFSEHLSHKLSSEEVETLPKGKWKFKWESPA 210 Query: 235 ---ANCKWAATRELNLEDSYSKSPYGLNMKLYDHWLNSYTASGGQDLHSSRQRSFFSLCN 405 NCKW T E L+ S +PYGL KLY+HWL Y GG+DL SS++R FFS+CN Sbjct: 211 FDMPNCKWKGTSENFLDGIQSDAPYGLKPKLYNHWLQLYKKCGGKDLDSSKRRKFFSICN 270 Query: 406 SYRDILHHNKKPFYLKGREEDSNIMDAYLLHSLNHIFKTRDLVTKNDKTMAKQKESKGEE 585 SY DILH NKKPFY G +EDS+ MDAYL+HSLNHIFKTRDLV KN+ +AK +E+ EE Sbjct: 271 SYLDILHSNKKPFYHCGSDEDSSAMDAYLMHSLNHIFKTRDLVKKNESKIAKHRETSEEE 330 Query: 586 VLNSEKFVDQGFTRPKVLIILPYRSIAFRVINRLIQLTPE 705 +L+ + F+DQGFTRPKVLI+LP RSIAFRV+ RLIQLTPE Sbjct: 331 ILSDDGFLDQGFTRPKVLILLPLRSIAFRVVKRLIQLTPE 370 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,072,747 Number of Sequences: 27288 Number of extensions: 368611 Number of successful extensions: 4938 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3855 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1236675772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB29E04.yg.ab1 (591 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g07020.1 expressed protein / ; supported by full-length c... 191 2e-49 >At5g07020.1 expressed protein / ; supported by full-length cDNA: Ceres: 17482. Length = 235 Score = 191 bits (485), Expect = 2e-49 Identities = 110/186 (59%), Positives = 131/186 (70%), Gaps = 4/186 (2%) Frame = +2 Query: 14 VAGEKTKVAGTFPPRR-RDWSGYVEKDTAGQTNIYSVEPAVYVAESAISSGTSGTSADGA 190 +AGEKTKV GTFPPR+ R W+GYVEKDTAGQTN+YS+EPAVYVAESAISSGT+G+SADGA Sbjct: 65 LAGEKTKVVGTFPPRKPRGWTGYVEKDTAGQTNVYSIEPAVYVAESAISSGTAGSSADGA 124 Query: 191 ENTAGLVGFGALIAIAAASAILLQVGKN-PPQIQTLDYSGPSLSYYITKFKPAEIVQISV 367 ENTA +V ALIA+AAAS+ILLQVGK+ P + + +DYSGPSLSYYI KFKP+EIVQ Sbjct: 125 ENTAAIVAGIALIAVAAASSILLQVGKDAPTRPKAVDYSGPSLSYYINKFKPSEIVQ--- 181 Query: 368 PTAPEPETSTPQVESVAPAAEVDSGAP--AAAVDSGASETETSSSAGQPESGTQVVSEVV 541 STP V P AE+++ P + S ET +S QPE+ S V Sbjct: 182 -------PSTPSVTEAPPVAELETSLPETPSVAQQETSLPETMASEAQPEA-----SSVP 229 Query: 542 VESETS 559 S TS Sbjct: 230 TTSSTS 235 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,974,447 Number of Sequences: 27288 Number of extensions: 313146 Number of successful extensions: 1503 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1343 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1483 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 913055448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB29N04.yg.ab1 (579 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22435.1 Expressed protein / ; supported by cDNA: gi_15081... 133 7e-32 At3g22430.1 hypothetical protein / predicted by genmark 52 2e-07 >At3g22435.1 Expressed protein / ; supported by cDNA: gi_15081712_gb_AY048249.1_ Length = 208 Score = 133 bits (334), Expect = 7e-32 Identities = 62/97 (63%), Positives = 74/97 (75%) Frame = +3 Query: 288 MHTYNPETSTSDQVPNHLGLHKALCILMGWNYLMPPDNSKVYQRLSADEIAANLDDLIMW 467 MHTY + S+S +HLGLHKALC+LMGWN+ PDNSK YQ L ADE A N LI+W Sbjct: 1 MHTYCSDDSSSRV--HHLGLHKALCVLMGWNFSKAPDNSKAYQNLPADEAAINQAQLIIW 58 Query: 468 PPHVIIRNTSTGKGKDGRMEGLGNXAMDMKLRDLGFT 578 PPHVI++NTSTGKGK+GRMEG GN MD ++R+LG T Sbjct: 59 PPHVIVQNTSTGKGKEGRMEGFGNKTMDNRIRELGLT 95 >At3g22430.1 hypothetical protein / predicted by genmark Length = 342 Score = 52.0 bits (123), Expect = 2e-07 Identities = 22/44 (50%), Positives = 31/44 (70%) Frame = +3 Query: 120 EVDQEKVKSSFLNFVRAITENANQKNKYLADGKQGALQCLACGR 251 +VDQ +K SFL FV+ + E+ +K YL +G++G LQCL CGR Sbjct: 247 QVDQVALKKSFLGFVKRVFEDPMEKKNYLENGRKGRLQCLVCGR 290 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,002,291 Number of Sequences: 27288 Number of extensions: 295950 Number of successful extensions: 884 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 864 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 884 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 877249352 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB29P09.yg.ab1 (631 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05320.1 unknown protein / 282 1e-76 >At3g05320.1 unknown protein / Length = 445 Score = 282 bits (721), Expect = 1e-76 Identities = 138/211 (65%), Positives = 169/211 (79%), Gaps = 7/211 (3%) Frame = -3 Query: 620 KDAFARAC*PARMXNRSLLMPSLSASLFYKEIDQLEPISFDKVFNFERFNSLCDGFVRVS 441 K AFARAC ARM NR+LLMPSLSASLFYKE+D+L PI FDKVF FERFNSLC GFVR+S Sbjct: 83 KIAFARACLTARMMNRTLLMPSLSASLFYKEVDKLRPIPFDKVFQFERFNSLCSGFVRLS 142 Query: 440 RYSDVGNRSNVIEVQKGSGRRWTLERDLDQLKEFSKRD-YDAYETIRVVGKNPFLWHDHW 264 R+SDV NR+ V +++KGSGRRWT+ERDL+ LK+ ++ + D +E IR++GKNPFLWHDHW Sbjct: 143 RFSDVKNRAQVFDLEKGSGRRWTVERDLEHLKQSARNESIDEFEVIRLIGKNPFLWHDHW 202 Query: 263 PVSDYAKVFECLVLVDEISKEANEVVAKIREFGSEVKNASSSCQT------PYVAIHMRI 102 PV DYAKVFEC+V+VDEIS+EA++VV KIRE G E + A + +T P+VA+HMRI Sbjct: 203 PVEDYAKVFECMVVVDEISREADKVVMKIREAG-EAERAKLASKTEILGPVPFVAVHMRI 261 Query: 101 EKDWMIHCKNRERRSNLTNICSSKEEITTRV 9 E DWMIHCK E+R ++ ICSSK EI RV Sbjct: 262 EIDWMIHCKKLEQRKKISEICSSKREILDRV 292 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,585,652 Number of Sequences: 27288 Number of extensions: 263486 Number of successful extensions: 870 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1017362904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB29P21.yg.ab1 (607 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66840.1 unknown protein / 88 4e-18 >At5g66840.1 unknown protein / Length = 551 Score = 87.8 bits (216), Expect = 4e-18 Identities = 74/217 (34%), Positives = 108/217 (49%), Gaps = 17/217 (7%) Frame = +1 Query: 1 RIVNESY-SASTEHTFSVEVLWSKWFKKLDPLSILLVKGRNLYQFGTFRQAWESEAERSE 177 ++V ESY +A +HTF++EVLW + +KL PL LLVKGRNLY+ T RQ W +E +R + Sbjct: 182 QVVKESYGTAKQQHTFTIEVLWCEGTQKLPPLYPLLVKGRNLYRLMTLRQRWPNEEDRVK 241 Query: 178 VLKEKHERGKEAR---RKRKWKETEFDVGDNKGKKRHKVSH--KVSSHSKHKHAN----- 327 VL EKH RG AR R+RK K + + + D + +K V +V + K N Sbjct: 242 VLNEKHNRGAAARKVMRERKIK-SGYVLKDGRLQKPGHVKKPCQVKTRKNEKDENLTQRL 300 Query: 328 -KNTKAHYQDVLLQSLDLKRS-----TQLTYHSDPNCSMYSDHHLQEASVPLTYDTTLQL 489 +NT A++ V + + + TQLT +P S H + P TY Sbjct: 301 RQNTPANHSLVAFPNQNPSQGHKNHPTQLT-DMNPANFYTSRPHAPRSHAPPTYAPR--- 356 Query: 490 NDLPPGSSVGHSHLNNEQPGPNQGLSQPPDHHHHDSE 600 P + ++ +N+ P PN PP H + SE Sbjct: 357 ----PHAPRSYAPINSHLPRPN----IPPYHSYTYSE 385 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.311 0.127 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,334,343 Number of Sequences: 27288 Number of extensions: 298683 Number of successful extensions: 1089 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 991 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1073 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 957813068 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB2e06.yg.ab1 (735 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55960.1 putative protein / similar to unknown protein (pi... 285 2e-77 >At5g55960.1 putative protein / similar to unknown protein (pir||T23656); supported by cDNA: gi_16648986_gb_AY059863.1_ Length = 648 Score = 285 bits (728), Expect = 2e-77 Identities = 143/186 (76%), Positives = 163/186 (86%) Frame = +2 Query: 2 VFIWVLYSLITSGSGGVTEQVMCMLPISRSARARCVDVLDKAISGVLLATVEIAFFQGCL 181 +FIWVLY LITS SGGVTEQVM MLPI+ SAR RCV+VLD AISGVLLAT EIAFFQGCL Sbjct: 461 IFIWVLYILITSESGGVTEQVMNMLPINASARNRCVEVLDLAISGVLLATAEIAFFQGCL 520 Query: 182 TWLLFRLFDIHFLYMSTGLAIISPFFPIIPYFISTIPVAVELVLEGQYVVAVCLSIIHFV 361 TWLLFRL++IHFLYMST LA IS PI PY+ +TIP A++LVLEG+Y+VAV LS+ H V Sbjct: 521 TWLLFRLYNIHFLYMSTVLAFISALLPIFPYWFATIPAALQLVLEGRYIVAVILSVTHLV 580 Query: 362 LIEYGTTEIQEDIPGNSAYLTGLSIIGGVALFPSAVEGAIMGPLITTVVIALKNLYVEFV 541 L+EYG +EIQ+DIPG++AYLTGLSIIGGV LFPSA+EGAIMGPLITTVVIALK+LY EFV Sbjct: 581 LMEYGASEIQDDIPGSNAYLTGLSIIGGVTLFPSALEGAIMGPLITTVVIALKDLYAEFV 640 Query: 542 LDEQDK 559 L+E K Sbjct: 641 LNEPKK 646 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,242,389 Number of Sequences: 27288 Number of extensions: 361155 Number of successful extensions: 975 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 947 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 975 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB2e11.yg.ab1 (799 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20420.1 succinyl-CoA ligase beta subunit / ;supported by... 459 e-130 >At2g20420.1 succinyl-CoA ligase beta subunit / ;supported by full-length cDNA: Ceres:36904. Length = 421 Score = 459 bits (1182), Expect = e-130 Identities = 229/261 (87%), Positives = 247/261 (93%) Frame = +2 Query: 17 VAGKMLGQTLVTKQTGPQGKVVSKVYLCEKVSLVNEMYFAITLDRTTAGPLIIACREGGT 196 +AGKMLGQ LVTKQTGPQGKVVSKVYLCEK+SLVNEMYF+I LDR +AGPLIIAC++GGT Sbjct: 106 IAGKMLGQVLVTKQTGPQGKVVSKVYLCEKLSLVNEMYFSIILDRKSAGPLIIACKKGGT 165 Query: 197 SIEDLAEKYPDMIIKVPIDVFKGITDEDAAKVVEGLAPKVADKQASIEQVKKLYNLFRES 376 SIEDLAEK+PDMIIKVPIDVF GITDEDAAKVV+GLAPK AD++ SIEQVKKLY LFR++ Sbjct: 166 SIEDLAEKFPDMIIKVPIDVFAGITDEDAAKVVDGLAPKAADRKDSIEQVKKLYELFRKT 225 Query: 377 DCTQLEINPIAETSDNKLIAADAKLNFDDNAAYRQKEIFALRDPTQEDPREVAAAKADLN 556 DCT LEINP+AETS N+L+AADAKLNFDDNAA+RQKE+FA+RDPTQEDPREVAAAK DLN Sbjct: 226 DCTMLEINPLAETSTNQLVAADAKLNFDDNAAFRQKEVFAMRDPTQEDPREVAAAKVDLN 285 Query: 557 YIGLDGEIGCMVNGAGLAMATMDIIKLHGGTPANFLDVGGNASEGQVVEAFKILTSDDKV 736 YIGLDGEIGCMVNGAGLAMATMDIIKLHGGTPANFLDVGGNASE QVVEAFKILTSDDKV Sbjct: 286 YIGLDGEIGCMVNGAGLAMATMDIIKLHGGTPANFLDVGGNASEHQVVEAFKILTSDDKV 345 Query: 737 KANFVNIFGWIMKCDVIASGI 799 KA VNIFG IMKCDVIASGI Sbjct: 346 KAILVNIFGGIMKCDVIASGI 366 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,038,038 Number of Sequences: 27288 Number of extensions: 428377 Number of successful extensions: 1290 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1287 length of database: 11,516,596 effective HSP length: 98 effective length of database: 8,842,372 effective search space used: 1476676124 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB30A07.yg.ab1 (739 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67630.1 putative DNA polymerase alpha subunit / similar t... 281 1e-78 >At1g67630.1 putative DNA polymerase alpha subunit / similar to DNA polymerase alpha 70 KD subunit (DNA polymerase subunit B) GB:P33611 [Mus musculus] Length = 620 Score = 281 bits (718), Expect(2) = 1e-78 Identities = 138/227 (60%), Positives = 185/227 (80%), Gaps = 2/227 (0%) Frame = +3 Query: 3 CRYMYDRIEDKFSYLEDRIMKYSEALVASQLYDELVDPSVASQKTIFSVGMICCEEEGRL 182 CR+MYDR ED+FS LE RI+++++A AS LY+E VDP+VASQ++IF+VGMICC+ EG L Sbjct: 207 CRFMYDRTEDRFSALEYRIVRHADAFAASGLYEEQVDPAVASQRSIFAVGMICCDGEGHL 266 Query: 183 KEKPIMLQSSVEHSGGQRVRLELQKLEQFSIFPGQVVGVEGHNPSGHCLIATKIVDYVPL 362 +K I+LQSS E + GQRV ++L++L+QFSIFPGQVVG+EG NPSGH L A+K++D VPL Sbjct: 267 NDKSILLQSSAERTSGQRVPVDLKRLDQFSIFPGQVVGIEGQNPSGHYLTASKLLDSVPL 326 Query: 363 SVPDDT-FRETKRQAVDQDNQL-VDPSDVSSDLSLIIASGPFTTTDNLFFEPLSDLLTYA 536 ++ D KRQ +DQ+ + + S S++S IIASGPFTT+DNL FEPL++LL YA Sbjct: 327 TLTVDVDLPPAKRQILDQEVLVPAEESCQKSEVSFIIASGPFTTSDNLLFEPLNELLAYA 386 Query: 537 RRKQPQLLVLLGPFIDSEHPEIKKGALNKTYDELFRLDVLXRLQDYV 677 +RK PQLLVLLGPF+DSEHPEIKKGA++ T++E+F+++VL +LQDYV Sbjct: 387 KRKPPQLLVLLGPFVDSEHPEIKKGAVDATFNEIFQVEVLRKLQDYV 433 Score = 30.4 bits (67), Expect(2) = 1e-78 Identities = 12/17 (70%), Positives = 15/17 (87%) Frame = +2 Query: 689 GSAARVILVPSVRDAHH 739 GS RV+LVPS+RDA+H Sbjct: 437 GSEVRVVLVPSIRDANH 453 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,696,518 Number of Sequences: 27288 Number of extensions: 371382 Number of successful extensions: 1113 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1084 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1112 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1312709680 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB30C12.yg.ab1 (546 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g15380.1 expressed protein / ; supported by cDNA: gi_15028... 67 6e-12 >At3g15380.1 expressed protein / ; supported by cDNA: gi_15028188_gb_AY045917.1_ Length = 700 Score = 67.0 bits (162), Expect = 6e-12 Identities = 28/39 (71%), Positives = 35/39 (88%) Frame = +2 Query: 203 MSLASALFAFLMLDTHKYKSSHNKITSPLFPVLACWGLG 319 +SL SALF FLMLD+H+Y++SHNK++SPL PVLACW LG Sbjct: 605 VSLFSALFGFLMLDSHRYRASHNKVSSPLLPVLACWALG 643 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,351,447 Number of Sequences: 27288 Number of extensions: 275572 Number of successful extensions: 656 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 656 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 790135456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB30F19.yg.ab1 (598 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g02560.1 unknown protein / ; supported by cDNA: gi_20466781 325 8e-90 >At2g02560.1 unknown protein / ; supported by cDNA: gi_20466781 Length = 1219 Score = 325 bits (834), Expect = 8e-90 Identities = 162/193 (83%), Positives = 177/193 (90%) Frame = +1 Query: 1 CLGKIALIKPSKLVPALKERTTSPAAFTRATVAVAVKYSIVERPEKIDSVLYPEISSFLM 180 CLGK+ALI+P KLVPAL+ RTTSPAAFTRATV AVKYS+VERPEK+D +++P+ISSFLM Sbjct: 954 CLGKMALIEPEKLVPALQVRTTSPAAFTRATVVTAVKYSVVERPEKLDEIIFPQISSFLM 1013 Query: 181 LIKDQDRHVRRAAVLALSTAGHNKPNLIKGLLPELLPLLYDQTVIKKELIRTVDLGPFKH 360 LIKD DRHVRRAAV ALST H KPNLIKGLLPELLPLLYDQTVIKKELIRTVDLGPFKH Sbjct: 1014 LIKDGDRHVRRAAVSALSTFAHYKPNLIKGLLPELLPLLYDQTVIKKELIRTVDLGPFKH 1073 Query: 361 TVDDGLELRKAAFECVDTLLDNCLDQLNPSSFIVPYLKSGLDDHYDVKMPCHPILSKLAD 540 VDDGLELRKAAFECV TL+D+CLDQ+NPSSFIVP+LKSGL+DHYD+KM CH ILS LAD Sbjct: 1074 VVDDGLELRKAAFECVFTLVDSCLDQVNPSSFIVPFLKSGLEDHYDLKMLCHLILSLLAD 1133 Query: 541 KCPSAVLTVLDSL 579 KCPSAVL VLDSL Sbjct: 1134 KCPSAVLAVLDSL 1146 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,747,429 Number of Sequences: 27288 Number of extensions: 272375 Number of successful extensions: 819 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 815 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 930958496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB30F23.yg.ab1 (458 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g21865.1 unknown protein / supported by full-length cDNA: ... 114 3e-26 >At3g21865.1 unknown protein / supported by full-length cDNA: Ceres:250935. Length = 100 Score = 114 bits (284), Expect = 3e-26 Identities = 54/76 (71%), Positives = 66/76 (86%), Gaps = 1/76 (1%) Frame = +1 Query: 1 VFTFGGLVKDNVLFCTTENGRMSFARQLEPDWHIDSDPEITSQLARFIRHQLHIST-KTE 177 VFT GGLVKD VLFC+TE GR SF RQLEPDWHID++PEI++QLARFI++QLH++T K E Sbjct: 22 VFTSGGLVKDKVLFCSTEIGRTSFVRQLEPDWHIDTNPEISTQLARFIKYQLHVATVKPE 81 Query: 178 RIASNVYSSSSLEQFF 225 R A NV++S S+EQFF Sbjct: 82 RTAPNVFTSQSIEQFF 97 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,447,147 Number of Sequences: 27288 Number of extensions: 216457 Number of successful extensions: 539 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 538 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 561761912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB30K21.yg.ab1 (741 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74260.1 putative phosphoribosylformylglycinamidine synthase ... 447 e-127 >At1g74260.1 putative phosphoribosylformylglycinamidine synthase / similar to GB:KIAA0361 from [Homo sapiens] Length = 1387 Score = 447 bits (1149), Expect(2) = e-127 Identities = 214/228 (93%), Positives = 226/228 (98%) Frame = +2 Query: 2 RGSFVVASTAGYCVGNLNIEGSYAPWEDASFEYPSHLASPLQILVDASNGASDYGNKFGE 181 RGSFVVAST+GYCVGNLN+EGSYAPWED+SF+YPS+LASPLQIL+DASNGASDYGNKFGE Sbjct: 404 RGSFVVASTSGYCVGNLNMEGSYAPWEDSSFQYPSNLASPLQILIDASNGASDYGNKFGE 463 Query: 182 PLIQGYTRTFGMRLPSGERREWLKPIMFSAGIGQIDHTHITKGEPEIGMLVVKIGGPAYR 361 P+IQGYTRTFGMRLPSG+RREWLKPIMFSAGIGQIDHTHITKGEPE+GMLVVKIGGPAYR Sbjct: 464 PMIQGYTRTFGMRLPSGDRREWLKPIMFSAGIGQIDHTHITKGEPEVGMLVVKIGGPAYR 523 Query: 362 IGMGGGAASSMVSGQNDAELDFNAVQRGDAEMAQKLYRVVRACIEMGENNPIISIHDQGA 541 IGMGGGAASSMVSGQNDAELDFNAVQRGDAEM+QKLYRVVRACIEMGE NPIISIHDQGA Sbjct: 524 IGMGGGAASSMVSGQNDAELDFNAVQRGDAEMSQKLYRVVRACIEMGEKNPIISIHDQGA 583 Query: 542 GGNCNVVKEIIYPEGATIDIRAIVVGDHTMSVLEIWGAEYQEQDAILV 685 GGNCNVVKEIIYP+GA IDIRA+VVGDHTMSVLEIWGAEYQEQDAILV Sbjct: 584 GGNCNVVKEIIYPQGAEIDIRAVVVGDHTMSVLEIWGAEYQEQDAILV 631 Score = 27.3 bits (59), Expect(2) = e-127 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = +1 Query: 694 SRSLLESVCKRERVSV 741 SR +L+S+CKRER+S+ Sbjct: 635 SREILQSICKRERLSM 650 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,715,844 Number of Sequences: 27288 Number of extensions: 429414 Number of successful extensions: 1608 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1598 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1321579340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB30L19.yg.ab1 (726 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61820.1 putative protein / MtN19, Medicago truncatula, EM... 282 1e-76 >At5g61820.1 putative protein / MtN19, Medicago truncatula, EMBL:MTY15367; supported by cDNA: gi_17529155 Length = 475 Score = 282 bits (722), Expect = 1e-76 Identities = 139/243 (57%), Positives = 169/243 (69%), Gaps = 9/243 (3%) Frame = +1 Query: 1 NAGLCDH-GRSQFFGMGSETRKTPTYVPDPYGIEVGNPLNVPAGYEEKWMFDIHAIDTRG 177 N GLC FFG+GSETR+T TYVPDPY IE+GNP P GYE KW+ +IHAIDTRG Sbjct: 137 NGGLCRSLTLRHFFGLGSETRETSTYVPDPYAIEIGNPEETPDGYEFKWLLNIHAIDTRG 196 Query: 178 AVDAIGCNECRCDLYNVTKDKDGLPLRPNYVGGLHCCYDGTQCKVKNGFKSVE--RNVYF 351 D GC EC CDLYNVT D+ G +RP Y GGL+CCYD TQC+VK+GF + E R +Y Sbjct: 197 VEDKKGCIECLCDLYNVTIDEYGRAIRPGYKGGLYCCYDKTQCRVKSGFDNGEKTRTLYL 256 Query: 352 KYTVKWVDWSDSVVPVKVFIFDVTDTWQ----DTGIHNCLFEYDVEKSATN--NYTNVRK 513 KYTV+WVDW SV+P KV+IFDVTD+W+ D+ H C EY+V+ TN +V+K Sbjct: 257 KYTVRWVDWDSSVLPAKVYIFDVTDSWERSKGDSQEHICHVEYEVKPCKTNGDGCVDVKK 316 Query: 514 SSVSFPTAGDVIYGFAQQYIGGIGSALYGEDGSVICASKPIYGKGIDIGDEAGYIVGMST 693 S+ P G ++YG A Q+ GGIG ALY E+G ICAS P YG G + G+EAGYIVGMS+ Sbjct: 317 KSLVMPFDGYIVYGVAHQHAGGIGGALYRENGEGICASMPKYGNGDEPGNEAGYIVGMSS 376 Query: 694 LYP 702 YP Sbjct: 377 CYP 379 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,306,257 Number of Sequences: 27288 Number of extensions: 400386 Number of successful extensions: 1132 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1087 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1130 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1277231040 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB30M05.yg.ab1 (571 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03510.1 expressed protein / ;supported by full-length cD... 307 2e-84 >At2g03510.1 expressed protein / ;supported by full-length cDNA: Ceres:41585. Length = 356 Score = 307 bits (787), Expect = 2e-84 Identities = 147/181 (81%), Positives = 164/181 (90%) Frame = +1 Query: 28 GGALQKTTTTPGFHLKLPLITHYEPVQVTLQTDTVRDIPCGTKGGVMINFDRIEVVNRLK 207 GGAL T PGFHLKLP IT+YEPVQVTLQTD VRDIPCGTKGGV+I F++IEVVNRL+ Sbjct: 61 GGALLNIITEPGFHLKLPFITNYEPVQVTLQTDQVRDIPCGTKGGVLITFEKIEVVNRLR 120 Query: 208 KESVYDTLLNYGVEYDHTWIYDKIHHEINQFCSAHSLQDVYIDMFDQIDETMKDALQADC 387 K+ VYDTLLNYGV YD+TWIYDKIHHEINQFCS+HSLQ VYID+FDQIDE MKDALQADC Sbjct: 121 KDFVYDTLLNYGVNYDNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDERMKDALQADC 180 Query: 388 TRYAPGIEIISVRVTKPSIPESATRNFEQMEDERTKVLVSVEKQRVAEKDAETLKKIAIT 567 TRYAPGIEI+SVRVTKP IPES RNFEQME+ERTKVL+++EKQRVAEK+AET K +AI+ Sbjct: 181 TRYAPGIEILSVRVTKPKIPESVRRNFEQMEEERTKVLIAIEKQRVAEKEAETKKIMAIS 240 Query: 568 E 570 E Sbjct: 241 E 241 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,911,437 Number of Sequences: 27288 Number of extensions: 295149 Number of successful extensions: 826 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 809 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 826 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 850394780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB30N01.yg.ab1 (667 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g55270.1 phosphatase - like protein / DUAL SPECIFICITY PRO... 72 3e-13 >At3g55270.1 phosphatase - like protein / DUAL SPECIFICITY PROTEIN PHOSPHATASE 5, Rattus norwegicus, SWISSPROT:DUS5_RAT; supported by cDNA: gi_15450857_gb_AY054509.1_ Length = 534 Score = 72.0 bits (175), Expect = 3e-13 Identities = 59/174 (33%), Positives = 80/174 (45%), Gaps = 6/174 (3%) Frame = +1 Query: 1 GEELSEFWNALGNDQDREHNMVTRGIVGQRKVVDYDIDFEVFDKAVNSGVVPPLSISGNV 180 G+E +W+A + V + G RKV Y++DFE+F KA+ G VP L+ S N Sbjct: 132 GDEPVYYWDAFASILPMIGGSVIKVQPGDRKVDAYNLDFEIFQKAIEGGFVPTLASSNNE 191 Query: 181 SETCLPARRSGWEILRRKFATGVMKDLITSSKEVESLDPISSDQNWVKNKDDDNDDECMS 360 ET LPAR + W L+ KFA+ K SK L + SD + + S Sbjct: 192 HETHLPARENSWSSLKCKFASRFDKGFRYVSK--TPLSRVYSDSMMIVHSSGSPSSTTSS 249 Query: 361 SDSFS-SFLVDD---SRKFGNSSPSISPTTSDCSNSFSFSP--TSSNWSDLSVL 504 S + S FL D S GNS S S ++ S S P T +S LS+L Sbjct: 250 SSTASPPFLSPDSVCSTNSGNSLKSFSQSSGRSSLRPSIPPSLTLPKFSSLSLL 303 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.310 0.128 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,097,659 Number of Sequences: 27288 Number of extensions: 349287 Number of successful extensions: 1556 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1550 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1112118500 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB31A14.yg.ab1 (670 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g12930.1 expressed protein / ;supported by full-length cDN... 245 1e-65 >At3g12930.1 expressed protein / ;supported by full-length cDNA: Ceres:39638. Length = 238 Score = 245 bits (626), Expect = 1e-65 Identities = 115/156 (73%), Positives = 136/156 (86%) Frame = +3 Query: 96 ANASQDTDDMYDDLFKKYGKVVYKSSDQKSPTAEVDDDAECLSFAVALAKIASDVKAADI 275 +N S+DTD+M+DDLF KYGKVV++S+D KSPTAEVDDDAE L+FAV LAK+ASDVKA DI Sbjct: 80 SNVSEDTDEMFDDLFNKYGKVVFRSTDVKSPTAEVDDDAESLAFAVELAKVASDVKAGDI 139 Query: 276 KLLFVKPLVYWTKFFLITTAFSRPQIDAIRNRINDLAEKQYGKFATGDTKANSWTLLDFG 455 K+LFVKPLVYWT+FF+I TAFSRPQIDAI +R+ DLAEK+YGK A GD K NSWTLLDFG Sbjct: 140 KVLFVKPLVYWTRFFIIATAFSRPQIDAIGSRMRDLAEKKYGKVANGDVKPNSWTLLDFG 199 Query: 456 DVVVHIFLPEQREIYNLEEFYANATPIELPFENEQR 563 DVV+H+FLP QR YNLE+FY NA IELPFE++ + Sbjct: 200 DVVIHLFLPPQRTFYNLEDFYGNAMQIELPFEDQSQ 235 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,410,563 Number of Sequences: 27288 Number of extensions: 338944 Number of successful extensions: 956 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 935 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 955 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB32A10.yg.ab1 (509 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05930.1 expressed protein / ;supported by full-length cD... 152 9e-38 >At5g05930.1 expressed protein / ;supported by full-length cDNA: Ceres:118390. Length = 274 Score = 152 bits (384), Expect = 9e-38 Identities = 75/115 (65%), Positives = 92/115 (79%) Frame = +1 Query: 1 IDIECRSIKEDELAVLILSGKCLVIALVDQYILSRPWTEDVYVPDIYSSSSGYTGHYIVI 180 I I+CRS+ E++ L+LSG + IALVDQ LS+ W E+V V ++SS+S YTGHY+VI Sbjct: 159 IIIQCRSVSIHEISCLLLSGNYIAIALVDQDKLSKSWLEEVLVSGLHSSNSCYTGHYVVI 218 Query: 181 CGYDALTDEFEIRDPASSRIRETISSRCLEKARKSFGTDEDILLIHLENTDN*NG 345 CGYDA+ DEFEIRDPASS+I E ISS+CLE ARKSFGTDED+LLI+LEN N NG Sbjct: 219 CGYDAVRDEFEIRDPASSKIHERISSKCLENARKSFGTDEDLLLINLENMRNQNG 273 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,840,842 Number of Sequences: 27288 Number of extensions: 233548 Number of successful extensions: 676 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 674 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 693469700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB32B20.yg.ab1 (430 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25660.1 unknown protein / 187 2e-48 >At2g25660.1 unknown protein / Length = 2136 Score = 187 bits (474), Expect = 2e-48 Identities = 97/142 (68%), Positives = 113/142 (79%) Frame = +2 Query: 5 QPSGKEAEVVVKKGTGHLNSKPKLVIRLTDLKLVLGPELRIVYPLILNFAVSGELELNGV 184 Q +GK V +K + KP + IRL+D+KLVLGPELRI+YPLILNFAVSGELEL+G+ Sbjct: 1851 QSTGKSNSV--EKEIEEVKMKPNMDIRLSDMKLVLGPELRIMYPLILNFAVSGELELDGM 1908 Query: 185 AHPKLLKPKGVLMSENGDVNLVATQVRLKREHLNTAKFEADYGLDPMLDLPLVGSEWQFR 364 AHPK +KPKGVL ENGDVNLVATQVRLKREHLN AKFE ++GLDP+LDL LVGSEWQFR Sbjct: 1909 AHPKFIKPKGVLTFENGDVNLVATQVRLKREHLNVAKFEPEHGLDPLLDLALVGSEWQFR 1968 Query: 365 IPSPATKRQARLDVTSPRPAEQ 430 + S A+ Q +L VTS R EQ Sbjct: 1969 VQSRASNWQDKLVVTSTRSVEQ 1990 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,582,753 Number of Sequences: 27288 Number of extensions: 195806 Number of successful extensions: 527 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 527 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 481662092 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB32E05.yg.ab1 (752 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58450.1 putative protein / predicted proteins from D.mela... 108 4e-24 >At5g58450.1 putative protein / predicted proteins from D.melanogaster, C.elegans and S.pombe Length = 1035 Score = 108 bits (269), Expect = 4e-24 Identities = 51/86 (59%), Positives = 67/86 (77%), Gaps = 4/86 (4%) Frame = +2 Query: 95 DLNYSEDY----EVSVTYCYILIQPASSVDMATGCCEYACGKFPNNLELMMGLFSCYVRG 262 +L Y +D +++++ I++Q +D+AT C +ACGK+PNNLELMMGLF+CYVR Sbjct: 137 ELLYKDDLALMDDLTLSTLQIVLQRLDHLDLATSCYAHACGKYPNNLELMMGLFNCYVRE 196 Query: 263 YSFVKQQQIAIKMYKVAGEEKFLLWA 340 YSFVKQQQ AIKMYK+AGEE+FLLWA Sbjct: 197 YSFVKQQQTAIKMYKLAGEERFLLWA 222 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,603,684 Number of Sequences: 27288 Number of extensions: 377121 Number of successful extensions: 821 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 821 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1357057980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB32I08.yg.ab1 (576 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55940.1 expressed protein / ;supported by full-length cD... 206 9e-54 >At5g55940.1 expressed protein / ;supported by full-length cDNA: Ceres:33108. Length = 208 Score = 206 bits (523), Expect = 9e-54 Identities = 104/165 (63%), Positives = 133/165 (80%), Gaps = 3/165 (1%) Frame = +1 Query: 88 MNNSNGGDCRYVIDQNAYIKLVLHALKHKTSAVNGVLLGRLSGE---VVEIADSVPLFHS 258 M + G+ +Y I QNAYIKLVLH+L+HKT+AVNGVL+GR+S + VVEI+DSVPLFHS Sbjct: 1 MGMGSNGELKYEISQNAYIKLVLHSLRHKTAAVNGVLVGRISPKDDGVVEISDSVPLFHS 60 Query: 259 SQIGLLPPLEIALITIEEYYSSQGLSIVGYFHANERFDDLELGTVARNIADHVYRYFPQA 438 + + LLPPLEI+LI IEE+Y +QGLSIVGYFHANERFDD+EL VA+NI DH+ RYFPQA Sbjct: 61 N-LALLPPLEISLIMIEEHYVAQGLSIVGYFHANERFDDVELCGVAKNIGDHISRYFPQA 119 Query: 439 ALLLLDNKKLGALRNNKDMGPVMQLYTRDSSKSWKHVESNGNKRV 573 +LLL+NKKL AL K+ PVMQL +D+SK+W+ V ++G ++ Sbjct: 120 PILLLNNKKLEALSKGKERSPVMQLCVKDASKNWRVVGADGGSKL 164 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,731,741 Number of Sequences: 27288 Number of extensions: 277993 Number of successful extensions: 937 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 868297828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB33D05.yg.ab1 (521 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g73990.1 SppA protease IV (SppA) / similar to protease IV ... 139 7e-34 >At1g73990.1 SppA protease IV (SppA) / similar to protease IV GB:AAA57008 from [Escherichia coli]; supported by cDNA: gi_6690269_gb_AF114385.1_AF114385 Length = 388 Score = 139 bits (351), Expect = 7e-34 Identities = 72/102 (70%), Positives = 85/102 (82%) Frame = +3 Query: 3 LVDAIGGFSRAVAIAKHKANIPQDKQVTLVELSRSSPSLPEILSGIGSSVIGIDMTLKQL 182 L+DA+GG SRA+AIAK KANIP +K+VTLVELSR S SLP+ILSGIGSSVIG+D TLK L Sbjct: 286 LIDAVGGLSRAIAIAKQKANIPLNKKVTLVELSRPSTSLPDILSGIGSSVIGVDRTLKGL 345 Query: 183 MDGLASSDGVQARMDGIMFQRSEGSSFANPIFNLLKDYLSSL 308 +D L ++GVQARMDGIMFQ+ S A PI ++LKDYLSSL Sbjct: 346 LDELTITEGVQARMDGIMFQQLGRDSLATPIIDMLKDYLSSL 387 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,720,207 Number of Sequences: 27288 Number of extensions: 252449 Number of successful extensions: 630 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 629 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 729494100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB33F07.yg.ab1 (387 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26230.1 putative uricase subunit / similar to nodulin-35... 160 7e-45 >At2g26230.1 putative uricase subunit / similar to nodulin-35; identical to GB:Y11120;supported by full-length cDNA: Ceres:38538. Length = 309 Score = 160 bits (404), Expect(2) = 7e-45 Identities = 74/102 (72%), Positives = 91/102 (88%) Frame = +2 Query: 2 TMKNTVYVKAKECKEQVSVEEFAIILAKHFTSFYPQVTTAIVKIVEKPWERISMNGQPHD 181 T+KNTVYVKAKEC +++SVEEFAI++ KHF SFYPQV TAIV I+EKPWER+S++G+PH Sbjct: 65 TIKNTVYVKAKECGDRLSVEEFAILIGKHFCSFYPQVFTAIVNIIEKPWERVSIDGKPHL 124 Query: 182 HGFKLGSEKHTTEVIVQKNGSLGVTSGVVGLSLLKTTQSGFE 307 HGFKLGSE HTTE V+K+G+L +TSG+ GL+LLKTTQSGFE Sbjct: 125 HGFKLGSENHTTEARVEKSGALNLTSGIGGLALLKTTQSGFE 166 Score = 36.6 bits (83), Expect(2) = 7e-45 Identities = 16/24 (66%), Positives = 20/24 (82%) Frame = +3 Query: 315 IPDHNTILPDTPERMLATQVSASW 386 + D TILP+T ERMLAT+V+ASW Sbjct: 169 VRDKYTILPETRERMLATEVNASW 192 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,266,676 Number of Sequences: 27288 Number of extensions: 198086 Number of successful extensions: 539 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 539 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 364610080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB33J14.yg.ab1 (237 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02690.1 expressed protein / ;supported by full-length cD... 137 1e-33 >At3g02690.1 expressed protein / ;supported by full-length cDNA: Ceres:35050. Length = 417 Score = 137 bits (344), Expect = 1e-33 Identities = 60/78 (76%), Positives = 69/78 (87%) Frame = +3 Query: 3 GSGEWWMLLAAQSMAVGTVMVRWVSKYSDPVMATGWHMVLGGIPLAALSYLVHDPALNGG 182 GSGEWWMLLAAQSMA+GTVMVRWVSKYSDP+MATGWHMV+GG+PL A+S + HDP NG Sbjct: 271 GSGEWWMLLAAQSMAIGTVMVRWVSKYSDPIMATGWHMVIGGLPLLAISVINHDPVFNGS 330 Query: 183 LSELTANDVFALLYTSVF 236 L +L+ NDV ALLYTS+F Sbjct: 331 LQDLSTNDVIALLYTSIF 348 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,220,036 Number of Sequences: 27288 Number of extensions: 138050 Number of successful extensions: 354 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 354 length of database: 11,516,596 effective HSP length: 54 effective length of database: 10,043,044 effective search space used: 241033056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB33M23.yg.ab1 (774 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g15980.1 expressed protein / ;supported by full-length cDN... 353 e-100 >At1g15980.1 expressed protein / ;supported by full-length cDNA: Ceres:122986. Length = 461 Score = 353 bits (906), Expect(2) = e-100 Identities = 169/242 (69%), Positives = 201/242 (82%) Frame = +2 Query: 2 VQVDVLSSARGKQAYEMNKNVRWADVIDPDDDYPEPADYLDFLGLIKNRYYDMMLSTKLA 181 VQVD+L++ RGKQ YE+NKNVRWA+V DPDD +PEPA+Y D +GL+K RYYDM+LSTKLA Sbjct: 146 VQVDILTTERGKQTYELNKNVRWANVYDPDDHWPEPAEYTDMIGLLKGRYYDMVLSTKLA 205 Query: 182 GIGHASFLFLSMATERASYIYPNVNSAGAGLLLSETFTPDRLNLSEGGYHMYKQMTDWLA 361 G+GHA+FLF++ A +R SYIYPNVNSAGAGL+LSETFT + NLSE GY MY QM DWL Sbjct: 206 GLGHAAFLFMTTARDRVSYIYPNVNSAGAGLMLSETFTAENTNLSELGYSMYTQMEDWLG 265 Query: 362 RPGRGVPRQEIPPLKVSIPRKVKEVVAEKYKNAGVEKGKYVVIHGIQSDSKASMQSRGDT 541 RP R VPR + PL+VSI RKVKEVVA KY+NAG GK++VIHGI+SDSKASMQS+GD Sbjct: 266 RPFRSVPRTPLLPLRVSISRKVKEVVAAKYRNAGAVTGKFIVIHGIESDSKASMQSKGDA 325 Query: 542 DSLLPLXLWAEITNSIRGVKPLYVIPHXEEREDVGEIVGDDTHILFITTPGQLAALINDS 721 DSLL L WA+I +RG KP++VIPH +ERE+V + VGDDT I+FITTPGQLAALINDS Sbjct: 326 DSLLSLEKWAKIIKGVRGFKPVFVIPHEKERENVEDFVGDDTSIVFITTPGQLAALINDS 385 Query: 722 VG 727 G Sbjct: 386 AG 387 Score = 29.3 bits (64), Expect(2) = e-100 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +3 Query: 726 GVISTNTAAVQLARAR 773 GVI+TNTAA+QLA AR Sbjct: 387 GVIATNTAAIQLANAR 402 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,700,497 Number of Sequences: 27288 Number of extensions: 402969 Number of successful extensions: 1188 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1068 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1188 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB34A12.yg.ab1 (420 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72020.1 expressed protein / ; supported by full-length cD... 124 2e-29 >At1g72020.1 expressed protein / ; supported by full-length cDNA: Ceres: 2031. Length = 97 Score = 124 bits (310), Expect = 2e-29 Identities = 63/95 (66%), Positives = 79/95 (82%), Gaps = 2/95 (2%) Frame = +3 Query: 6 TGLRSLSSKLLVSVDSSLAKSAQRGFHSTGAKRM--GGHGGHDEPAYLHSKHMYNLDRMK 179 T +RS+S K++ S ++S+++S R FHSTG K+M GGHGG+DE YLH+KHMYNLDRMK Sbjct: 5 TSIRSVS-KIIASSEASVSRSVTRSFHSTGVKKMSGGGHGGYDE-YYLHAKHMYNLDRMK 62 Query: 180 NQKLTMTLGVFTAFSIGVGVPIYAVIFQQKKTASG 284 Q L M+LGVFTAFSIGVGVPI+AV+FQQ+KT SG Sbjct: 63 YQALKMSLGVFTAFSIGVGVPIFAVVFQQRKTQSG 97 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,292,581 Number of Sequences: 27288 Number of extensions: 191414 Number of successful extensions: 628 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 626 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 454398200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB34K10.yg.ab1 (468 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g21760.1 F-box protein family / Contains PF|00646 F-box do... 136 6e-33 >At1g21760.1 F-box protein family / Contains PF|00646 F-box domain. ESTs gb|Z37267, gb|R90412, gb|Z37268 and gb|T88189 come from this gene;supported by full-length cDNA: Ceres:11543. Length = 328 Score = 136 bits (342), Expect = 6e-33 Identities = 61/88 (69%), Positives = 73/88 (82%) Frame = -1 Query: 264 RLRGTTAGANTRMDLLSIVTSGVQESEVPGPDGDILGVVEGWQDDDTHNPEVPAISHTRG 85 RLRGT GAN RMDLLS+VTSGV + E+ + DILG+VEGW+DD+THNP++PA+SH RG Sbjct: 239 RLRGTAIGANNRMDLLSLVTSGVNDEEISSTEEDILGLVEGWEDDETHNPDIPAVSHKRG 298 Query: 84 LTPIVFVPFEEADTSVLNLPVERMDYYV 1 +T VFVPFEE D SVLNLP E+MDYYV Sbjct: 299 MTAFVFVPFEEVDESVLNLPPEKMDYYV 326 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,521,895 Number of Sequences: 27288 Number of extensions: 229735 Number of successful extensions: 549 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 549 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 578136832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB34M20.yg.ab1 (594 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72560.1 putative exportin, tRNA (nuclear export receptor for... 293 5e-80 >At1g72560.1 putative exportin, tRNA (nuclear export receptor for tRNAs) / similar to exportin, tRNA (nuclear export receptor for tRNAs) GB:6005954 [Homo sapiens] Length = 993 Score = 293 bits (750), Expect = 5e-80 Identities = 144/185 (77%), Positives = 168/185 (89%) Frame = +2 Query: 2 FSERLVTASRPAIGLMFKQTLDVLLQILIIFPKVETLRSKVTAFIHRMVETLGSSVFPYL 181 F+ERLVTASRP IGLMFKQTLDVLL++LI FPKVE LRSKVT+FIHRMV+TLGS+VFPYL Sbjct: 671 FNERLVTASRPGIGLMFKQTLDVLLRVLIEFPKVEPLRSKVTSFIHRMVDTLGSAVFPYL 730 Query: 182 PKALEQLLAESEPKELVGFLVLLNQLICKFNTSVQDILENVYPVIGGRIFSILPRDTIPS 361 PKALEQLLA+SEPKE+VGF+VLLNQLICKFN+++ DILE VYPV+ RIF+++PRD +PS Sbjct: 731 PKALEQLLADSEPKEMVGFMVLLNQLICKFNSALHDILEEVYPVVAVRIFNVIPRDGLPS 790 Query: 362 GPGSNTEEIRELQELQRTFYTFLHVMATHDLSSVFLSPKSQGYLDSMMQLLLFTSCNHKD 541 PG+ TEE+REL ELQR YTFLHV+ATHDLSSVFL+PKS+ YLD MMQL+L TSCNHKD Sbjct: 791 RPGAVTEEMRELIELQRMLYTFLHVIATHDLSSVFLTPKSRAYLDPMMQLVLNTSCNHKD 850 Query: 542 LVVRK 556 + VRK Sbjct: 851 ITVRK 855 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,089,949 Number of Sequences: 27288 Number of extensions: 293506 Number of successful extensions: 694 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 693 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 922006972 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB35B01.yg.ab1 (631 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11790.1 expressed protein / supported by full-length cDNA... 125 2e-29 >At4g11790.1 expressed protein / supported by full-length cDNA: Ceres:151415. Length = 443 Score = 125 bits (314), Expect = 2e-29 Identities = 77/149 (51%), Positives = 88/149 (58%), Gaps = 14/149 (9%) Frame = +1 Query: 22 QRAESSRQHVRALNTQFASWVQSQLQNHPDELWEDGVRDYLTHASNILEKFSDVVNWLKS 201 QRAE +R+HVRALN QF SWVQ QL+NHPDELWEDG+ DY+THASNILEKF DVV+WLK Sbjct: 50 QRAELARKHVRALNNQFVSWVQLQLKNHPDELWEDGMNDYITHASNILEKFKDVVSWLKE 109 Query: 202 NSTKSEKLSEPGSHVAQKKLVTDNKGI------TNVPLQEKTSNAPLSGPAS---MFATS 354 N K E LS P S A+ KLV + K N+P S S + S Sbjct: 110 NKGKGENLS-PESRGAENKLVAEVKNTNVKSFSNNIPFASNNQPGIFSNNQSSDFSSSQS 168 Query: 355 GFVSS----WSPRPLG-NSQSTQSSFSFG 426 GF SS +S P G S S SFS G Sbjct: 169 GFFSSQSGAFSSSPSGLISNSQTGSFSSG 197 Score = 77.4 bits (189), Expect(2) = 7e-18 Identities = 53/123 (43%), Positives = 71/123 (57%), Gaps = 6/123 (4%) Frame = +1 Query: 226 SEPGSHVAQKKLVTDNK---GITNVPLQEKTSNAP--LSGPASMFATSGFVSSWSPRPLG 390 S+PG+ + +T N ++ + S+ P LSG + +G +SS +P Sbjct: 221 SQPGTFSSSHSGITSNSQTGSFSSGQFGQTKSSQPSLLSG-----SQAGAISS--NQPSF 273 Query: 391 NSQSTQSSFSFGVQS-SIGVKPDASKDADGDDEAEQPSSPSVKKTEEIGISVVHEVKCKI 567 ++QS F+ V SI K D S DADG DE QPSSPSVKKTEE GI+VVHEVKCK+ Sbjct: 274 QFSNSQSPFTSAVPPVSIPAKQDHSDDADGGDEQSQPSSPSVKKTEEKGITVVHEVKCKL 333 Query: 568 YIK 576 Y+K Sbjct: 334 YVK 336 Score = 30.0 bits (66), Expect(2) = 7e-18 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 588 WKDRGTGQLTIKCK 629 WKD+GTG L IKCK Sbjct: 345 WKDKGTGNLYIKCK 358 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.310 0.126 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,048,022 Number of Sequences: 27288 Number of extensions: 344688 Number of successful extensions: 1072 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1064 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1017362904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB35B19.yg.ab1 (611 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g03360.1 hypothetical protein / Similar to hypothetical pr... 306 3e-84 >At1g03360.1 hypothetical protein / Similar to hypothetical protein SPAC2F7.14c gi|1052797 from Schizosaccharomyces pombe cosmid gb|Z50142 Length = 322 Score = 306 bits (784), Expect(2) = 3e-84 Identities = 144/187 (77%), Positives = 169/187 (90%) Frame = -3 Query: 576 NQEDGVLKGHGTTDLDGEVVATVCGVIERVNKLVYVRTLRARYKPEVGDIIVGRVLEVAP 397 N +D LKGHGT+++DGE++ATVCGV+ERV+KLVYVRTLRARYKPEVGDI+VGRV+EVA Sbjct: 47 NHDDAFLKGHGTSEVDGELLATVCGVVERVDKLVYVRTLRARYKPEVGDIVVGRVIEVAQ 106 Query: 396 KRWRLEINFSQDAVLMLSSMNLPDGIQRRRTAVDELNMRSIFEENDVVSAEVRDFMRDGS 217 KRWR+E+NF+QD VLMLSSMN+PDGIQRRRT+VDELNMR+IF E+DVV AEVR+F DGS Sbjct: 107 KRWRVELNFNQDGVLMLSSMNMPDGIQRRRTSVDELNMRNIFVEHDVVCAEVRNFQHDGS 166 Query: 216 LQLQARSQKYGKLERGQLLTISPYLVKRRKQHFHHLEKYGIDLILGCNGFIWVGEHVEVK 37 LQLQARSQKYGKLE+GQLL + PYLVKR K HFH++E GIDLI+GCNGFIWVGEHVEV+ Sbjct: 167 LQLQARSQKYGKLEKGQLLKVDPYLVKRSKHHFHYVESLGIDLIIGCNGFIWVGEHVEVR 226 Query: 36 DDMVEDE 16 D M D+ Sbjct: 227 DPMAIDD 233 Score = 23.1 bits (48), Expect(2) = 3e-84 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 611 NASVTVADSIPVTKKTAF 558 +ASV V DSIPV AF Sbjct: 35 DASVIVTDSIPVNHDDAF 52 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,973,479 Number of Sequences: 27288 Number of extensions: 301448 Number of successful extensions: 892 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 862 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 892 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 963817488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB35F11.yg.ab1 (728 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39680.1 hypothetical protein / 180 6e-46 >At4g39680.1 hypothetical protein / Length = 633 Score = 180 bits (457), Expect = 6e-46 Identities = 130/285 (45%), Positives = 163/285 (56%), Gaps = 43/285 (15%) Frame = +2 Query: 2 KSDSISIDTMSGTEKIELKDNVIAADGEGRVELDVKPEMSFGKVVSDDGKTESVVVNAVV 181 KSD IS D++S EKIELKDN IA + ++E +V VV ES ++ Sbjct: 226 KSDCISTDSVSNNEKIELKDNKIADNV--KLEQNVNKFQEPSTVVG-----ESHPMDVEE 278 Query: 182 PTDKK------DVSIAESGDV---------GSPEKLNLDRSSGDDSMEEDALESKQIESV 316 P ++K D S A + D+ G EKLNLDRSSGD+SME++ E+KQ ES+ Sbjct: 279 PLEQKTSVGGGDDSNAANADMIKENNIIDAGDSEKLNLDRSSGDESMEDEP-ETKQSESI 337 Query: 317 DVMVEDSPAAKITECTKENS----------------DPAVRPIKRKL--HDQEAATNSEV 442 D +AKI +KE S P V KRKL +DQEA N+E Sbjct: 338 ---TSDDKSAKIEMLSKEESRADMDAGKGKSPENKSHPLVASDKRKLPANDQEAVGNNEP 394 Query: 443 VKRQRMLNS-----QQQTTNSSVSTTP-----MRHRFLKSDSSVSHEEPKERVVPPSSMS 592 KR+R ++ + Q TNS+ TT ++ F +SDSSVS + PKERVVPPS Sbjct: 395 AKRRRWNSNSIKVPEAQITNSATPTTTPRSTGLKRDFSRSDSSVSEDGPKERVVPPSPKE 454 Query: 593 PTTSLRIDRFLRPFTLEAVQELLGQTGTVVSFWMDRIKTH*YVTY 727 PT SLRIDRFLRPFTL+AVQELLG+TG V SFWMD IKTH YV+Y Sbjct: 455 PTNSLRIDRFLRPFTLKAVQELLGKTGNVTSFWMDHIKTHCYVSY 499 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,676,578 Number of Sequences: 27288 Number of extensions: 316370 Number of successful extensions: 1582 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1564 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1286100700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB35F18.yg.ab1 (765 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49510.1 von Hippel-Lindau binding protein (VHL binding prote... 282 1e-76 >At5g49510.1 von Hippel-Lindau binding protein (VHL binding protein; VBP) like / ; supported by cDNA: gi_13878182_gb_AF370354.1_AF370354 Length = 195 Score = 282 bits (722), Expect = 1e-76 Identities = 142/170 (83%), Positives = 156/170 (91%) Frame = +3 Query: 21 RGIPAASFVKDVQAYLNQLGLDVNNTLAFLQERLQQYKVVEMKLLAQQRDLQAKIPDIEK 200 RGIPAA F++DV+ YL+Q GLD N+ LAF QERLQQYKVVEMKLLAQQRDLQAKIPDIEK Sbjct: 17 RGIPAAKFIQDVETYLSQSGLDPNSALAFHQERLQQYKVVEMKLLAQQRDLQAKIPDIEK 76 Query: 201 CLDVVATLQAKKDSDEALLTDFEVSEGIYARARIENADSVCLWLGANVMLEYSCEEATTL 380 CL+VVATL+AKK + EALL DFEVSEGIY+RA IE+ DSVCLWLGANVMLEYSCEEA+ L Sbjct: 77 CLEVVATLEAKKGTGEALLADFEVSEGIYSRACIEDTDSVCLWLGANVMLEYSCEEASAL 136 Query: 381 LQNNLENAKASLEVLVADLQFLRDQVTITQVTIARVYNWDVHQRRVKSTS 530 L+NNLENAKASLEVLVADLQFLRDQVT+TQVTIARVYNWDVHQRRVK + Sbjct: 137 LKNNLENAKASLEVLVADLQFLRDQVTVTQVTIARVYNWDVHQRRVKQVT 186 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,868,512 Number of Sequences: 27288 Number of extensions: 323394 Number of successful extensions: 828 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 828 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1392536620 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB36A15.yg.ab1 (489 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15530.1 pyruvate,orthophosphate dikinase / 261 1e-70 >At4g15530.1 pyruvate,orthophosphate dikinase / Length = 960 Score = 261 bits (668), Expect = 1e-70 Identities = 134/178 (75%), Positives = 144/178 (80%), Gaps = 15/178 (8%) Frame = -1 Query: 489 VILGKQQLPPPAMSPDLEIFMSWADQVRRLKVMANADTPNDALTARNNGAQGIXLCRTEH 310 VILGKQ L PPA+SPDLE FMSWAD +RRLKVMANADTP DA+ AR NGAQGI LCRTEH Sbjct: 576 VILGKQALAPPALSPDLETFMSWADAIRRLKVMANADTPEDAIAARKNGAQGIGLCRTEH 635 Query: 309 MF---------------FXSDERIKAVRKMIMXVTLEQRKAALDLLLPYQRSDFEGIFRA 175 M F +RIKAVRKMIM VT EQRKA+LD+LLPYQRSDFEGIFRA Sbjct: 636 MIVCIQMFNVVFGLVFKFFGADRIKAVRKMIMAVTTEQRKASLDILLPYQRSDFEGIFRA 695 Query: 174 MDGLPVTIRLLDPPLHEFLPEGDLDHIVSELTVDTGMTEDEIYSRIEKLSEVNPMLGF 1 MDGLPVTIRLLDPPLHEFLPEGDLD+IV EL +TG+ EDE+ SRIEKLSEVNPMLGF Sbjct: 696 MDGLPVTIRLLDPPLHEFLPEGDLDNIVHELAEETGVKEDEVLSRIEKLSEVNPMLGF 753 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,030,045 Number of Sequences: 27288 Number of extensions: 237952 Number of successful extensions: 616 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 615 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 630427000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB36O01.yg.ab1 (414 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25910.1 expressed protein / ;supported by full-length cD... 156 4e-39 >At2g25910.1 expressed protein / ;supported by full-length cDNA: Ceres:26655. Length = 341 Score = 156 bits (394), Expect = 4e-39 Identities = 75/100 (75%), Positives = 82/100 (82%) Frame = +3 Query: 114 LHDCKRDSEALYFQFNIKLHNVFDTQIAYSLIEEQEGGTKVPDDYISFVGLLADPRYFGI 293 +HDCKRDSEALYFQF I+LHNV DTQIAYSLIEEQEG + DDYISFV LLADPRY GI Sbjct: 113 IHDCKRDSEALYFQFGIRLHNVVDTQIAYSLIEEQEGRRRPLDDYISFVSLLADPRYCGI 172 Query: 294 SYLEKHEATVLLTXDPNFWKYRPLSELMVRAATDDVRLLL 413 SY EK E VL+ DP FW YRP++ELM+RAA DDVR LL Sbjct: 173 SYEEKEEVRVLMRQDPKFWTYRPMTELMIRAAADDVRFLL 212 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,501,367 Number of Sequences: 27288 Number of extensions: 203305 Number of successful extensions: 2038 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1802 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 436222272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB37A23.yg.ab1 (697 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11480.1 expressed protein / contains similarity to eukary... 99 2e-21 >At1g11480.1 expressed protein / contains similarity to eukaryotic initiation factor 4B GI:6739515 from [Triticum aestivum]; supported by cDNA: gi_14335083_gb_AY037221.1_ Length = 578 Score = 99.4 bits (246), Expect = 2e-21 Identities = 75/181 (41%), Positives = 101/181 (55%), Gaps = 9/181 (4%) Frame = +3 Query: 3 LVLKERGVDDVAATQDMIQSPNRMK-KDITRAENPPMNPTVTSRQNGKSEPFDHHRTGKT 179 LVLKERG+D+ + Q +RM K I R V+S ++ ++ FD + G+ Sbjct: 405 LVLKERGIDE-PEHHKLDQPTDRMVLKPIERVPEHASQRPVSSPRDMRTRKFDQ-KDGRN 462 Query: 180 IDRREAEKSDAQRRSNWRNDNRKSSRDLEQQQE--RPPSPETWRKPV----DPEPSAGPR 341 + + +S+ QRR NWR + KS+R +Q QE R PSPETWRKPV D G R Sbjct: 463 VS--DIARSETQRR-NWRENENKSARQQQQTQEKTRHPSPETWRKPVPQKLDSPNGTGIR 519 Query: 342 YGKAASAVELAQAFSKSVSDPK--VVAIDRFSSQRGLPGQAQIPFSRLTSQPATRSHING 515 +GKAASA+ELAQA+S SDPK + + + F+ R Q Q PFSRL T ING Sbjct: 520 HGKAASALELAQAYS-PFSDPKSGIGSSNSFNKSRNNQTQQQ-PFSRLVGSTTTGRQING 577 Query: 516 H 518 + Sbjct: 578 Y 578 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,660,429 Number of Sequences: 27288 Number of extensions: 383487 Number of successful extensions: 1383 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1372 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1201087980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB37B02.yg.ab1 (545 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g36310.1 expressed protein / similar to Yml014wp GB:NP_013... 111 2e-25 >At1g36310.1 expressed protein / similar to Yml014wp GB:NP_013698 from [Saccharomyces cerevisiae];supported by full-length cDNA: Ceres:34418. Length = 404 Score = 111 bits (278), Expect = 2e-25 Identities = 49/71 (69%), Positives = 62/71 (87%) Frame = +3 Query: 3 PLHGAEVSGASAGAVENGLARKDDSKGAIVYDRYYHVFGQGELESLVSGMKNAVIVDQFY 182 P H AEVSGASA A+ +GLA+KDD KGA+VY+RYYHVF +GELE L SG+ NA+IVD+F+ Sbjct: 328 PYHRAEVSGASASALASGLAKKDDRKGAVVYNRYYHVFSEGELERLASGVGNAMIVDRFF 387 Query: 183 DKSNWCVILEK 215 DKSNWC++L+K Sbjct: 388 DKSNWCIVLQK 398 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,411,047 Number of Sequences: 27288 Number of extensions: 269434 Number of successful extensions: 740 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 740 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 790135456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB37M18.yg.ab1 (714 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03450.1 putative protein / 209 2e-54 At5g03750.1 hypothetical protein / 54 6e-08 >At5g03450.1 putative protein / Length = 614 Score = 209 bits (531), Expect = 2e-54 Identities = 110/232 (47%), Positives = 158/232 (67%), Gaps = 4/232 (1%) Frame = +1 Query: 25 AFTLQREFQVDGGRYFDIDASGQLMIVARRQNGTGGTSILSKISLLAPNEREDIHLPAYT 204 +F Q + ++GGR FDID Q+++ ARR +G GGT +L+++SL +P E +DI LP T Sbjct: 259 SFRHQGDLLINGGRIFDIDGGRQILLYARRLSGVGGTFVLTQMSLHSPCEIDDILLPRTT 318 Query: 205 KAVRALCVRPCTR-LALVASLGKKLSIVSTESNNTVVTYDLPASAWSCSWDVDSPYHVYT 381 +A++ L + P LA+ SLGKKLS++S ES+NTV++YDLPA+ WSCSWD+ S +H+Y Sbjct: 319 RAIKDLHLSPHNNGLAVFGSLGKKLSVISLESHNTVLSYDLPAAPWSCSWDLKSSHHIYA 378 Query: 382 GLQNGMVMSFDTRQTKEPLETRIGLSCNPVHTLISVAPDS--SSGTTTLLSASQIGICEW 555 GLQNGMV+ FD RQT P + GL+ NPVHT+ ++ +S +S TLLSAS IG+C+W Sbjct: 379 GLQNGMVLIFDMRQTTGPFASMTGLTTNPVHTVHHLSGNSTPTSDVRTLLSASSIGLCQW 438 Query: 556 NIGSSEERPYLIPESKNEGQACISLAH-SGGDDSVASFRPKIETSTQITVSQ 708 NI SE P L+ E+ N G CIS ++ + VAS+RP++ +S +Q Sbjct: 439 NISGSEGSPSLVSETGNPG-VCISSSYCPRSNHIVASYRPRVGSSDDTVPTQ 489 >At5g03750.1 hypothetical protein / Length = 169 Score = 54.3 bits (129), Expect = 6e-08 Identities = 23/45 (51%), Positives = 33/45 (73%) Frame = +1 Query: 340 SCSWDVDSPYHVYTGLQNGMVMSFDTRQTKEPLETRIGLSCNPVH 474 SCSWD+++ ++VY GLQNGMV+ FD RQ + PL + ++ N VH Sbjct: 41 SCSWDLNNYHNVYAGLQNGMVLVFDMRQNRGPLVSLADVTSNSVH 85 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.315 0.131 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,750,470 Number of Sequences: 27288 Number of extensions: 383400 Number of successful extensions: 1033 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1000 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1031 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1254469668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB37P15.yg.ab1 (660 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g48210.1 putative protein / ;supported by full-length cDN... 168 2e-42 >At3g48210.1 putative protein / ;supported by full-length cDNA: Ceres:38202. Length = 315 Score = 168 bits (426), Expect = 2e-42 Identities = 94/221 (42%), Positives = 141/221 (63%), Gaps = 4/221 (1%) Frame = +3 Query: 6 EDGLVKAIAVKTRQEAKKMAIADSISAVKARNEELHKIVVDQRTRKEEYAQIISRQSEAL 185 ED LVK +AVKTR+EA++M I DSISA ++R E L + + Q+++K++ +IIS+Q +AL Sbjct: 75 EDELVKVLAVKTRKEARQMGIRDSISATQSRIEVLRRNLQLQKSKKDDSVRIISQQLQAL 134 Query: 186 KECEEKHNQDAERREEIEEAISWYNKVLGFRIERGRGIKFIFTHINMKKPDEEYFFTIRL 365 + ++ + E + +I EAISWYN LGF +E G G+KF FT+I+ K+P E+ FT+ Sbjct: 135 SKSKDNAGKVTEDKADIHEAISWYNHALGFHVEAGHGVKFTFTNIDAKRPTREFSFTVHY 194 Query: 366 ENDSYCLLECHPHVTEVNKLVNDLNITNGLYNFVRVMRTKFQEVSAGGNLHEIASH---- 533 ND Y LL+ + +N++V +LN TN L+ FVR+MR +F + L E+ +H Sbjct: 195 GNDIYTLLDSDLQLDYINEMVQELNKTNDLFRFVRLMREQFLK----STLSELPTHSGQL 250 Query: 534 PQETTMISMSAPMSSVSTDSVSGSPKKNNFRQADRVGRKAK 656 QET+ IS SAP S STD+ +P+ N R +V R+ K Sbjct: 251 QQETSAISASAPAISFSTDTNMSTPE--NKRSKVQVNRRQK 289 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,241,971 Number of Sequences: 27288 Number of extensions: 306576 Number of successful extensions: 1110 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1056 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1101 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1106605264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB38B13.yg.ab1 (567 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g73090.1 expressed protein / ;supported by full-length cDN... 178 1e-45 >At1g73090.1 expressed protein / ;supported by full-length cDNA: Ceres:1321. Length = 306 Score = 178 bits (452), Expect = 1e-45 Identities = 81/127 (63%), Positives = 101/127 (78%) Frame = +1 Query: 1 INYFKTALFCCVDGQTFGRVIDASVFRGSSRAFAPLYFTVREVNEVMSTEEPCDMAYEFG 180 IN+FK ALF +GQ +GRV V + AF+PLYF V E EVM+TEEPCD+A +FG Sbjct: 179 INFFKMALFRSYNGQIYGRVCGGPVVSTLANAFSPLYFEVTEAMEVMATEEPCDVACKFG 238 Query: 181 DGLLDLQEYPQGFPKPGKHPSPFNDAVVIYVRNVGPGVMVGQAWQEGEDLNQVPKKLCSE 360 DGLL +++YPQGFP+P KHP PFND+VVIY+R++GPGV VGQAWQEG +L QVP++LCS+ Sbjct: 239 DGLLAIEDYPQGFPRPAKHPYPFNDSVVIYIRHIGPGVCVGQAWQEGRELQQVPQRLCSD 298 Query: 361 ILMVKDY 381 ILMVK Y Sbjct: 299 ILMVKQY 305 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,771,851 Number of Sequences: 27288 Number of extensions: 293096 Number of successful extensions: 753 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 740 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 753 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 841443256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB38D16.yg.ab1 (695 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g29630.1 putative thiamin biosynthesis protein / ; suppor... 476 e-135 >At2g29630.1 putative thiamin biosynthesis protein / ; supported by cDNA: gi_20260179 Length = 644 Score = 476 bits (1225), Expect = e-135 Identities = 225/231 (97%), Positives = 229/231 (98%) Frame = +2 Query: 2 RHIHETREWILRNSAVPVGTVPIYQALEKVNGIAENLTWEVFRETLIEQAEQGVDYFTIH 181 RHIHETREWILRNSAVPVGTVPIYQALEKV+GIAENL WEVFRETLIEQAEQGVDYFTIH Sbjct: 263 RHIHETREWILRNSAVPVGTVPIYQALEKVDGIAENLNWEVFRETLIEQAEQGVDYFTIH 322 Query: 182 AGVLLRYIPLTAKRMTGIVSRGGSIHAKWCLAYHKENFTYEHWDDILDICNQYDIALSIG 361 AGVLLRYIPLTAKR+TGIVSRGGSIHAKWCLAYHKENF YEHWDDILDICNQYD+ALSIG Sbjct: 323 AGVLLRYIPLTAKRLTGIVSRGGSIHAKWCLAYHKENFAYEHWDDILDICNQYDVALSIG 382 Query: 362 DGLRPGSIYDANDTAQFAELLTQGELTRRAWEKDVQVMNEGPGHIPMHKIPENMQKQLEW 541 DGLRPGSIYDANDTAQFAELLTQGELTRRAWEKDVQVMNEGPGH+PMHKIPENMQKQLEW Sbjct: 383 DGLRPGSIYDANDTAQFAELLTQGELTRRAWEKDVQVMNEGPGHVPMHKIPENMQKQLEW 442 Query: 542 CNEAPFYTLGPLTTDIAPGYDHITSAIGAANIGALGTALLCYVTPKEHLGL 694 CNEAPFYTLGPLTTDIAPGYDHITSAIGAANIGALGTALLCYVTPKEHLGL Sbjct: 443 CNEAPFYTLGPLTTDIAPGYDHITSAIGAANIGALGTALLCYVTPKEHLGL 493 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,331,042 Number of Sequences: 27288 Number of extensions: 372538 Number of successful extensions: 977 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 944 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 977 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1201087980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB38P14.yg.ab1 (751 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g04620.1 unknown protein / 462 e-131 >At1g04620.1 unknown protein / Length = 360 Score = 462 bits (1189), Expect = e-131 Identities = 218/250 (87%), Positives = 238/250 (95%) Frame = +1 Query: 1 RQRSKPIPPGGTYPAKDHCSKCGLCDTYYVAHVKNACAFLGDGMSRVQGLEPVVHGRPRN 180 R++S+PIPPGGTYPAKDHCS+CGLCDTYY+AHVK ACAFLGDGMSR++ LEPVVHGR R Sbjct: 56 REKSRPIPPGGTYPAKDHCSQCGLCDTYYIAHVKEACAFLGDGMSRIESLEPVVHGRGRK 115 Query: 181 PDSLDETYFGVHQELLYARKIHPLPGAQWTGIVTTIAIEMLKSGMVEAVVCVQSDPDDRL 360 DSL +TYFGVHQE LYARK+ P+ GAQWTGIVTTIAIEMLKS MVEAVVCVQSDP+DRL Sbjct: 116 ADSLQDTYFGVHQEQLYARKLKPVEGAQWTGIVTTIAIEMLKSNMVEAVVCVQSDPEDRL 175 Query: 361 SPRPVLARTPEEVLAAKGVKPTLSPNLNTLALVEAAGVKRLLFCGVGCQVQALRSVEQYL 540 SPRPVLARTPEEVLAA+GVKPTLSPNLNTL L+EA+GVKRLLFCGVGCQVQALRSVEQ+L Sbjct: 176 SPRPVLARTPEEVLAARGVKPTLSPNLNTLELIEASGVKRLLFCGVGCQVQALRSVEQHL 235 Query: 541 NLDKLYVLGTNCVDNGTRDGLDKFLRAASEDPETVVHYEFMQDYKVHLKHLDGHIEEVPY 720 NL+KLYVLGTNCVDNGTRDGLDKFL+AAS++PETV+HYEFMQDYKV LKHLDGHIEEVPY Sbjct: 236 NLEKLYVLGTNCVDNGTRDGLDKFLKAASKEPETVLHYEFMQDYKVQLKHLDGHIEEVPY 295 Query: 721 FSLPANDLVD 750 FSLPANDLVD Sbjct: 296 FSLPANDLVD 305 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,689,122 Number of Sequences: 27288 Number of extensions: 401665 Number of successful extensions: 1031 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 994 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1031 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB39A01.yg.ab1 (668 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03820.1 putative nonsense-mediated mRNA decay protein / ... 369 e-103 >At2g03820.1 putative nonsense-mediated mRNA decay protein / ; supported by cDNA: gi_15810402_gb_AY056240.1_ Length = 516 Score = 369 bits (948), Expect = e-103 Identities = 172/215 (80%), Positives = 194/215 (90%) Frame = +3 Query: 21 AGMFTVQQTVGSVLCCKCGILMAPNAANMCVKCLRSEVDITEGLQKHVIIIHCPECDCYL 200 +GMF VQQT+GSVLCCKCG+ MAPNAANMCV CLRSEVDITEGLQK + I +CPEC CYL Sbjct: 7 SGMFNVQQTIGSVLCCKCGVPMAPNAANMCVNCLRSEVDITEGLQKSIQIFYCPECTCYL 66 Query: 201 QPPRTWLKAQVESKELLTFCVKRLKNLNKVRLIHAEFIWTEPHSKRIKVKLRVQKEVLNG 380 QPP+TW+K Q ESKELLTFC+KRLKNLNKV+L +AEF+WTEPHSKRIKVKL VQ EVLNG Sbjct: 67 QPPKTWIKCQWESKELLTFCIKRLKNLNKVKLKNAEFVWTEPHSKRIKVKLTVQAEVLNG 126 Query: 381 AVLEQAYMVEYVVHDQMCESCSRVQANPDQWVAAVQLRQHVSHRRTFFYLEQLILKHDAA 560 AVLEQ+Y VEY V D +CESCSR QANPDQWVA++QLRQHVSHRRTFFYLEQLIL+HDAA Sbjct: 127 AVLEQSYPVEYTVRDNLCESCSRFQANPDQWVASIQLRQHVSHRRTFFYLEQLILRHDAA 186 Query: 561 VRAIRIKQMDRGIDFFFANRSHAVKFVEFIQKVVP 665 RAIRI+Q+D+GIDFFF N+SHA FVEF++KVVP Sbjct: 187 SRAIRIQQVDQGIDFFFGNKSHANSFVEFLRKVVP 221 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,783,748 Number of Sequences: 27288 Number of extensions: 311312 Number of successful extensions: 959 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 932 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 959 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB39D10.yg.ab1 (732 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g21350.1 hypothetical protein / contains similarity to RNA... 327 4e-90 >At3g21350.1 hypothetical protein / contains similarity to RNA polymerase transcriptional regulation mediator GB:AAC26869 from [Homo sapiens]; supported by cDNA: gi_20258922 Length = 257 Score = 327 bits (838), Expect = 4e-90 Identities = 164/244 (67%), Positives = 188/244 (76%), Gaps = 9/244 (3%) Frame = +1 Query: 1 GNAAAAPPTP----GTDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDYTCNNEQLRM 168 GNAA P P GTDMTGI FRDQLW+N+YPLDRN +FDYFALSPFYD TCNNE LR Sbjct: 16 GNAADQIPPPLQPPGTDMTGISFRDQLWINSYPLDRNYIFDYFALSPFYDTTCNNEILRR 75 Query: 169 RSIHPLDISHLSKMTGIEFMVSEVMEPHLFVMRKQKRDGPEKVTPMLTYYVLDGSIYQAP 348 RSIHPLD+SHLSKMTG+E+M+++ EP+LFV RKQKRDGPEKVTPMLTYY+LDGSIYQAP Sbjct: 76 RSIHPLDLSHLSKMTGLEYMLTDATEPNLFVFRKQKRDGPEKVTPMLTYYILDGSIYQAP 135 Query: 349 QLCNVFSARVGRALYYISKAFTTAASKLEKVGYVDTEDDSTSHEPKAAKETIDFKEVKRV 528 QLC+VF+ARV R +Y ISKAFT AASKLE + VDTE+ + E K A ET+D KE+KRV Sbjct: 136 QLCSVFAARVSRTIYNISKAFTDAASKLETIRQVDTENQNEPAESKPASETVDLKEMKRV 195 Query: 529 DHTLASLQRKLPAAPPPPPFPEGYTPPSTAE-----GEQGPETEQADPSVDPILDQGPAK 693 D L SL RKL PPPPPFPEGY G QG E++ P VDPI+DQGPAK Sbjct: 196 DVILTSLYRKLAPPPPPPPFPEGYVSQEALGEKEELGTQGGESQ--PPQVDPIIDQGPAK 253 Query: 694 RLKY 705 R+K+ Sbjct: 254 RMKF 257 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,075,710 Number of Sequences: 27288 Number of extensions: 403617 Number of successful extensions: 4676 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3762 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1294970360 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB39G16.yg.ab1 (541 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63220.1 putative protein / similar to unknown protein (re... 147 3e-36 >At5g63220.1 putative protein / similar to unknown protein (ref|NP_057033.1) Length = 316 Score = 147 bits (372), Expect = 3e-36 Identities = 69/108 (63%), Positives = 93/108 (85%) Frame = +1 Query: 7 MAVARAVLMYLSVGNLRDANNIMDGIEKLAEVKGLEFPDSELMRFINYLLQTLMRDALPL 186 +A+ARAVLMYLS+GN++DAN +MD I+K AE K E +S+L++FI+YLL+TL RDALPL Sbjct: 208 LAIARAVLMYLSMGNMKDANFMMDEIKKQAETKNPELSESDLIQFISYLLETLQRDALPL 267 Query: 187 FNTLKQKFSSSIERDPMFNELLEDIGEKFYGVRRKNPLQGMFGELFKM 330 FN L+ K+ SSI+RD + NELL++I E+FYGV+RKNPLQGMFG++FK+ Sbjct: 268 FNMLRVKYKSSIDRDQLLNELLDEIAERFYGVQRKNPLQGMFGDIFKV 315 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,669,115 Number of Sequences: 27288 Number of extensions: 212732 Number of successful extensions: 477 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 772177832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB39I14.yg.ab1 (683 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g03560.1 putative calcium channel / ; supported by cDNA: g... 306 7e-84 >At4g03560.1 putative calcium channel / ; supported by cDNA: gi_13786068_gb_AF360372.1_AF360372 Length = 733 Score = 306 bits (784), Expect = 7e-84 Identities = 146/202 (72%), Positives = 174/202 (85%), Gaps = 2/202 (0%) Frame = +2 Query: 32 TFISNGEWIRYLLIARMLRLIRLLMHVQRYRAFVATFLTLIPSLMPYLGTVFCVMCIYCT 211 TF SNGEWIRYLL+ARMLRLIRLLM+VQRYRAF+ATF+TLIPSLMPYLGT+FCV+CIYC+ Sbjct: 522 TFFSNGEWIRYLLLARMLRLIRLLMNVQRYRAFIATFITLIPSLMPYLGTIFCVLCIYCS 581 Query: 212 LGIQIFGGIVNAGNPDLPATDLADSDYLLFNFNDFPNGMVTLFNLLVMGNWQIWMQDYVA 391 +G+Q+FGG+VNAGN L T+LA+ DYLLFNFND+PNGMVTLFNLLVMGNWQ+WM+ Y Sbjct: 582 IGVQVFGGLVNAGNKKLFETELAEDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWMESYKD 641 Query: 392 LTGTSWTYAYFVSFYLITVLFLLNLIVAFVLEAFFAELELECPEEEEGKKIGVR--GRRN 565 LTGT W+ YFVSFY+IT+L LLNL+VAFVLEAFF EL+LE E+ +G+ + RR+ Sbjct: 642 LTGTWWSITYFVSFYVITILLLLNLVVAFVLEAFFTELDLEEEEKCQGQDSQEKRNRRRS 701 Query: 566 MGTKTRSQRVDMLLHHMLSSEL 631 G+K+RSQRVD LLHHML EL Sbjct: 702 AGSKSRSQRVDTLLHHMLGDEL 723 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,947,968 Number of Sequences: 27288 Number of extensions: 362742 Number of successful extensions: 1210 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1097 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1201 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1165500188 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB39J02.yg.ab1 (637 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g04390.1 hypothetical protein / predicted by genscan 199 1e-51 >At1g04390.1 hypothetical protein / predicted by genscan Length = 849 Score = 199 bits (506), Expect = 1e-51 Identities = 91/212 (42%), Positives = 138/212 (64%), Gaps = 1/212 (0%) Frame = +1 Query: 4 ALLKLLEYVYSGHLTATDDLVKRLKTLAKHCNLQPLLQTLCRNRPKWRTPFPTFDLTSAL 183 AL+KLLE+ YSG++ +K+LK LAKHC + LLQ LCR RPKW + P D+ AL Sbjct: 588 ALVKLLEFAYSGYVEVESTTLKKLKPLAKHCKAKVLLQMLCRRRPKWGSSIPEIDIPLAL 647 Query: 184 GPNGFCFSDIVLEAKGNAFENWKCESCALSQPHLHAHKAILCASSDHMRALLCSGMQESQ 363 P FSD++L K + C C+L+ PH H+H+ IL + +++RAL SGMQES Sbjct: 648 TPKLIHFSDVILVPKETNVACFNCRMCSLTSPHAHSHRVILSSGCEYLRALFRSGMQESH 707 Query: 364 SETIKIDLGWNALVRLVNWLYSGKLVPKPKYSCLWNNLDEQGKLEQVTPYVELYCLSDSW 543 + + + + W L +LV+W YS +L PKP C WNN+D + KL+++ YVE+Y LS+ W Sbjct: 708 LDRLNVPVSWLGLTKLVSWFYSDEL-PKPPSGCKWNNMDTEAKLDELQAYVEIYSLSEWW 766 Query: 544 LLEDLHKECSKVIVNCLDSV-NMAVKLIQIGA 636 ++E+L +C+ VI++CL+S +++K I++ A Sbjct: 767 IMEELQNDCAHVILSCLESARELSIKTIELAA 798 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,395,030 Number of Sequences: 27288 Number of extensions: 282030 Number of successful extensions: 1005 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 966 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1002 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB39J24.yg.ab1 (715 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58020.1 putative protein / protein x 0001, Homo sapiens, ... 272 1e-73 At5g55020.1 putative protein / contains similarity to MYB-rel... 50 2e-06 >At5g58020.1 putative protein / protein x 0001, Homo sapiens, EMBL:AF117231 Length = 354 Score = 272 bits (695), Expect = 1e-73 Identities = 130/188 (69%), Positives = 154/188 (81%), Gaps = 3/188 (1%) Frame = +2 Query: 2 AESRDCYLNMYADKKPDKVDPNEQRLSKWLNCALSNEPLKRPIVVDYLGNVFNKQALVEA 181 AESRDCYLNMYA+KKPDKVDPNEQRLSKWLNCALSNEPL P V+D LGN+FNK+ LV A Sbjct: 93 AESRDCYLNMYAEKKPDKVDPNEQRLSKWLNCALSNEPLAEPCVIDLLGNLFNKEVLVHA 152 Query: 182 LLKKNVPKAFGYIKGLKDMISVELESIPGTEGADSD---VKFQCPVTGLEFNGKYKFYAL 352 LL K +PK F YIKGLKDM++++L + G++G+ D +FQCPV+GLEFNGKYKF+AL Sbjct: 153 LLSKRLPKQFSYIKGLKDMVNIKLTPVAGSDGSSQDTTSAQFQCPVSGLEFNGKYKFFAL 212 Query: 353 KSCGHVLSAKALKEIKSSSCHVCRKEFAEADKIVINGNEEEVIALREKMEIEKLKVREKK 532 + CGHV+SAKALKE+KSSSC VC + ++DKIVING EEEV LRE+ME EK K+REKK Sbjct: 213 RGCGHVMSAKALKEVKSSSCLVCHADVKDSDKIVINGTEEEVDLLRERMEEEKAKLREKK 272 Query: 533 AKVKKVKN 556 KK KN Sbjct: 273 GVSKKSKN 280 >At5g55020.1 putative protein / contains similarity to MYB-related transcription factor; supported by cDNA: gi_14161418_gb_AF371979.1_AF371979 Length = 523 Score = 49.7 bits (117), Expect = 2e-06 Identities = 65/243 (26%), Positives = 95/243 (38%), Gaps = 37/243 (15%) Frame = -3 Query: 689 LIRLNLPRHFRSLHVNLTLRPNNPETHSPQHPNHHHH---QHSHSRSHF*LSSPSPSSLS 519 L+R LP + + N L P+ QH +HHHH Q H + +F P S Sbjct: 129 LLRQGLPLYPPDIIPNHQLHPHPHHQQQQQHNHHHHHHQQQQQHQQMYF-----QPQSSQ 183 Query: 518 LSTFRSPSSPAMRSPLPHSH*SQS------------YPL-PQTPYDTHDNSTT*SPSTLS 378 +T PSS + SP P + S S +PL P TP S+T P LS Sbjct: 184 RNT---PSSSPLPSPTPANAKSSSSFTFHTTTANLLHPLSPHTPNTPSQLSSTPPPPPLS 240 Query: 377 HSTRARSSSTRKTYTSH*TPTR*PDTETS------HPNPLLQFPVSIQAQPISYPSTPLY 216 + ++ T P + + P PLLQ P S+ A+ + +TPL Sbjct: 241 SPLCSPRNNQYPTLPLFALPRSQINNNNNGNFTFPRPPPLLQPPSSLFAKRYNNANTPLN 300 Query: 215 ------------TQTLSAHSSSTMPQPTPVY*T---HSLNNQPQSAASTARSTTHNSTIS 81 S S T+P P+P T H+ NN S+ S + + + +S + Sbjct: 301 CINRVSTAPFSPVSRDSYTSFLTLPYPSPTAQTATYHNTNNPYSSSPSFSLNPSSSSYPT 360 Query: 80 ITS 72 TS Sbjct: 361 STS 363 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,355,877 Number of Sequences: 27288 Number of extensions: 408917 Number of successful extensions: 3262 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 2280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2892 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1254469668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB39O14.yg.ab1 (625 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g28460.1 unknown protein / ; supported by cDNA: gi_18389225 200 4e-52 >At3g28460.1 unknown protein / ; supported by cDNA: gi_18389225 Length = 314 Score = 200 bits (509), Expect = 4e-52 Identities = 98/140 (70%), Positives = 114/140 (81%), Gaps = 5/140 (3%) Frame = +1 Query: 1 GLMACSRGCSEAHFVEMDPWVVSDVLRPNLEWTGFLDNSVIHTVRVETFLERT-----KG 165 G+ A SRGCSEAHFVEMDPWVVS+VL+PNLE TGF+D SVIHT RVE FLER K Sbjct: 175 GIEAISRGCSEAHFVEMDPWVVSNVLQPNLEHTGFVDASVIHTARVENFLERADKLVGKD 234 Query: 166 DPFDYISVTPPYMLVDYEILMKQISESAVIGDDSFIVVEYPFRTDMHETCGCLVKLADRR 345 FDYISVTPPYM VDYE+LM QI++S IG+++FI+VEYP RT M ++CGCL K+ DRR Sbjct: 235 GVFDYISVTPPYMEVDYEVLMDQIAKSPAIGENTFILVEYPSRTTMLDSCGCLEKMTDRR 294 Query: 346 FGRTNLAIYGPKWAQKKGRS 405 FGRT+LAIYGPKWAQK +S Sbjct: 295 FGRTHLAIYGPKWAQKPRKS 314 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,005,768 Number of Sequences: 27288 Number of extensions: 343605 Number of successful extensions: 865 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 863 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 999514432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB3d07.yg.ab1 (649 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g22940.1 phosphomethylpyrimidine kinase / probable thiamin... 283 1e-80 >At1g22940.1 phosphomethylpyrimidine kinase / probable thiamin biosynthetic enzyme, location of EST gb|AA395737, gb|T21651 Length = 525 Score = 283 bits (723), Expect(2) = 1e-80 Identities = 141/191 (73%), Positives = 157/191 (81%), Gaps = 1/191 (0%) Frame = +1 Query: 4 QGPFDHMFKLKRK-NSSKLRLFEPSDLFLYAVTDSGMNKKWGHSITDAVKVFIEGGATIV 180 QGPFDH F LK+ SS+ +F P DLFLYAVTDS MNKKW SI DA+K IEGGATI+ Sbjct: 293 QGPFDHFFGLKKDPQSSRCSIFNPDDLFLYAVTDSRMNKKWNRSIVDALKAAIEGGATII 352 Query: 181 QLREKDAETGEFLEAAKSCLEICRAHNIPLLINDRVDIALACDADGVHVGQSDMPVNTVR 360 QLR FLE AK+C++ICR+H + LLINDR+DIALACDADGVHVGQSDMPV+ VR Sbjct: 353 QLR-----FDHFLEEAKACIDICRSHGVSLLINDRIDIALACDADGVHVGQSDMPVDLVR 407 Query: 361 ALLGPEKIIGVSCKTPEHALKAWADGADYIGSGGVFPTNTKANNRTIGLDGLKTVCLALK 540 +LLGP+KIIGVSCKTPE A +AW DGADYIGSGGVFPTNTKANNRTIGLDGLK VC A K Sbjct: 408 SLLGPDKIIGVSCKTPEQAHQAWKDGADYIGSGGVFPTNTKANNRTIGLDGLKEVCEASK 467 Query: 541 LPVVAIGGINL 573 LPVVAIGGI + Sbjct: 468 LPVVAIGGIGI 478 Score = 35.0 bits (79), Expect(2) = 1e-80 Identities = 17/24 (70%), Positives = 20/24 (82%) Frame = +3 Query: 576 NARSVMELGVVNLEGVAVVSALFD 647 NA SVM++ NL+GVAVVSALFD Sbjct: 480 NAGSVMQIDAPNLKGVAVVSALFD 503 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,554,529 Number of Sequences: 27288 Number of extensions: 370559 Number of successful extensions: 865 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 830 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1070908320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB41H12.yg.ab1 (692 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g50380.1 putative protein / hypothetical protein KIAA0453 ... 262 1e-70 >At3g50380.1 putative protein / hypothetical protein KIAA0453 (fragment), Homo sapiens, PIR:T00067 Length = 3071 Score = 262 bits (669), Expect = 1e-70 Identities = 137/232 (59%), Positives = 171/232 (73%), Gaps = 13/232 (5%) Frame = +2 Query: 20 VAGGFQQGILKLAMEPSVLGSAFTEGGPDRKIKLDRNPGVDELYIEGYLQAMLDTMYKHE 199 + GF GILKLAMEPSV+G+A EGGPDR IKLDRNPG+DELYIEGYLQAMLDTMY+ E Sbjct: 2837 LVSGFHHGILKLAMEPSVIGTALMEGGPDRTIKLDRNPGIDELYIEGYLQAMLDTMYRQE 2896 Query: 200 YLRVRVIDDQVVLKNMPPNSVLIDEIMDHVKGFLVSKGLLTGE-TSSYSLRHLRVQNEWR 376 YLRV+VIDDQV LKN+PP++ LIDE++D VK FL S+GLL G+ +SS R L EW+ Sbjct: 2897 YLRVKVIDDQVFLKNLPPSNSLIDEMIDRVKDFLESRGLLKGDPSSSRPRRRLHGDKEWK 2956 Query: 377 IVPTVLTLCEHLFVNFAIGWLRKQAGDLSSKIK------WDDKFKVGAKKAI------TK 520 I PTVLTLCEHLFV+FAI L++ A + ++ + G+ A+ K Sbjct: 2957 IGPTVLTLCEHLFVSFAIRILKQHATKAITSLRPKKEEAEAETSDSGSNTAMVPVVSDNK 3016 Query: 521 QETRVSVWKWGVGRFVFAGIVAYVDGRLCRSIPNPVARRIVSGFVLSFLDRT 676 ++ +WK G+G FV +GIVAY+DGRLCR IPNP+ARRIVSGF+LSFLD++ Sbjct: 3017 KKKMKFMWKAGIGNFVASGIVAYIDGRLCRQIPNPIARRIVSGFLLSFLDKS 3068 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,361,245 Number of Sequences: 27288 Number of extensions: 377767 Number of successful extensions: 1006 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 978 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1002 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1192191032 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB41L05.yg.ab1 (506 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24690.1 putative protein / ; supported by cDNA: gi_17065... 124 2e-29 >At4g24690.1 putative protein / ; supported by cDNA: gi_17065501 Length = 704 Score = 124 bits (312), Expect = 2e-29 Identities = 57/81 (70%), Positives = 70/81 (86%) Frame = +1 Query: 7 LVKELEEMGFKQLDLNTEVLRMNDYELEKSIDDLCGVLEWDPMLDELQEMGFADTEANRR 186 ++KELEEMGFK++DLN E+LR N+Y LE+S+D LCGV EWDP+L+ELQEMGF D N+R Sbjct: 622 MLKELEEMGFKEIDLNKEILRDNEYNLEQSVDALCGVSEWDPILEELQEMGFCDDVTNKR 681 Query: 187 LLKKNNGSIKRVVMDLINGER 249 LLKKNNGSIK VVMDL+ GE+ Sbjct: 682 LLKKNNGSIKGVVMDLLTGEK 702 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,839,103 Number of Sequences: 27288 Number of extensions: 308045 Number of successful extensions: 1171 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1066 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1156 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 684463600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB42A09.yg.ab1 (423 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g34050.1 expressed protein / ;supported by full-length cDN... 154 2e-38 >At2g34050.1 expressed protein / ;supported by full-length cDNA: Ceres:23892. Length = 248 Score = 154 bits (389), Expect = 2e-38 Identities = 71/93 (76%), Positives = 83/93 (88%) Frame = +1 Query: 22 TGLEDYKARGTQAAPYFTVSHYKEFAETKDLVLIRGDIVFASKLTDSEAKWLLETAQSFY 201 TGLEDYKARGTQAAPY T + Y E +ETKDLV IRGD+VF SKLTD EAKW++ETAQSFY Sbjct: 156 TGLEDYKARGTQAAPYLTTTFYTELSETKDLVFIRGDVVFTSKLTDEEAKWIMETAQSFY 215 Query: 202 LNDTRYKLVERFNKKTSEFDFKDVLRALDMPMM 300 LND+RYKL+ERFNK T +F+FKDVL+ALDMP++ Sbjct: 216 LNDSRYKLLERFNKHTHDFEFKDVLQALDMPLL 248 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,509,387 Number of Sequences: 27288 Number of extensions: 162649 Number of successful extensions: 387 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 382 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 387 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 463486164 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB42C02.yg.ab1 (449 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02100.1 hypothetical protein / predicted by genscan; supp... 95 2e-20 >At1g02100.1 hypothetical protein / predicted by genscan; supported by cDNA: gi_18377693 Length = 332 Score = 94.7 bits (234), Expect = 2e-20 Identities = 42/68 (61%), Positives = 56/68 (81%) Frame = +3 Query: 3 MLKIYTSFIEPQERQRIERVELFDEFEEWYMMQEHYCVACAINDAMGMFENFGFPKDQPV 182 MLK+Y SF++ QE++RIER+ELFDEFEEW+MMQEHYCV A+NDAMG+F +FGF ++ Sbjct: 263 MLKVYGSFVDTQEKRRIERLELFDEFEEWHMMQEHYCVTYAVNDAMGIFGDFGFTREGGG 322 Query: 183 TGASTTAS 206 S++AS Sbjct: 323 ERMSSSAS 330 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,298,135 Number of Sequences: 27288 Number of extensions: 222039 Number of successful extensions: 549 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 549 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 534579884 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB42D13.yg.ab1 (678 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66130.1 AtRAD17 (dbj|BAA90479.1) / ; supported by cDNA: ... 247 4e-66 >At5g66130.1 AtRAD17 (dbj|BAA90479.1) / ; supported by cDNA: gi_6855471_dbj_AB030250.1_AB030250 Length = 599 Score = 247 bits (631), Expect = 4e-66 Identities = 130/242 (53%), Positives = 164/242 (67%), Gaps = 16/242 (6%) Frame = +1 Query: 1 ACKVTFNPITVNSMAKTLSKICRVEKVRVTADQIDVIAKASGGDIRHAVTSMQYLCLKSG 180 A KV FNPIT NS+ K L +ICR E +VT +ID +A ASGGDIRHA+TS+Q +K Sbjct: 282 ALKVAFNPITKNSIKKVLQRICREEHCKVTTMEIDQMATASGGDIRHAITSLQLFSVKPE 341 Query: 181 -----------SIEKGPHKIDY-----LEDGCSLPFGRDETLSLFHALGKFLHNKRDTEN 312 +E H + L+ G S FGRDETLSLFHALGKFLHNKR+T+N Sbjct: 342 LNHTKIKSPRPGMEDNYHGNEQTMYSGLDSGISSCFGRDETLSLFHALGKFLHNKRETDN 401 Query: 313 STASDADSLLIKEDFARLPMKMDAPERVLGQAHGQARPIADFLQENVLDFVHEEAMDDAW 492 S+ S L+ ++FARLP+KMDAPE+VL QAHGQA + DFL ENVLDFV + A++DAW Sbjct: 402 VIISECSSSLVHDEFARLPLKMDAPEKVLSQAHGQAGRVVDFLHENVLDFVSDGAIEDAW 461 Query: 493 MATSYLSDADTLLASLSGAQYRNYVAENIIQSTAASVAVRGVMFGNRHPLSARWHAIRRP 672 +SYL+DAD LLA + G + E++ QS ASVAVRGV++GN+ P S+RWH IR+P Sbjct: 462 CVSSYLADADLLLADIRGKMSGHNNTEDVPQSAGASVAVRGVLYGNKQPCSSRWHVIRKP 521 Query: 673 TL 678 L Sbjct: 522 KL 523 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,571,220 Number of Sequences: 27288 Number of extensions: 343990 Number of successful extensions: 861 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 860 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1147706292 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB42E09.yg.ab1 (491 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g37990.1 expressed protein / ;supported by full-length cD... 145 1e-35 >At2g37990.1 expressed protein / ;supported by full-length cDNA: Ceres:40538. Length = 318 Score = 145 bits (366), Expect = 1e-35 Identities = 73/130 (56%), Positives = 95/130 (72%) Frame = +3 Query: 15 PITGTQAAPRKVSKDELQNVAGMAATSTASGGKFDKKLAGEKPPKHDKKYRKFLPVVEGS 194 PI+GT+A P+K+ KDEL +VAG+AATSTASGGKFDKKL GEKPPK K+ K+LPVV G Sbjct: 194 PISGTKAQPKKIGKDELGDVAGLAATSTASGGKFDKKLPGEKPPKKQGKHHKYLPVVSGR 253 Query: 195 GMGSLEKQQSDKILNKLMAKNSHEIFNVGKAVDMYNAKSDKKRRNQQGKSSSTSSKLKVK 374 G + EK+Q++ +L+K+ +K+SHEI NVGKA++MYN K +KK+ S S KLK K Sbjct: 254 GDVNAEKEQTNNVLSKIFSKHSHEILNVGKAINMYNVKKEKKK-------SGRSDKLKPK 306 Query: 375 KSPYKNKSTK 404 K K + K Sbjct: 307 KDITKKPANK 316 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,138,422 Number of Sequences: 27288 Number of extensions: 251122 Number of successful extensions: 919 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 861 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 911 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 639433100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB42E14.yg.ab1 (738 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g64250.1 2-nitropropane dioxygenase-like protein / ;suppo... 337 4e-93 >At5g64250.1 2-nitropropane dioxygenase-like protein / ;supported by full-length cDNA: Ceres:207555. Length = 293 Score = 337 bits (864), Expect = 4e-93 Identities = 162/215 (75%), Positives = 189/215 (87%) Frame = +1 Query: 1 VKVVPQIGSIEEAKHAADAGVDAIIVQGHEAGGHVIGQEALTALVPRVVDLVGSKGIPVI 180 VKV+PQ+G++EEA+ A GVDAIIVQG EAGGHVIG++ L +L+PRVVDLVG + IPVI Sbjct: 69 VKVIPQVGNVEEARKAVAVGVDAIIVQGREAGGHVIGKDGLFSLLPRVVDLVGERDIPVI 128 Query: 181 AAGGIVDERGYVAALALGAQGVCLGTRFLATEESYAHPEYKKKLVEMSETEYTNVYGRAR 360 AAGGIVD RGYVAAL+LGAQGVCLGTRF+AT ESYAHP YK+KL+E +TEYT+V+GRAR Sbjct: 129 AAGGIVDGRGYVAALSLGAQGVCLGTRFVATHESYAHPIYKRKLIEYEKTEYTDVFGRAR 188 Query: 361 WPGAPQRVLKTPFFLEWRNLPNHENEANQPVIGRSTIHGMEKEIRRFAGTVPNKTTTGDI 540 WPGAPQRVL+TPFF +WR+LP HENE NQP+IGRSTIHG+EKEIRRF+GTVPN TTTGD+ Sbjct: 189 WPGAPQRVLETPFFDDWRSLPAHENEVNQPIIGRSTIHGVEKEIRRFSGTVPNMTTTGDL 248 Query: 541 ENMVMYASEGVGLINEILPAAQVVKRLVEGAQTLI 645 E+M MYA + VGLI EILPA +VVK LVE AQ LI Sbjct: 249 ESMAMYAGQSVGLIKEILPAGEVVKSLVEEAQALI 283 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,848,723 Number of Sequences: 27288 Number of extensions: 391790 Number of successful extensions: 1202 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1199 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1312709680 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB42I02.yg.ab1 (755 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g40740.1 putative protein / ; supported by cDNA: gi_14532... 216 1e-56 At3g17840.1 leucine-rich repeat transmembrane protein kinase, pu... 59 2e-09 At1g48480.1 leucine-rich repeat transmembrane protein kinase, pu... 58 6e-09 At5g16590.1 leucine-rich repeat transmembrane protein kinase, pu... 49 2e-06 At3g02880.1 leucine-rich repeat transmembrane protein kinase, pu... 49 3e-06 At1g62763.1 hypothetical protein / 49 4e-06 At4g34440.1 putative serine threonine protein kinase / Daucus... 49 4e-06 At1g26150.1 Pto kinase interactor, putative / similar to Pto ... 47 8e-06 >At5g40740.1 putative protein / ; supported by cDNA: gi_14532693_gb_AY039971.1_ Length = 741 Score = 216 bits (550), Expect = 1e-56 Identities = 112/136 (82%), Positives = 119/136 (87%), Gaps = 5/136 (3%) Frame = +2 Query: 266 MTMDREKERETELESAMYTNCLLLGLDPSIIN-GANNGAPRVGNFRHSNPKLGEQLLYFI 442 MTMDREKERE ELESAMYTNCLLLGLDP++I GA+NG PRVG FRHSNPKLGEQLLYFI Sbjct: 1 MTMDREKERELELESAMYTNCLLLGLDPNVIGLGASNGTPRVGLFRHSNPKLGEQLLYFI 60 Query: 443 LSSLRGP----KDFDKVWPIFDSTQSRDFRKVVQSIISELESQGALPRSNSRVSSLATCC 610 LSSLRGP KDFDKVWPIFDS QSRDFRKVVQ+IISELESQGALPRSNSRVSSLATCC Sbjct: 61 LSSLRGPAQSSKDFDKVWPIFDSAQSRDFRKVVQAIISELESQGALPRSNSRVSSLATCC 120 Query: 611 GPRLVSIWIRL*IQML 658 GPR V + +L + L Sbjct: 121 GPRFVELLWQLSLHAL 136 >At3g17840.1 leucine-rich repeat transmembrane protein kinase, putative / similar to receptor kinase GB:AAA33715 from [Petunia integrifolia];supported by full-length cDNA: Ceres:22221. Length = 647 Score = 59.3 bits (142), Expect = 2e-09 Identities = 32/66 (48%), Positives = 44/66 (66%) Frame = -3 Query: 216 YTISVSFSLYIYSFLSLSLSLSTLISTTTSDLAADRSAILSIRSAVGGRSILWNISQPAT 37 +T S+S +S L LSL L ++ DLAAD+SA+LS RSAVGGR++LW++ Q + Sbjct: 5 FTPSMSNLSIFFSILLLSLPLPSI-----GDLAADKSALLSFRSAVGGRTLLWDVKQ-TS 58 Query: 36 PCTWPG 19 PC W G Sbjct: 59 PCNWTG 64 >At1g48480.1 leucine-rich repeat transmembrane protein kinase, putative / contains similarity to many predicted protein kinases; supported by cDNA: gi_13430527_gb_AF360176.1_AF360176 Length = 655 Score = 57.8 bits (138), Expect = 6e-09 Identities = 29/52 (55%), Positives = 37/52 (70%) Frame = -3 Query: 168 LSLSLSTLISTTTSDLAADRSAILSIRSAVGGRSILWNISQPATPCTWPGYR 13 LSL L +L +T DL ADR+A+LS+RSAVGGR+ WNI Q +PC W G + Sbjct: 18 LSLLLLSLPLPSTQDLNADRTALLSLRSAVGGRTFRWNIKQ-TSPCNWAGVK 68 >At5g16590.1 leucine-rich repeat transmembrane protein kinase, putative / Length = 625 Score = 49.3 bits (116), Expect = 2e-06 Identities = 21/40 (52%), Positives = 29/40 (72%) Frame = -3 Query: 138 TTTSDLAADRSAILSIRSAVGGRSILWNISQPATPCTWPG 19 + TSDL ADR A++++R V GR +LWN++ P PCTW G Sbjct: 20 SVTSDLEADRRALIALRDGVHGRPLLWNLTAP--PCTWGG 57 >At3g02880.1 leucine-rich repeat transmembrane protein kinase, putative / contains Pfam profiles: PF00069 Eukaryotic protein kinase domain, PF00560 Leucine Rich Repeat (5 copies); supported by cDNA: gi_13937227_gb_AF372969.1_AF372969 Length = 627 Score = 48.9 bits (115), Expect = 3e-06 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 4/54 (7%) Frame = -3 Query: 168 LSLSLSTL----ISTTTSDLAADRSAILSIRSAVGGRSILWNISQPATPCTWPG 19 LSLS+ L ++ TSDL +DR A+L++R++V GR +LWN+S ++PC W G Sbjct: 7 LSLSVVFLFVFYLAAVTSDLESDRRALLAVRNSVRGRPLLWNMS-ASSPCNWHG 59 >At1g62763.1 hypothetical protein / Length = 312 Score = 48.5 bits (114), Expect = 4e-06 Identities = 29/59 (49%), Positives = 39/59 (65%), Gaps = 3/59 (5%) Frame = -1 Query: 188 TSTAFSLSLSLSPPSSLPQPPTSPPTD-PPS--SPSAPPWVAAPSSGTSPNPPPPAHGP 21 T+++ SLS S S PS P PP+S P+ PPS SPS+PP ++ S +SP PPPP+ P Sbjct: 21 TTSSSSLSPSSSSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSL--SPSSPPPPPPSSSP 77 >At4g34440.1 putative serine threonine protein kinase / Daucus carota somatic embryogenesis receptor-like kinase Length = 674 Score = 48.5 bits (114), Expect = 4e-06 Identities = 26/47 (55%), Positives = 28/47 (59%) Frame = -1 Query: 170 LSLSLSPPSSLPQPPTSPPTDPPSSPSAPPWVAAPSSGTSPNPPPPA 30 +S S SPP + P TSPPT P SSP P VA PS T NP PPA Sbjct: 51 ISASFSPPPAPPTQETSPPTSPSSSP---PVVANPSPQTPENPSPPA 94 >At1g26150.1 Pto kinase interactor, putative / similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 47.4 bits (111), Expect = 8e-06 Identities = 25/65 (38%), Positives = 32/65 (48%), Gaps = 17/65 (26%) Frame = -1 Query: 164 LSLSPPSSLPQPPT-------------SPPTDPPSSPSAPPWVAAPSSGTSPNPP----P 36 +S PP S P PP SPPT+PP P +PP + AP ++P PP P Sbjct: 115 VSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVP 174 Query: 35 PAHGP 21 P+H P Sbjct: 175 PSHSP 179 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,652,805 Number of Sequences: 27288 Number of extensions: 501503 Number of successful extensions: 13620 Number of sequences better than 1.0e-05: 16 Number of HSP's better than 0.0 without gapping: 3036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8345 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB42I06.yg.ab1 (636 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g51050.1 putative protein / hypothetical protein L1648.04 ... 335 1e-92 >At3g51050.1 putative protein / hypothetical protein L1648.04 - Leishmania major, EMBL:LMFL1648; supported by cDNA: gi_18087607 Length = 698 Score = 335 bits (859), Expect = 1e-92 Identities = 157/213 (73%), Positives = 187/213 (87%), Gaps = 1/213 (0%) Frame = +1 Query: 1 GGNGAEQTVVSGSMEVLKPCWAVATSGVPVREQLFNGSICHRSHFNFIPHG-EYSRTFGR 177 GGN E+TVVSGSMEVLKPCWAVATSGVP+REQLFN SICH S FNF+ +G +YSR F + Sbjct: 443 GGNVGERTVVSGSMEVLKPCWAVATSGVPIREQLFNVSICHHSPFNFLHYGGDYSRHFAQ 502 Query: 178 AVDVSSLEVATPILIPTNDGHKHRKGSHGDIVFLTNRGEVTAYSPGLHGHEAVWQWQLLT 357 A D S+LE+ATPILIP +DGHKHRKGSHGD++FLTNRGEVT+Y+P +HGH+AVWQWQL T Sbjct: 503 ARDTSTLEIATPILIPRDDGHKHRKGSHGDVIFLTNRGEVTSYTPDVHGHDAVWQWQLQT 562 Query: 358 GATWSNLPSPAGMMDAGYVIPSLKPFNLRMHDNQHLILAAGDQEAVVISAGGSQLTSIDL 537 ATWSNLPSP+G+ ++G V+P+LKPF+LR+HDNQ +ILA GDQ AV+IS GGS L SI+L Sbjct: 563 EATWSNLPSPSGLTESGTVVPTLKPFSLRIHDNQPMILAGGDQAAVIISPGGSILASIEL 622 Query: 538 PAPPTHALVDADFSNDGLTDLIVVTSNGVYGFV 636 P+ PTHAL+ DFSNDGLTD+IV+TSNGVYGFV Sbjct: 623 PSQPTHALITDDFSNDGLTDVIVMTSNGVYGFV 655 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,964,261 Number of Sequences: 27288 Number of extensions: 335382 Number of successful extensions: 818 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB42L07.yg.ab1 (349 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05570.1 putative protein / similar to unknown protein (pi... 71 9e-14 >At5g05570.1 putative protein / similar to unknown protein (pir||T04661) Length = 1124 Score = 71.2 bits (173), Expect = 9e-14 Identities = 32/57 (56%), Positives = 43/57 (75%) Frame = +2 Query: 5 GDTAAVALEAKDKLLERQMKLEKLKENSEELASGSENFASLAGELVKQMENRKWWQL 175 G+T+A+A +AKDKL ER KLE++ + + EL +ENFAS+A EL KQME RKWW + Sbjct: 1068 GETSAIASQAKDKLHERGEKLERISQRTAELQDNAENFASMAHELAKQMEKRKWWNI 1124 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,142,909 Number of Sequences: 27288 Number of extensions: 130694 Number of successful extensions: 449 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 449 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 216801312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QHB4d05.yg.ab1 (671 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26800.1 putative hydroxymethylglutaryl-CoA lyase / ; sup... 325 1e-89 At5g23010.1 2-isopropylmalate synthase-like; homocitrate synthas... 60 1e-09 At5g23020.1 2-isopropylmalate synthase-like protein / ; supp... 53 1e-07 >At2g26800.1 putative hydroxymethylglutaryl-CoA lyase / ; supported by cDNA: gi_11935188_gb_AF327420.1_AF327420 Length = 468 Score = 325 bits (834), Expect = 1e-89 Identities = 160/203 (78%), Positives = 182/203 (88%) Frame = +2 Query: 5 KEVAVFAAASESFSRSNINCSIDESLARYRDVTSAARKRSIPVRGYISCVVGCPMEGNVH 184 KEVA+FA+ASESFS SNINC+I+ESL RYR V +AA++ S+PVRGY+SCVVGCP+EG V