BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA10F16.yg.ab1 (408 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g28760.1 hypothetical protein / 115 6e-27 >At3g28760.1 hypothetical protein / Length = 357 Score = 115 bits (289), Expect = 6e-27 Identities = 62/95 (65%), Positives = 75/95 (78%) Frame = +1 Query: 1 VDQSGIQRTAVVGRVKIETRPLIIVDAKVDSHKETSYTILLQNSKTVGLVAPTKGGGNEA 180 VDQ G QRTAVVGRVKIE RPLI+V+AK +ET Y+I+LQN++TV LV P +G Sbjct: 269 VDQKGKQRTAVVGRVKIEKRPLIVVEAK---EEETVYSIILQNAETVALVTPHQG----R 321 Query: 181 TAIPVTSLKVGDEVFVRVQGSARHTGIEIQEFTLE 285 TA+PVTSLK GD+V +R+QG ARHTGIEIQEF +E Sbjct: 322 TAVPVTSLKPGDQVLIRLQGGARHTGIEIQEFIVE 356 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,429,657 Number of Sequences: 27288 Number of extensions: 166341 Number of successful extensions: 431 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 418046344 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA10P22.yg.ab1 (747 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54780.1 thylakoid lumen 18.3 kDa protein / SP:Q9ZVL6;supp... 353 5e-98 >At1g54780.1 thylakoid lumen 18.3 kDa protein / SP:Q9ZVL6;supported by full-length cDNA: Ceres:3853. Length = 285 Score = 353 bits (906), Expect = 5e-98 Identities = 171/205 (83%), Positives = 195/205 (94%) Frame = +1 Query: 1 SAFASEFDVLNDGPPKESYVLDDAGVLSRVTKSDLKNLLSDLEYRKKIRINFVTVRKLTS 180 +A ASEF++LNDGPPKE+YV+DDAGVLSRVTKSDLK LLSDLEYRKK+R+NF+TVRKLTS Sbjct: 81 TALASEFNILNDGPPKETYVVDDAGVLSRVTKSDLKKLLSDLEYRKKLRLNFITVRKLTS 140 Query: 181 KADAFEYADQVLERWYPTLEEGNNKGIVVLVTSQKEGAVSGGPEFIKAVGDTVLDATVSQ 360 KADAFEYADQVLE+WYP++EEGNNKGIVVL+TSQKEGA++GGP FI+AVG+ +LDATVS+ Sbjct: 141 KADAFEYADQVLEKWYPSIEEGNNKGIVVLITSQKEGAITGGPAFIEAVGENILDATVSE 200 Query: 361 NLPVLATDEKYNEAVYSTAKRLVAAIDGLPDPGGPEAKENKRESNFKTKEETAEKRDQFT 540 NLPVLATDEKYNEAVYS+AKRLVAAIDG PDPGGP K++KRESNFKTKEET EKR QF+ Sbjct: 201 NLPVLATDEKYNEAVYSSAKRLVAAIDGQPDPGGPTVKDSKRESNFKTKEETDEKRGQFS 260 Query: 541 LVVGGLLAIAFVVPMAQYYAYVSKK 615 LVVGGLL IAFVVPMAQY+AYVS+K Sbjct: 261 LVVGGLLVIAFVVPMAQYFAYVSRK 285 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,677,186 Number of Sequences: 27288 Number of extensions: 374521 Number of successful extensions: 1174 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1174 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA11B23.yg.ab1 (578 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02760.1 putative histidyl tRNA synthetase / similar to hi... 148 2e-36 >At3g02760.1 putative histidyl tRNA synthetase / similar to histidyl tRNA synthetase GB:NP_032240 [Mus musculus] Length = 479 Score = 148 bits (373), Expect = 2e-36 Identities = 78/141 (55%), Positives = 102/141 (72%), Gaps = 5/141 (3%) Frame = +1 Query: 1 RYDNLIGMFGTKRVAAIGVSLGIERVFTIMEEQQRVENQVIRASETQVLVSVLGDD-VGL 177 RYDNLIGMFGTK+V A+G+SLGIERVF IMEE + QVIR +ETQVLVS++ D+ + Sbjct: 339 RYDNLIGMFGTKQVPAVGMSLGIERVFNIMEELNEKQKQVIRPTETQVLVSIMVDNKLAE 398 Query: 178 ASKLVQMCWDAKVNAEFMANKRLNKHFDRAKEFGIPWMVIVGEREIKEGIVKIKNKEVNI 357 A++LV W AK+NAE++ +KR KHF+RAKE GIPWMV+VGE+E+ V +K E Sbjct: 399 AAELVSQLWGAKINAEYLVSKRKEKHFNRAKESGIPWMVMVGEKELSGSFVTLKKLEKGS 458 Query: 358 EQEVAMT----DFVDELIKLM 408 E++ T FV+EL KL+ Sbjct: 459 EEKEDQTCTRDRFVEELKKLL 479 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,692,277 Number of Sequences: 27288 Number of extensions: 278188 Number of successful extensions: 957 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 956 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 877249352 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA11C01.yg.ab1 (473 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03070.1 expressed protein / ; supported by full-length c... 151 2e-37 >At3g03070.1 expressed protein / ; supported by full-length cDNA: Ceres: 35785. Length = 110 Score = 151 bits (381), Expect = 2e-37 Identities = 70/94 (74%), Positives = 78/94 (82%), Gaps = 6/94 (6%) Frame = +3 Query: 63 SSLRPFS------GVVNSEITTSHTAKWMQDTSKKSPMELINEVPPIKVEGRIAACEGDT 224 SS R FS G+ ++ +HTAKWMQD SKKSPMELI+EVPPIKV+GRI ACEGDT Sbjct: 17 SSRRNFSVATTQLGIPTDDLVGNHTAKWMQDRSKKSPMELISEVPPIKVDGRIVACEGDT 76 Query: 225 NPALGHPIEFICLDKSEPAVCKYCGLRYVQDHHH 326 NPALGHPIEFICLD +EPA+CKYCGLRYVQDHHH Sbjct: 77 NPALGHPIEFICLDLNEPAICKYCGLRYVQDHHH 110 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,399,211 Number of Sequences: 27288 Number of extensions: 255256 Number of successful extensions: 891 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 889 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 596203608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA11G16.yg.ab1 (419 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g08580.1 hypothetical protein / predicted by genscan 62 8e-11 >At1g08580.1 hypothetical protein / predicted by genscan Length = 123 Score = 62.4 bits (150), Expect = 8e-11 Identities = 38/79 (48%), Positives = 53/79 (66%) Frame = +3 Query: 12 RDQKEAVEKGLITMEDIEMAVADGSGTSSQDAIKSRVKFHMKKSVKIKSKRATKKEKKGK 191 R+QK+ VEKGL+TMED+EMA A +S+D+ KS KF +KKS+K+ K KGK Sbjct: 54 REQKDMVEKGLVTMEDVEMASAQ---AASEDSKKSPRKFSVKKSLKL-----NKLNNKGK 105 Query: 192 NKRKSDKPAMEGSSDVMME 248 K+K+ K + E S+D M+E Sbjct: 106 -KKKNQKASGEKSADCMLE 123 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,937,066 Number of Sequences: 27288 Number of extensions: 181755 Number of successful extensions: 630 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 454398200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA11M10.yg.ab1 (635 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g65660.1 expressed protein / ;supported by full-length cD... 145 2e-35 >At5g65660.1 expressed protein / ;supported by full-length cDNA: Ceres:25419. Length = 136 Score = 145 bits (366), Expect = 2e-35 Identities = 75/133 (56%), Positives = 91/133 (68%) Frame = +2 Query: 173 MESPTYYPPPPPLHHSDSSRPTLGFPLGTALLLIVIFSLSGIFSCCYHWDKLRHLRGSFT 352 ME+ + PP H D+SRP+LGFPLGTALLLI+IFSLSGIFSCCYHWDK R LR S Sbjct: 1 MENTQDFSPP----HMDASRPSLGFPLGTALLLIIIFSLSGIFSCCYHWDKHRSLRRSLA 56 Query: 353 DAAADDDNDHVHSPSKPKPTFSEKLQNENQSLPVVMPGDRIARFIALPCPCEPEREEKIV 532 + D + +P KPKP F E + +N S+PV+MPGD +FIALPCPC P R EK+ Sbjct: 57 NGRPSADIE--SNPYKPKPPFPEMKKPQNLSVPVLMPGDNTPKFIALPCPCAPPRPEKLT 114 Query: 533 VEEVQKTPKPPHV 571 V +VQ P+ P V Sbjct: 115 V-DVQTPPQSPPV 126 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,022,827 Number of Sequences: 27288 Number of extensions: 373365 Number of successful extensions: 2485 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2410 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA11O04.yg.ab1 (420 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02850.1 putative protein / 102 6e-23 >At5g02850.1 putative protein / Length = 426 Score = 102 bits (255), Expect = 6e-23 Identities = 58/92 (63%), Positives = 65/92 (70%), Gaps = 2/92 (2%) Frame = +2 Query: 5 PYGL*PGMPVQLPTDLPILPPAGWKPGDPVALPPLDSXAVAPRMEEQQQPVHVPGFGKGP 184 P G PGMPV+LP DLP LPP GWKPGDPV LPPL+S A APR E+ Q G + P Sbjct: 337 PSGWKPGMPVELPRDLP-LPPPGWKPGDPVVLPPLESIA-APRAEDHQHMRPSQGLHRPP 394 Query: 185 QPIQVRHVQLDI-DDDSDTEYSSDD-SSDDED 274 IQVR VQLDI +DD ++YSSDD SSDDED Sbjct: 395 DVIQVRAVQLDILEDDDSSDYSSDDASSDDED 426 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,081,480 Number of Sequences: 27288 Number of extensions: 271142 Number of successful extensions: 2618 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1582 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2366 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 454398200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA13F04.yg.ab1 (669 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15770.1 hypothetical protein / 127 4e-30 >At4g15770.1 hypothetical protein / Length = 75 Score = 127 bits (320), Expect = 4e-30 Identities = 61/75 (81%), Positives = 68/75 (90%) Frame = +1 Query: 313 MSFLYGNDVVKGGLGRITDNINAYDGVVVFSMSDLPLGFGIAAKSTQDCRKMDPNGLVVI 492 MSFLYGN V+KGGLGRITD+I DGVVVFSMSD+PLGFGIAAKSTQDCRK+DPNG+VV+ Sbjct: 1 MSFLYGNHVLKGGLGRITDSIVPGDGVVVFSMSDVPLGFGIAAKSTQDCRKLDPNGIVVL 60 Query: 493 RQADTGEYLRNQDDL 537 QAD GEYLR +DDL Sbjct: 61 HQADIGEYLRGEDDL 75 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,285,451 Number of Sequences: 27288 Number of extensions: 362741 Number of successful extensions: 1119 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1118 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA13J12.yg.ab1 (299 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66520.1 formyl transferase, putative / contains Pfam prof... 65 5e-12 >At1g66520.1 formyl transferase, putative / contains Pfam profile: PF00551: Formyl transferase Length = 355 Score = 65.5 bits (158), Expect = 5e-12 Identities = 30/34 (88%), Positives = 33/34 (96%) Frame = +1 Query: 1 GTALEVLEVQLPGKKVVDAAAFWNGLRGQKVKKL 102 GTALEVLEVQLPGKK ++AAAFWNGLRGQK+KKL Sbjct: 322 GTALEVLEVQLPGKKAINAAAFWNGLRGQKLKKL 355 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,228,206 Number of Sequences: 27288 Number of extensions: 114376 Number of successful extensions: 300 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 300 length of database: 11,516,596 effective HSP length: 75 effective length of database: 9,469,996 effective search space used: 227279904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA13N06.yg.ab1 (443 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g59520.1 expressed protein / ; supported by cDNA: gi_65202... 92 9e-20 >At1g59520.1 expressed protein / ; supported by cDNA: gi_6520211_dbj_AB028226.1_AB028226 Length = 388 Score = 92.4 bits (228), Expect = 9e-20 Identities = 55/94 (58%), Positives = 65/94 (68%) Frame = +3 Query: 3 EVEVAVSGVADHSLDEVGFGSPHSPLHISEGGFKIGAMVRKAASVAQVAAKNAYAAAAAT 182 EVEVAVSGV D S +G SP S S+ +G++ RKAASVA VAAK+A AAA A+ Sbjct: 295 EVEVAVSGVVDQSQVVLGPVSPMS----SKKSIDLGSIFRKAASVASVAAKHAIAAATAS 350 Query: 183 RNNSDGGMDMVPLKCCLMSISLPWEHIAHDLLFK 284 + + M PLKCCLMSISLPW+ IAHDLLFK Sbjct: 351 YDEDE----MFPLKCCLMSISLPWDTIAHDLLFK 380 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,412,319 Number of Sequences: 27288 Number of extensions: 232388 Number of successful extensions: 783 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 776 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 516458532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA14A07.yg.ab1 (543 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g43190.1 F-box protein family, AtFBX6 / contains similarit... 186 7e-48 At5g15710.1 F-box protein family / unusual floral organs prot... 61 4e-10 >At5g43190.1 F-box protein family, AtFBX6 / contains similarity to unusual floral organs (UFO) GI:4376159 from [Arabidopsis thaliana] Length = 403 Score = 186 bits (472), Expect = 7e-48 Identities = 78/146 (53%), Positives = 105/146 (71%), Gaps = 4/146 (2%) Frame = +2 Query: 2 KWETLDVD----LPGELTFVRLTAGNGNGEGSKKLFMFGGIGRNGISKSMKVWKLDVKGR 169 KW T D E+TF RL + K L+M GGIG NGI +S+K+W+ + Sbjct: 262 KWTTATGDGVFPADDEITFARLVSD----PEKKILYMVGGIGSNGICRSIKIWEFKEETE 317 Query: 170 NWMEIQSVPEMMCKKLGSVCYHNYEHIYCFCHQGMICVCCYSWPEVLYYKVSRKTWHWLP 349 +W+E++++P+++C+K SVCYHNYEH+YC H+ MICVCCY+WPE+L++ V R+TWHW+P Sbjct: 318 SWIEVETLPDIVCRKFTSVCYHNYEHVYCLWHKEMICVCCYNWPEILFFHVGRRTWHWVP 377 Query: 350 KSPSLPEKWSCGFQWFSFVPELYAFV 427 K PSLPEKWSCGF+WFSFVP L A V Sbjct: 378 KCPSLPEKWSCGFRWFSFVPSLSASV 403 >At5g15710.1 F-box protein family / unusual floral organs protein UFO - Arabidopsis thaliana, PIR:S57710 Length = 448 Score = 60.8 bits (146), Expect = 4e-10 Identities = 34/115 (29%), Positives = 54/115 (46%) Frame = +2 Query: 2 KWETLDVDLPGELTFVRLTAGNGNGEGSKKLFMFGGIGRNGISKSMKVWKLDVKGRNWME 181 +WE + P L L AG K+LF+ G IG +SM++W+LD +W+E Sbjct: 318 QWEHIPAKFPRSLLDGYLVAGT-----QKRLFLVGRIGLYSTLQSMRIWELDHTKVSWVE 372 Query: 182 IQSVPEMMCKKLGSVCYHNYEHIYCFCHQGMICVCCYSWPEVLYYKVSRKTWHWL 346 I +P + L + +E CF +IC ++ + L Y V +K W W+ Sbjct: 373 ISRMPPKYFRALLRLSAERFE---CFGQDNLICFTSWNQGKGLLYNVDKKIWSWI 424 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,499,597 Number of Sequences: 27288 Number of extensions: 339906 Number of successful extensions: 1420 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1418 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 781156644 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA14D11.yg.ab1 (466 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50575.1 expressed protein / ; supported by cDNA: gi_16649... 238 1e-63 >At1g50575.1 expressed protein / ; supported by cDNA: gi_16649026_gb_AY059883.1_ Length = 306 Score = 238 bits (607), Expect = 1e-63 Identities = 113/147 (76%), Positives = 129/147 (86%) Frame = +3 Query: 3 ALEAGKPVGGFKIAKEAGEWTATNFHPYLPSHAYLTCRFFSARKHGLVDAAVRSSKGEKT 182 ALEA KPVGG KI KEAGEWTA+ FHPYLP Y TCRFFSARKHGLVDA +R++ EKT Sbjct: 140 ALEAEKPVGGIKIEKEAGEWTASKFHPYLPPQNYHTCRFFSARKHGLVDAVIRNNVSEKT 199 Query: 183 GVIVLPGGIGTLDEAFEILALIQLERIGSALPVPFVLMNYDSFYSKLLQFLEVCQDWGTV 362 +I LPGGIGTLDE FEILALIQLERIGSALPVPF++MNYD+FYSKLL+F+E C++ GTV Sbjct: 200 AIIALPGGIGTLDEMFEILALIQLERIGSALPVPFIVMNYDAFYSKLLEFIETCENLGTV 259 Query: 363 SKGEVSSLFKVCNNNSEALAYLAQFYN 443 SKGEVS+L+KVCNNN EAL YLA+FY+ Sbjct: 260 SKGEVSALWKVCNNNFEALTYLAEFYD 286 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,298,774 Number of Sequences: 27288 Number of extensions: 258702 Number of successful extensions: 852 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 820 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 852 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 569103444 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA14I20.yg.ab1 (467 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g01350.1 putative protein / ;supported by full-length cDN... 79 8e-16 >At5g01350.1 putative protein / ;supported by full-length cDNA: Ceres:35934. Length = 72 Score = 79.3 bits (194), Expect = 8e-16 Identities = 34/67 (50%), Positives = 54/67 (79%) Frame = +2 Query: 2 GNFVQRVMSYLVNEILVDSLANSRAFQRFAVKTSKSMEEMSSIAAKKRQEIAEQVKEMSR 181 GNF+ RV+SY+ NE +V+ LANS AFQRFAV+TSK +E +S +AA+ R+++A+Q++E ++ Sbjct: 5 GNFIARVISYVANEFIVNGLANSHAFQRFAVRTSKRIENLSKMAAENREKVAQQMEEFAK 64 Query: 182 NFESKNR 202 N +S + Sbjct: 65 NIDSTKK 71 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,518,857 Number of Sequences: 27288 Number of extensions: 189112 Number of successful extensions: 582 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 582 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 578136832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA14J03.yg.ab1 (746 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g26370.1 putative protein / transcription termination fact... 258 2e-69 >At4g26370.1 putative protein / transcription termination factor nusB, Synechocystis sp., PIR2:S76233;supported by full-length cDNA: Ceres:943. Length = 301 Score = 258 bits (659), Expect = 2e-69 Identities = 128/174 (73%), Positives = 146/174 (83%) Frame = +1 Query: 1 ARRELGYEFDKETLMEYNHMSFGGPPVKTETAEEADELLQLDEKASEIEAEVLSAPPKLV 180 ARRE GYEFDK +L+EYNHMSFGGPPVKTET EE DEL++ DEK S+IEAEVLSAPPKLV Sbjct: 128 ARREPGYEFDKSSLLEYNHMSFGGPPVKTETKEEEDELVRHDEKESKIEAEVLSAPPKLV 187 Query: 181 YSKLILRFTRKLLVAVAEKWDDHVVVIEKVAPQNWKNEPAGRILELSILHLAMSEIDVLG 360 YSKL+LRF +KLL AV +KWD HVV+IEK++P +WK+ PAGRILE SILHLAMSE+ VL Sbjct: 188 YSKLVLRFAKKLLAAVVDKWDSHVVIIEKISPPDWKSAPAGRILEFSILHLAMSEVAVLE 247 Query: 361 TRHQIVINEAVDLAKRFCDGSAPRTVNGCLRTFIKGIKGNSVALAQDLETKKEI 522 TRH IVINEAVDLAKRFCDGSAPR +NGCLRTF+K S Q LE K+E+ Sbjct: 248 TRHPIVINEAVDLAKRFCDGSAPRIINGCLRTFVKDRATTST--PQALELKQEV 299 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,410,645 Number of Sequences: 27288 Number of extensions: 397232 Number of successful extensions: 1212 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1212 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA14K02.yg.ab1 (565 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50170.1 expressed protein / similar to hypothetical prote... 187 3e-48 >At1g50170.1 expressed protein / similar to hypothetical protein GB:AAD50047 GI:5734782 from [Arabidopsis thaliana];supported by full-length cDNA: Ceres:96741. Length = 225 Score = 187 bits (475), Expect = 3e-48 Identities = 83/110 (75%), Positives = 99/110 (89%) Frame = +1 Query: 1 YPIVEPAHMELAKPSIQDAFHACVEKGANRVIVSPFFLFPGRHWHQDIPSLTAEAAKDYP 180 YPIVEPAHMELA+PSI+DAF CV++GA RV+VSPFFLFPGRHWH DIPSLTA+AAK++ Sbjct: 113 YPIVEPAHMELAEPSIKDAFSLCVQQGAKRVVVSPFFLFPGRHWHTDIPSLTADAAKEFS 172 Query: 181 DVSYLITAPLGLHSLLLDVVDDRIKHCLSHIAGDAEECAVCVGTGKCRLH 330 +SYLITAPLG H+LLLDVV+DRI+HCLSH+ GDA+EC VC GT KC+L+ Sbjct: 173 GISYLITAPLGPHNLLLDVVNDRIQHCLSHVEGDADECLVCAGTNKCKLY 222 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,597,172 Number of Sequences: 27288 Number of extensions: 272370 Number of successful extensions: 589 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 589 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 832491732 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA15F05.yg.ab1 (588 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27710.1 putative protein / 82 3e-16 >At5g27710.1 putative protein / Length = 380 Score = 81.6 bits (200), Expect = 3e-16 Identities = 44/89 (49%), Positives = 49/89 (54%) Frame = +2 Query: 2 VLVVLDAHPGGIIYRDIIPNYVKYARTIYEG*KVFT*FVFFDFD*KY**VYKLFRFLVFF 181 VLVVLDAHP GIIYRD+IP+YVK+ RTIYE Sbjct: 324 VLVVLDAHPDGIIYRDLIPDYVKFVRTIYE------------------------------ 353 Query: 182 LADDFGDNVVDVNYLNVGTAKPDYQLFIC 268 DD G VDVNYLNVG +PDYQLF+C Sbjct: 354 --DDLGTTAVDVNYLNVGAHEPDYQLFMC 380 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,426,969 Number of Sequences: 27288 Number of extensions: 250993 Number of successful extensions: 492 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 904103924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA15F17.yg.ab1 (527 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g16450.1 expressed protein / ;supported by full-length cDN... 179 6e-46 >At4g16450.1 expressed protein / ;supported by full-length cDNA: Ceres:16090. Length = 106 Score = 179 bits (455), Expect = 6e-46 Identities = 85/100 (85%), Positives = 92/100 (92%) Frame = +3 Query: 60 MNTDITALAKPEYPVIDRNPPFTKTVANFNTLDYLRLTTISGISVTVGYLSGIKPGIRGP 239 MNTDITAL K +YPV+DRNP FTK V NF TLDYLR +TI+GISVTVGYLSGIKPGI+GP Sbjct: 1 MNTDITALEKAQYPVVDRNPAFTKVVGNFRTLDYLRFSTITGISVTVGYLSGIKPGIKGP 60 Query: 240 SMVTGGLIGVMGGFMYAYQNSAGRLMGFFPNDGEVARYKK 359 SMVTGGLIG+MGGFMYAYQNSAGRLMGFFPNDGEVA Y+K Sbjct: 61 SMVTGGLIGLMGGFMYAYQNSAGRLMGFFPNDGEVASYQK 100 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,978,421 Number of Sequences: 27288 Number of extensions: 340149 Number of successful extensions: 2292 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2208 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 736262584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA15I24.yg.ab1 (570 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18660.1 putative protein / 2'-hydroxyisoflavone reductase... 258 1e-69 >At5g18660.1 putative protein / 2'-hydroxyisoflavone reductase (EC 1.3.1.45) - Nicotiana tabacum, PIR:T02202;supported by full-length cDNA: Ceres:17121. Length = 417 Score = 258 bits (660), Expect = 1e-69 Identities = 122/154 (79%), Positives = 137/154 (88%) Frame = +1 Query: 1 KPYVMFGDGKLCACKPISEPDLASFIADCVLSTDKTNQILPIGGPGKALTPLEQGEMLFK 180 KPYVMFGDGKLCACKPISE DLA+FIADCVL +K NQ+LPIGGPGKALTPLEQGE+LFK Sbjct: 262 KPYVMFGDGKLCACKPISEQDLAAFIADCVLEENKINQVLPIGGPGKALTPLEQGEILFK 321 Query: 181 LAGKKPNFIKVPIEIMDFAIGVLDFLVKIFPSMEDVAEFGKIGRYYAAESMLVYDPETKE 360 + G++P F+KVPIEIMDF IGVLD + KIFPS+ + AEFGKIGRYYAAESML+ DPET E Sbjct: 322 ILGREPKFLKVPIEIMDFVIGVLDSIAKIFPSVGEAAEFGKIGRYYAAESMLILDPETGE 381 Query: 361 YKAEETPSYGEDTLEDFFKKVLEEGMAGQELGEQ 462 Y E+TPSYG+DTLEDFF KV+ EGMAGQELGEQ Sbjct: 382 YSEEKTPSYGKDTLEDFFAKVIREGMAGQELGEQ 415 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,219,555 Number of Sequences: 27288 Number of extensions: 304547 Number of successful extensions: 983 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 950 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 983 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 850394780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA16B16.yg.ab1 (644 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58040.1 putative protein / predicted proteins, Drosophila... 115 3e-26 >At5g58040.1 putative protein / predicted proteins, Drosophila melanogaster and Arabidopsis thaliana Length = 1192 Score = 115 bits (287), Expect = 3e-26 Identities = 75/151 (49%), Positives = 91/151 (59%), Gaps = 13/151 (8%) Frame = +1 Query: 25 GLSSSGARVLERSGTEGGGG-------DDWDDSDSEDDLQIVLNDNT-----GGGIMGMD 168 G+S R+ ++ G G GG DDWD SDSEDDLQIVLND++ GG Sbjct: 117 GVSQVTTRIEQQVGGGGDGGYGGQGEGDDWD-SDSEDDLQIVLNDSSRNVMIGGADRRSR 175 Query: 169 VGGGQDEEDDEDGDNLVIVTGNADPNHHHHPPMDDLQDWGEDPSQAAEGAGERKDLLGGE 348 +G +D++D++D D LVIV + DPN PM++ Q WGED Q EG G KD GGE Sbjct: 176 MGDNEDDDDEDDEDPLVIVA-DTDPNQ----PMEE-QMWGEDGLQGIEGDG--KD--GGE 225 Query: 349 AGRPE-VGGATAAQKVGYGSHGYHPFHSQFK 438 AG+ GGAT K GY SHGYHPFHSQFK Sbjct: 226 AGKGSGPGGATGPPKAGYSSHGYHPFHSQFK 256 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,024,570 Number of Sequences: 27288 Number of extensions: 454760 Number of successful extensions: 4261 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3589 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1061984084 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA16E05.yg.ab1 (602 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59140.1 elongin - like protein / elongin C, Drosophila me... 162 9e-41 >At5g59140.1 elongin - like protein / elongin C, Drosophila melanogaster, PIR:JC5794; supported by cDNA: gi_15028384_gb_AY045995.1_ Length = 96 Score = 162 bits (411), Expect = 9e-41 Identities = 79/94 (84%), Positives = 87/94 (92%) Frame = +3 Query: 45 DTVKLISAEGFEFVIDKNAAMVSQTIRNMLTSPGDFAETEHQEVTFPEISTTILEKICQY 224 +TVKLIS EGFEFVID+ AAMVSQTIR+MLTSPG F+E++ VTFP+ISTTILEKICQY Sbjct: 3 ETVKLISMEGFEFVIDREAAMVSQTIRSMLTSPGGFSESKDGVVTFPDISTTILEKICQY 62 Query: 225 FYWSLQYASGKETEFHIEPELTLELMMAANYLHT 326 FYWSLQY+ GKETEFHIEPELTLELMMAANYLHT Sbjct: 63 FYWSLQYSRGKETEFHIEPELTLELMMAANYLHT 96 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,160,274 Number of Sequences: 27288 Number of extensions: 330158 Number of successful extensions: 925 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 898 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 925 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 948861544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA16G16.yg.ab1 (490 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03420.1 expressed protein / similar to Ku70-binding prote... 235 8e-63 >At3g03420.1 expressed protein / similar to Ku70-binding protein GB:AAD31085 [Homo sapiens]; supported by cDNA: gi_13877934_gb_AF370230.1_AF370230 Length = 194 Score = 235 bits (600), Expect = 8e-63 Identities = 103/118 (87%), Positives = 112/118 (94%) Frame = +1 Query: 1 IVVCSNYMNIQDEVNQVVIHELIHAYDDCRAANLDWTNCAHHACSEIRAGHLSGDCHYKR 180 I VCSNY+ IQDEVNQVVIHELIHAYD+CRA NLDWTNCAHHACSEIRAGHLSGDCH+KR Sbjct: 77 ITVCSNYLTIQDEVNQVVIHELIHAYDECRAKNLDWTNCAHHACSEIRAGHLSGDCHFKR 136 Query: 181 ELLRGFVKIRGHEQECVRRRVMKSLANNPYCSEAAAKDAMEAVWETCYNDTKPFDRAP 354 ELLRGF+K+RGHEQEC++RRV+KSL NPYCSE AAKDAMEAVW+TCYNDTKPFDRAP Sbjct: 137 ELLRGFIKLRGHEQECIKRRVLKSLRGNPYCSEVAAKDAMEAVWDTCYNDTKPFDRAP 194 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,784,186 Number of Sequences: 27288 Number of extensions: 227822 Number of successful extensions: 582 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 568 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 582 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 630427000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA16L10.yg.ab1 (489 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g17560.1 putative protein / ;supported by full-length cDN... 137 4e-33 At1g55805.1 Expressed protein / ; supported by cDNA: gi_14488... 47 5e-06 >At5g17560.1 putative protein / ;supported by full-length cDNA: Ceres:9667. Length = 177 Score = 137 bits (344), Expect = 4e-33 Identities = 70/89 (78%), Positives = 76/89 (84%) Frame = +3 Query: 3 TSPSNASGPIDSPLMQSMQNKIKEELNAELVTVNDAYGDGRHVSIDVVSSAFEGKSAVNR 182 +S N +G ID LMQSM+ KIKE+LNAE VTV D GDGRHV I+VVSSAFEG+SAVNR Sbjct: 88 SSQINDAGSIDQTLMQSMELKIKEQLNAESVTVTDMSGDGRHVCINVVSSAFEGQSAVNR 147 Query: 183 QRMVYKAIWEELQNVVHAVDQMTTKTPEE 269 QRMVYKAIWEELQNVVHAVDQMTTKTP E Sbjct: 148 QRMVYKAIWEELQNVVHAVDQMTTKTPSE 176 >At1g55805.1 Expressed protein / ; supported by cDNA: gi_14488091_gb_AF389294.1_AF389294 Length = 109 Score = 47.0 bits (110), Expect = 5e-06 Identities = 33/99 (33%), Positives = 53/99 (53%), Gaps = 13/99 (13%) Frame = +3 Query: 21 SGPIDSPLMQSMQNKIKEELN-AELVTVNDAY------------GDGRHVSIDVVSSAFE 161 SG I++ + M+ K+++EL ELV + +Y D H ++ +VS FE Sbjct: 11 SGAIENRASR-MREKLQKELEPVELVIEDVSYQHAGHAGMKGRTDDETHFNVKIVSKGFE 69 Query: 162 GKSAVNRQRMVYKAIWEELQNVVHAVDQMTTKTPEEAAS 278 G + V R R+VY + EEL +HA+ + +KTP E+ S Sbjct: 70 GMNLVKRHRLVYHLLREELDTGLHAL-SIVSKTPSESPS 107 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,380,336 Number of Sequences: 27288 Number of extensions: 215156 Number of successful extensions: 622 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 630427000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA17D15.yg.ab1 (413 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55540.1 putative protein / similar to unknown protein (gb... 116 5e-27 >At5g55540.1 putative protein / similar to unknown protein (gb|AAD39572.1) Length = 1380 Score = 116 bits (290), Expect = 5e-27 Identities = 49/73 (67%), Positives = 64/73 (87%), Gaps = 1/73 (1%) Frame = +1 Query: 40 RGRGRSTNVQ-QDMKAAHQWVVDFLRERGCSTGKDIAEKFGLWRVRYRDDGQIAWVCRRH 216 R RGR ++Q Q+ +AA QW++D+LRE+ CSTG+DIAEKFGLWRVRYRDDG IAW+C+RH Sbjct: 1308 RNRGRDRDIQEQEQRAAQQWLIDYLREQTCSTGRDIAEKFGLWRVRYRDDGSIAWICKRH 1367 Query: 217 MYTRANEIVEVPL 255 M TRA+E+++VPL Sbjct: 1368 MITRAHEVIQVPL 1380 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,750,292 Number of Sequences: 27288 Number of extensions: 263931 Number of successful extensions: 918 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 874 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 916 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 436222272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA18P22.yg.ab1 (689 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66680.1 dolichyl-di-phosphooligosaccharide-protein glycotran... 347 3e-96 >At5g66680.1 dolichyl-di-phosphooligosaccharide-protein glycotransferase (oligosaccharyltransferase)-like / ;supported by full-length cDNA: Ceres:18419. Length = 437 Score = 347 bits (891), Expect = 3e-96 Identities = 161/203 (79%), Positives = 184/203 (90%) Frame = +1 Query: 1 QARNNARIVFSGSLDLFSNKFFKSPVQKAGSSNKYAKSGNQQFATEISKWVFHERGHLKA 180 QARNNAR+V SGS+ LFS++ +S VQKAGS N+Y KSGN+QF TE+SKWVFHERGHLKA Sbjct: 235 QARNNARVVISGSVQLFSDRLIRSGVQKAGSPNQYEKSGNEQFVTELSKWVFHERGHLKA 294 Query: 181 VNVRHHRVGETDEPSIYRINDDLEYLVEIYEWSGSSWEPYVANDVQVQFYMMSPYVLKTM 360 N+ HHRVGETDEP+IYRI DDLE+ VEIYEWSG SWEPYVANDVQVQFYMMSPYVLKT+ Sbjct: 295 GNLVHHRVGETDEPAIYRIKDDLEFSVEIYEWSGKSWEPYVANDVQVQFYMMSPYVLKTL 354 Query: 361 SSNNKGLYIASFKVPDVYGVFQFKVEYQRLGYTSLSLAKQIPVRPFRHNEYERFIPTAFP 540 S++ KGL+ SFKVPDVYGVFQFKVEY++LGYT+LSL+KQIPVRP+RHNEYERFIPTA+P Sbjct: 355 STDKKGLFHTSFKVPDVYGVFQFKVEYEKLGYTTLSLSKQIPVRPYRHNEYERFIPTAYP 414 Query: 541 YYGASFSTMAAFFIFSFVYLYSK 609 YYGA F+TMA FF+FSFVYLY K Sbjct: 415 YYGACFTTMAGFFVFSFVYLYHK 437 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,294,489 Number of Sequences: 27288 Number of extensions: 335139 Number of successful extensions: 855 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 854 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1183294084 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA19B01.yg.ab1 (523 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27990.1 putative protein / predicted proteins, Saccharomy... 86 9e-18 >At5g27990.1 putative protein / predicted proteins, Saccharomyces cerevisiae and Schizosaccharomyces pombe;supported by full-length cDNA: Ceres:5109. Length = 184 Score = 86.3 bits (212), Expect = 9e-18 Identities = 51/154 (33%), Positives = 90/154 (58%), Gaps = 1/154 (0%) Frame = +2 Query: 2 GRDTRQKAQQLAVDIYQWLIRPSEALY-VDELENLLDDFMLSLNTEIDDGSIEEIADNLM 178 GRD++ KA + ++ + I+ + + +++L +LLD + LNT +DGS++E+A+ L+ Sbjct: 39 GRDSQAKANETVATVFDFFIQSKDPVKDIEKLGDLLDKGLDELNTTAEDGSVDEVANLLV 98 Query: 179 IIHEECLEGNFASIERLRQSAPQIAAASHQMQVVNGGEDDSDSTSSSGDESMEMADGVDP 358 ++E+C GN+ +E LR + Q +A+ ++V NG DD +S D++ +M VD Sbjct: 99 DLYEDCCNGNYEMLEELRATYSQTSAS--VVKVSNG--DDEESDDEDDDQTTDMM--VDA 152 Query: 359 TSNMADMTLNESARPAAPTVDADGWTVVSSRRNR 460 ++ + A P V DGWTVVSSR+N+ Sbjct: 153 SNQ------KQEAMPVDEPVADDGWTVVSSRKNK 180 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,889,690 Number of Sequences: 27288 Number of extensions: 224813 Number of successful extensions: 965 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 961 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 729494100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA19C02.yg.ab1 (256 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54855.1 Expressed protein / ; supported by full-length cD... 100 2e-22 >At5g54855.1 Expressed protein / ; supported by full-length cDNA: Ceres: 9159. Length = 146 Score = 99.8 bits (247), Expect = 2e-22 Identities = 45/67 (67%), Positives = 50/67 (74%) Frame = +2 Query: 2 IYTVAETMPESERWDACLARPISSFHEHCTHLGDGFSGVKFGYNHVSGYSHAVRPFVYRH 181 +YTVAETMPESERWDACLARPISSFH C L +G+KF YN SG+ HAV+PFVYR Sbjct: 80 VYTVAETMPESERWDACLARPISSFHTPCNRLHQTNTGIKFTYNRPSGFFHAVKPFVYRP 139 Query: 182 ASIPMYC 202 P YC Sbjct: 140 QYAPSYC 146 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,801,086 Number of Sequences: 27288 Number of extensions: 110320 Number of successful extensions: 290 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 290 length of database: 11,516,596 effective HSP length: 60 effective length of database: 9,879,316 effective search space used: 237103584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA19L01.yg.ab1 (592 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25400.1 unknown protein / 111 3e-25 >At3g25400.1 unknown protein / Length = 99 Score = 111 bits (277), Expect = 3e-25 Identities = 52/71 (73%), Positives = 61/71 (85%) Frame = +3 Query: 156 VGEVGELSEIFQWKGEVERGLPNWSDDDKEHLEEELSDVLLYLVQLADVCGLDLGQAALS 335 VGEVGELSEIFQWKGEV RG P+W +++K HL EELSDVLLYLV+L+D CG+DLG+AAL Sbjct: 4 VGEVGELSEIFQWKGEVARGCPDWKEEEKVHLGEELSDVLLYLVRLSDACGVDLGKAALR 63 Query: 336 KIVKNAQKYPI 368 KI NA KYP+ Sbjct: 64 KIELNAIKYPV 74 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,782,592 Number of Sequences: 27288 Number of extensions: 316433 Number of successful extensions: 1047 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1033 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 913055448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA1c03.yg.ab1 (492 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g01710.1 putative actin polymerization factor / similar to... 233 3e-62 >At4g01710.1 putative actin polymerization factor / similar to human ARP2/3 complex 16 kd subunit, GenBank accession number O15511 likely functions to control the polymerization of actin; supported by cDNA: gi_15529134_gb_AY052191.1_ Length = 132 Score = 233 bits (595), Expect = 3e-62 Identities = 115/132 (87%), Positives = 121/132 (91%) Frame = +3 Query: 21 MGEHVEADNAEAIITRIEHKSRKIESLLKQYKPVEALKTALEGSPPKTRDERCKSANWIV 200 M E VEADNAEAII RIE KSRKIESLLKQYK VEALKTALEGSPPKTRDERCKSANWIV Sbjct: 1 MAEFVEADNAEAIIARIETKSRKIESLLKQYKHVEALKTALEGSPPKTRDERCKSANWIV 60 Query: 201 VHRALMAIKDVDLMFTSLDPEYYDILMKYLYRGLSTGDRPTCDQCLRIHEKLTHKAGLGC 380 VHRALMAIKD+D M +LD EYYDILMKYLYRGLSTGDRPTCDQCL+IHEKLT +AGLGC Sbjct: 61 VHRALMAIKDIDGMLNALDVEYYDILMKYLYRGLSTGDRPTCDQCLKIHEKLTERAGLGC 120 Query: 381 ILRALSDTVNTV 416 ILR L+DT+NTV Sbjct: 121 ILRCLTDTINTV 132 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,891,207 Number of Sequences: 27288 Number of extensions: 263476 Number of successful extensions: 751 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 751 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 639433100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA20G07.yg.ab1 (484 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13225.1 hypothetical protein / predicted by genemark.hmm 103 3e-23 >At3g13225.1 hypothetical protein / predicted by genemark.hmm Length = 863 Score = 103 bits (258), Expect = 3e-23 Identities = 48/82 (58%), Positives = 63/82 (76%), Gaps = 2/82 (2%) Frame = +2 Query: 2 ANFQPLGGDWRERVRRKR--AKKSMEAEDKEAKGTVDTTNQKPDLVQLTKQLPSPWQAYW 175 ANFQPLGGDWRE+V+RKR A+KS + + ++ QKPDL +L+ LPS WQAYW Sbjct: 788 ANFQPLGGDWREKVKRKRERAEKSQKKDPEK--------QQKPDLTKLSANLPSEWQAYW 839 Query: 176 DEASKQVYYGNSKTSETSWTKP 241 DE++K+VYYGN+ TS+TSWT+P Sbjct: 840 DESTKKVYYGNTSTSQTSWTRP 861 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,035,752 Number of Sequences: 27288 Number of extensions: 234320 Number of successful extensions: 941 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 940 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 623303772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA20M11.yg.ab1 (756 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g22750.1 expressed protein / strong similarity to hypothet... 122 3e-57 >At1g22750.1 expressed protein / strong similarity to hypothetical protein gb|Y09823 from A. thaliana. ESTs gb|T76118, gb|T04263 and gb|ATYU9823 come from this gene; supported by cDNA: gi_15292832_gb_AY050850.1_ Length = 244 Score = 122 bits (307), Expect(2) = 3e-57 Identities = 59/113 (52%), Positives = 75/113 (66%) Frame = +2 Query: 353 KGLSVVIARVIFGVLGCLMLGTLLYTLIVDGSPFRAELYTPWIVATLIDFYINVVALSVW 532 K VV AR +FG LGC+MLG L+YT GSPF EL PW+V L++FYI+V LSVW Sbjct: 129 KNSLVVTARFVFGALGCVMLGALVYTCFTYGSPFHMELLYPWMVVLLVNFYIDVAVLSVW 188 Query: 533 IAYKESSWISALLWIVFLVCCGSITTCVYIVKQLFYLSPDQPISLILFKNNHR 691 + YKESS I +LW+ L+ GS+ T IV QLF LSP P+ L+L N++R Sbjct: 189 VVYKESSLIIGILWVALLIGLGSVGTSAVIVVQLFRLSPLDPLYLVLVNNSNR 241 Score = 117 bits (292), Expect(2) = 3e-57 Identities = 52/107 (48%), Positives = 77/107 (71%), Gaps = 2/107 (1%) Frame = +1 Query: 7 VRTLLSVLGCFMVAVLIYTIATDGLPF--RTELLTRWMAALLIDFYIHIAIIGAWVVYKE 180 ++ +L V+ C M+A L+YTI TDGLP R ++ T W ++DFYI++ I W+VYKE Sbjct: 10 LKVVLPVMFCLMLATLVYTIITDGLPLPDRQDVFTPWFVTTILDFYINLVPIAVWIVYKE 69 Query: 181 SSWIIASVWVILLICFGSVTTCGYIVLQFYKLTPEESSKDPIYFVLV 321 S+W + +W ILLI FGS+TTC Y+ LQ KLT +E+S+DP+Y++L+ Sbjct: 70 STWSGSILWTILLIIFGSLTTCVYLFLQLLKLTNQEASEDPMYYLLL 116 Score = 112 bits (279), Expect = 3e-25 Identities = 50/112 (44%), Positives = 78/112 (69%), Gaps = 6/112 (5%) Frame = +2 Query: 377 RVIFGVLGCLMLGTLLYTLIVDGSPF--RAELYTPWIVATLIDFYINVVALSVWIAYKES 550 +V+ V+ CLML TL+YT+I DG P R +++TPW V T++DFYIN+V ++VWI YKES Sbjct: 11 KVVLPVMFCLMLATLVYTIITDGLPLPDRQDVFTPWFVTTILDFYINLVPIAVWIVYKES 70 Query: 551 SWISALLWIVFLVCCGSITTCVYIVKQLFYL----SPDQPISLILFKNNHRD 694 +W ++LW + L+ GS+TTCVY+ QL L + + P+ +L +++ +D Sbjct: 71 TWSGSILWTILLIIFGSLTTCVYLFLQLLKLTNQEASEDPMYYLLLRDSIKD 122 Score = 109 bits (272), Expect = 2e-24 Identities = 55/112 (49%), Positives = 70/112 (62%) Frame = +1 Query: 1 VAVRTLLSVLGCFMVAVLIYTIATDGLPFRTELLTRWMAALLIDFYIHIAIIGAWVVYKE 180 V R + LGC M+ L+YT T G PF ELL WM LL++FYI +A++ WVVYKE Sbjct: 134 VTARFVFGALGCVMLGALVYTCFTYGSPFHMELLYPWMVVLLVNFYIDVAVLSVWVVYKE 193 Query: 181 SSWIIASVWVILLICFGSVTTCGYIVLQFYKLTPEESSKDPIYFVLVTHQKR 336 SS II +WV LLI GSV T IV+Q ++L+P DP+Y VLV + R Sbjct: 194 SSLIIGILWVALLIGLGSVGTSAVIVVQLFRLSP----LDPLYLVLVNNSNR 241 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,632,101 Number of Sequences: 27288 Number of extensions: 406485 Number of successful extensions: 1026 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1023 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA21F08.yg.ab1 (396 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77710.1 unknown protein / similar to hypothetical protein... 163 3e-41 >At1g77710.1 unknown protein / similar to hypothetical protein GB:P34661 [Caenorhabditis elegans]; supported by cDNA: gi_20260379 Length = 93 Score = 163 bits (412), Expect = 3e-41 Identities = 80/83 (96%), Positives = 82/83 (98%) Frame = +1 Query: 1 GKVSFKVILTSDPKLPFKVFSVPEGAPFTAVLKYAAEEFKVPPQTSAIITNDGVGINPQQ 180 GKVSFKV LTSDPKLPFKVFSVPEGAPFTAVLK+AAEEFKVPPQTSAIITNDG+GINPQQ Sbjct: 5 GKVSFKVTLTSDPKLPFKVFSVPEGAPFTAVLKFAAEEFKVPPQTSAIITNDGIGINPQQ 64 Query: 181 SAGNVFLKHGSELRLIPRDRVGA 249 SAGNVFLKHGSELRLIPRDRVGA Sbjct: 65 SAGNVFLKHGSELRLIPRDRVGA 87 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,397,462 Number of Sequences: 27288 Number of extensions: 173195 Number of successful extensions: 739 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 391955836 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA21N22.yg.ab1 (428 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55610.1 unknown protein / 90 5e-19 >At5g55610.1 unknown protein / Length = 329 Score = 89.7 bits (221), Expect = 5e-19 Identities = 41/60 (68%), Positives = 50/60 (83%) Frame = +3 Query: 3 EQVKGLGKKVYGVTVRCGASLLFASIGAGIGATLFRPSTGQSVGCLIGDLAGPIIVSFCL 182 +Q K LG KV G+TVRCGASL+FA+IGAGI + L RPSTGQ +GC +GDLAGP++VS CL Sbjct: 262 QQAKDLGNKVVGITVRCGASLVFAAIGAGICSCLIRPSTGQWIGCALGDLAGPMVVSVCL 321 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,031,619 Number of Sequences: 27288 Number of extensions: 218333 Number of successful extensions: 636 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 634 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 481662092 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA3d10.yg.ab1 (475 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g46030.1 expressed protein / similar to unknown protein (p... 166 7e-42 >At5g46030.1 expressed protein / similar to unknown protein (pir||T27174); supported by full-length cDNA: Ceres: 15222. Length = 120 Score = 166 bits (419), Expect = 7e-42 Identities = 75/94 (79%), Positives = 87/94 (91%) Frame = +3 Query: 15 MGKRKSRAKPAPRKRMDKLDTVFSCPFCNHGTSVECRIDMKNLIGEASCRICQENFSTTV 194 MGKRKSRAKPAP KRMDKLDT+FSCPFCNHG+SVEC IDMK+LIG+A+CRIC+E+FSTT+ Sbjct: 1 MGKRKSRAKPAPTKRMDKLDTIFSCPFCNHGSSVECIIDMKHLIGKAACRICEESFSTTI 60 Query: 195 TALTEPIDIYSEWIDECERVNTVDEDGVPVEDDE 296 TALTE IDIYSEWIDECERVNT ++D V E++E Sbjct: 61 TALTEAIDIYSEWIDECERVNTAEDDVVQEEEEE 94 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,722,436 Number of Sequences: 27288 Number of extensions: 233584 Number of successful extensions: 917 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 911 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 596203608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA5C07.yg.ab1 (670 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g36980.1 expressed protein / ; supported by cDNA: gi_15292... 254 4e-68 >At1g36980.1 expressed protein / ; supported by cDNA: gi_15292702_gb_AY050785.1_ Length = 135 Score = 254 bits (648), Expect = 4e-68 Identities = 115/135 (85%), Positives = 126/135 (93%) Frame = +2 Query: 59 MDLSELWAIFGPGFAGAVFGAGWWFWVDAVVCSSVQVSFLHYLPGIFASLAALMFNCVRR 238 MDL+ELWAIFGPGF+GAVFG GWWFWVDAVVCSS+QV F+HYLPGIFASL ALMFNCVR+ Sbjct: 1 MDLAELWAIFGPGFSGAVFGTGWWFWVDAVVCSSIQVPFVHYLPGIFASLGALMFNCVRK 60 Query: 239 EDIDYSPYEEGEWRLKLWLFLAYVVSFVSLAASVGLLIQDALVPEGPSAWTGTAGVLQCV 418 EDIDYSPY+EGEWRLKLWLF+AYVV+FVSLAASVGLLIQD++V GPS WTG AGV QCV Sbjct: 61 EDIDYSPYDEGEWRLKLWLFIAYVVAFVSLAASVGLLIQDSVVKTGPSTWTGVAGVFQCV 120 Query: 419 LVLISGLVYWTSHSE 463 VLISGL+YWTSHSE Sbjct: 121 FVLISGLMYWTSHSE 135 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,993,486 Number of Sequences: 27288 Number of extensions: 378238 Number of successful extensions: 1183 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1181 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA5J19.yg.ab1 (409 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g31860.1 phosphoribosyl-ATP pyrophosphohydrolase (At-IE) / ... 99 1e-21 >At1g31860.1 phosphoribosyl-ATP pyrophosphohydrolase (At-IE) / identical to phosphoribosyl-ATP pyrophosphohydrolase (At-IE) [Arabidopsis thaliana] GI:3461884 (Plant Physiol. 118 (1), 275-283 (1998)); supported by full-length cDNA: Ceres: 25538. Length = 281 Score = 98.6 bits (244), Expect = 1e-21 Identities = 49/62 (79%), Positives = 55/62 (88%) Frame = +3 Query: 3 EADELCRTLEENEDESRSVSEMADVLYHEMVLLIRRGLKFEDVLEVLRCRFTQSGIEEKN 182 EADELCRTLE+NE+ SR+ SEMADVLYH MVLL +RG+K EDVLEVLR RF+QSGIEEK Sbjct: 218 EADELCRTLEDNEEVSRTPSEMADVLYHAMVLLSKRGVKMEDVLEVLRKRFSQSGIEEKQ 277 Query: 183 NR 188 NR Sbjct: 278 NR 279 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,064,520 Number of Sequences: 27288 Number of extensions: 150931 Number of successful extensions: 472 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 466 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 418046344 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA5M06.yg.ab1 (607 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32690.1 Expressed protein / ; supported by cDNA: gi_14165... 246 7e-66 >At4g32690.1 Expressed protein / ; supported by cDNA: gi_14165162_gb_AF376062.1_AF376062 Length = 175 Score = 246 bits (628), Expect = 7e-66 Identities = 117/158 (74%), Positives = 136/158 (86%), Gaps = 5/158 (3%) Frame = +3 Query: 3 DAFSIDEVNLFEKLGLQTFINLSTDFYTRVYDEGEEWFRSIFADSKKEDAIQNQYEFFVQ 182 +AF+IDE NLF+KLGLQTFINLST+FYTRVYD+ EEWF+SIF++S KEDAIQNQYEFFVQ Sbjct: 18 EAFAIDESNLFDKLGLQTFINLSTNFYTRVYDDEEEWFQSIFSNSNKEDAIQNQYEFFVQ 77 Query: 183 RMGGPPLYSQRKGHPALIGRHRPFLVTHKAAERWLHHMQQALDNTTDIDHDSKTRMLNFF 362 RMGGPPLYSQRKGHPALIGRHRPF VTH+AAERWL HMQ ALD++ DID DSK +M+ FF Sbjct: 78 RMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALDDSVDIDQDSKIKMMKFF 137 Query: 363 RHTAYFLVAGNDLKSQSQGAP-----PCKNGTNKPAAE 461 RHTA+FLVAGN+LK+Q++ CK+ NKPA E Sbjct: 138 RHTAFFLVAGNELKNQNEKPKHKPQCACKHAANKPAEE 175 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,594,790 Number of Sequences: 27288 Number of extensions: 301912 Number of successful extensions: 743 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 742 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 957813068 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA5N24.yg.ab1 (436 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15030.1 putative protein / 155 6e-39 >At4g15030.1 putative protein / Length = 179 Score = 155 bits (393), Expect = 6e-39 Identities = 82/139 (58%), Positives = 94/139 (66%) Frame = +2 Query: 17 LPIKTDQDTLREGYRFIRSEEDDMDFSWEQRLVKRYYDKLFKEYCIADMSHYKSGKIGLR 196 LP+KTDQDTLREGYRFIRSEEDD+D SWEQRLVKRYYDKLFKEYCIADMS YK+GK+GLR Sbjct: 11 LPVKTDQDTLREGYRFIRSEEDDLDPSWEQRLVKRYYDKLFKEYCIADMSKYKTGKMGLR 70 Query: 197 WRTEKEVTSGKGQFVCGNKHCNEEEGLTSYEVNFAYFEAGENKQALVKLVTCERCAKKLV 376 WRTEKEV +GK AGE+KQALVKLV CER Sbjct: 71 WRTEKEVMTGK---------------------------AGEDKQALVKLVACERSKSHSE 103 Query: 377 YKKMKEKEKEESKRREKEE 433 +E++++E +R E E Sbjct: 104 DDTDEEEKRKEGERSESNE 122 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,280,117 Number of Sequences: 27288 Number of extensions: 197796 Number of successful extensions: 1085 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1049 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 489276504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA6G19.yg.ab1 (358 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76200.1 expressed protein / ; supported by full-length cD... 132 4e-32 >At1g76200.1 expressed protein / ; supported by full-length cDNA: Ceres: 20257. Length = 69 Score = 132 bits (331), Expect = 4e-32 Identities = 55/69 (79%), Positives = 61/69 (87%), Gaps = 2/69 (2%) Frame = +3 Query: 33 MAGGGYGQG-TYKGVNLHQPKRWHTVTGKGMCAMMWFWILYRAKQDGPVVLGWRHPWEGH 209 M GGG+G G TYKGV +H PK WHTVTGKG+CA+MWFWILYRAKQDGPVV+GWRHPW+GH Sbjct: 1 MGGGGHGGGITYKGVTVHTPKTWHTVTGKGLCAVMWFWILYRAKQDGPVVMGWRHPWDGH 60 Query: 210 G-HGHGDEH 233 G HGHGD H Sbjct: 61 GDHGHGDHH 69 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,909,078 Number of Sequences: 27288 Number of extensions: 204440 Number of successful extensions: 631 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 615 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 214836576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA6G22.yg.ab1 (431 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21105.1 Expressed protein / ; supported by full-length cD... 115 7e-27 >At4g21105.1 Expressed protein / ; supported by full-length cDNA: Ceres: 23587. Length = 68 Score = 115 bits (289), Expect = 7e-27 Identities = 53/68 (77%), Positives = 64/68 (93%) Frame = +3 Query: 36 MVEEPPFRPREKLIEKQKMYQSIQKHTYLKGPMDKITSVAIPLALAGSSLYLIGRGIYNM 215 M+ E PFRPREKL+EKQ+++QSIQ+HTYLKGPMDKITSVAIP+ALA SSLY+IG GIYNM Sbjct: 1 MLTETPFRPREKLLEKQRLFQSIQRHTYLKGPMDKITSVAIPIALAASSLYMIGTGIYNM 60 Query: 216 SHGIGRKD 239 S+GIG+K+ Sbjct: 61 SNGIGKKE 68 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,710,353 Number of Sequences: 27288 Number of extensions: 205757 Number of successful extensions: 531 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 531 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 480215828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA6H08.yg.ab1 (506 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g18593.1 Expressed protein / ; supported by full-length cD... 112 1e-25 >At4g18593.1 Expressed protein / ; supported by full-length cDNA: Ceres: 29009. Length = 142 Score = 112 bits (280), Expect = 1e-25 Identities = 44/85 (51%), Positives = 66/85 (76%) Frame = +1 Query: 1 EGESSFEWHRRRSDNYFNKYDELECTSIFVEPLRWMKTVEEGALEGKLWCSHCEGRLGYF 180 +GE F W +R ++ ++++C+SIFVEP++WM+T+ +G +E KL C C GRLGYF Sbjct: 49 KGEECFAWKKRSGNS-----EQVQCSSIFVEPMKWMQTIHDGMVEEKLLCFGCNGRLGYF 103 Query: 181 NWSGIQCSCGSWITPAFQLHRSRVD 255 NW+G+QCSCG+W+ PAFQL++SR+D Sbjct: 104 NWAGMQCSCGAWVNPAFQLNKSRID 128 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,046,163 Number of Sequences: 27288 Number of extensions: 237936 Number of successful extensions: 680 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 684463600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA6H24.yg.ab1 (635 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g02620.1 putative vacuolar ATPase / similar to vacuolar AT... 219 9e-58 >At4g02620.1 putative vacuolar ATPase / similar to vacuolar ATPase, GenBank accession number P50408;supported by full-length cDNA: Ceres:10207. Length = 128 Score = 219 bits (558), Expect = 9e-58 Identities = 104/126 (82%), Positives = 119/126 (93%) Frame = +3 Query: 93 MASRAQIPTNNSALIAMIADEDTITGFLLAGVGNVDIRRKTNYMIVDSKTTVKQIEDAFK 272 MA RA IP NSALIAMIADEDT+ GFL+AGVGNVDIRRKTNY+IVDSKTTV+QIEDAFK Sbjct: 1 MAGRATIPARNSALIAMIADEDTVVGFLMAGVGNVDIRRKTNYLIVDSKTTVRQIEDAFK 60 Query: 273 EFTTRDDVAIVLISQYVANMIRFVVDSYNNPIPAILEIPSKDHPYDPAHDSVLSRVKYLF 452 EF+ RDD+AI+L+SQY+ANMIRF+VDSYN P+PAILEIPSKDHPYDPAHDSVLSRVKYLF Sbjct: 61 EFSARDDIAIILLSQYIANMIRFLVDSYNKPVPAILEIPSKDHPYDPAHDSVLSRVKYLF 120 Query: 453 NSDSVA 470 +++SV+ Sbjct: 121 SAESVS 126 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,666,826 Number of Sequences: 27288 Number of extensions: 299377 Number of successful extensions: 777 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 777 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA6K13.yg.ab1 (313 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g23395.1 unknown protein / predicted by genemarkHMM 144 1e-35 >At5g23395.1 unknown protein / predicted by genemarkHMM Length = 162 Score = 144 bits (362), Expect = 1e-35 Identities = 71/99 (71%), Positives = 84/99 (84%), Gaps = 1/99 (1%) Frame = +1 Query: 16 SGSESESSSPPSMESLLAEAAAFGNED-ESLSMEAKAQKALECPCIQNLRSGPCGSQFSD 192 S +SE +S PSM+SLLAEAAA+G +D E+ S+EAKAQ+AL+CPCI +LR+G CGSQFS+ Sbjct: 26 SPRDSEDTSSPSMDSLLAEAAAYGEDDNENESLEAKAQRALDCPCIADLRNGSCGSQFSE 85 Query: 193 AFLCFLKSTAEEKGSDCVIPFVALQRCIKTNPNAFPKDV 309 AFLCFLKSTAEEKGSDCV PFVALQ CI NP+AF K V Sbjct: 86 AFLCFLKSTAEEKGSDCVNPFVALQSCINANPDAFSKSV 124 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.310 0.126 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,866,611 Number of Sequences: 27288 Number of extensions: 164868 Number of successful extensions: 589 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 11,516,596 effective HSP length: 79 effective length of database: 9,360,844 effective search space used: 224660256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA6O06.yg.ab1 (439 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06780.1 expressed protein / ; supported by cDNA: gi_15450... 93 6e-20 >At3g06780.1 expressed protein / ; supported by cDNA: gi_15450370_gb_AY052286.1_ Length = 201 Score = 92.8 bits (229), Expect = 6e-20 Identities = 47/81 (58%), Positives = 52/81 (64%), Gaps = 12/81 (14%) Frame = +1 Query: 4 GFFGGGDGPFGGGGGS-----------GGGGNFHGFNWDESSSSS-SDPAFDFVYEALTW 147 G FGG DGPFG GGG GGGG F NWD SS SS SDPA +FVYE + W Sbjct: 108 GDFGGSDGPFGFGGGGNDGGGKGWNYGGGGGGFGRDNWDGSSFSSWSDPAMEFVYEVICW 167 Query: 148 FVLSNCLHFALKRVVRMVADG 210 LSNC+HFA KR+VR+V DG Sbjct: 168 IALSNCVHFAFKRIVRIVTDG 188 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,037,747 Number of Sequences: 27288 Number of extensions: 300509 Number of successful extensions: 15294 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2419 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8975 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 498337180 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA8A18.yg.ab1 (711 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g45050.1 putative protein / 159 1e-39 >At3g45050.1 putative protein / Length = 148 Score = 159 bits (402), Expect = 1e-39 Identities = 78/121 (64%), Positives = 89/121 (73%) Frame = +2 Query: 212 KPKETLIPNGLPETAASVAVAATVVGAAATLLARRTKSVEAANATPTRPCEDCGGSGICS 391 K T++P L ETA S+A+AATVVG AAT+L RR + CE C GSGIC Sbjct: 28 KRSSTVVP-ALAETAVSIAIAATVVGTAATILVRRNNKASEEAEASMKECEACLGSGICP 86 Query: 392 ECKGEGFVVKRMSDSSAEKARLNAKNMATRYTAGLPKKWSYCTKCLSARSCKSCDGSGKL 571 ECKGEGFV+K++SD++AEKARL AKNMATRYTAGLPKKWSYCTKC S RSC C GSGK Sbjct: 87 ECKGEGFVLKKLSDANAEKARLAAKNMATRYTAGLPKKWSYCTKCSSTRSCMICGGSGKT 146 Query: 572 S 574 S Sbjct: 147 S 147 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,329,587 Number of Sequences: 27288 Number of extensions: 408500 Number of successful extensions: 1356 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1352 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1245572720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA8B24.yg.ab1 (565 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g52730.1 ubiquinol--cytochrome-c reductase-like protein / ... 116 7e-27 >At3g52730.1 ubiquinol--cytochrome-c reductase-like protein / ubiquinol--cytochrome-c reductase, 8K chain, potato, PIR:T07369; supported by cDNA: gi_15451023_gb_AY054592.1_ Length = 72 Score = 116 bits (291), Expect = 7e-27 Identities = 54/68 (79%), Positives = 58/68 (84%) Frame = +3 Query: 78 SAARKSGGLFEGLYKVLMRRNSVYVTFVIAGAFIGERAVDYGVHKLWENNNVGKRYEDIP 257 +A R G FEG YK++MRRNSVYVTF+IAGAF GERAVDYGVHKLWE NNVGKRYEDI Sbjct: 4 AARRNQKGAFEGFYKLIMRRNSVYVTFIIAGAFFGERAVDYGVHKLWERNNVGKRYEDIS 63 Query: 258 VLGQRPTE 281 VLGQRP E Sbjct: 64 VLGQRPVE 71 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,522,735 Number of Sequences: 27288 Number of extensions: 269411 Number of successful extensions: 805 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 832491732 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA9F21.yg.ab1 (687 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54770.1 thiazole biosynthetic enzyme precursor (ARA6) (sp Q3... 277 3e-75 >At5g54770.1 thiazole biosynthetic enzyme precursor (ARA6) (sp Q38814) / ; supported by cDNA: gi_1113782_gb_U17589.1_ATU17589 Length = 349 Score = 277 bits (709), Expect = 3e-75 Identities = 134/163 (82%), Positives = 149/163 (91%) Frame = +1 Query: 19 AGDLIIKGGRVSGVVTNWALVAMNHDTQSCMDPNVMEAKVVVSSCGHDGPMGATGVKRLR 198 A DLI+KG RV GVVTNWALVA NH TQSCMDPNVMEAK+VVSSCGHDGP GATGVKRL+ Sbjct: 187 AEDLIVKGNRVGGVVTNWALVAQNHHTQSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLK 246 Query: 199 SVGLIESVPGMKALDMNAAEDAIVKLTREIVPGMIVTGMEVAEIDGSPRMGPTFGAMMIS 378 S+G+I+ VPGMKALDMN AEDAIV+LTRE+VPGMIVTGMEVAEIDG+PRMGPTFGAMMIS Sbjct: 247 SIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMIS 306 Query: 379 GQKAAHLALRALGLPNALDGTSVGSVHPEMILAAVDSGETVDA 507 GQKA LAL+ALGLPNA+DGT VG++ PE++LAA DS ETVDA Sbjct: 307 GQKAGQLALKALGLPNAIDGTLVGNLSPELVLAAADSAETVDA 349 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,755,484 Number of Sequences: 27288 Number of extensions: 397078 Number of successful extensions: 1538 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1522 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1174397136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB10P09.yg.ab1 (693 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g28720.1 hypothetical protein / 268 2e-72 >At3g28720.1 hypothetical protein / Length = 687 Score = 268 bits (686), Expect = 2e-72 Identities = 135/196 (68%), Positives = 165/196 (83%), Gaps = 2/196 (1%) Frame = -1 Query: 582 AAISSDHYHVITPF-SSNTNHRLSLTHMLALDVDLSSPSLSSKLSDKIKSEIATTASPLR 406 AA+++D++HVI+P S+TNH+L ++H L LD LS SLS++L +K+ I++T S LR Sbjct: 113 AAVTNDNFHVISPSPDSSTNHKLVISHSLHLDASLSPQSLSTRLDSTLKTLISSTTSSLR 172 Query: 405 SNLISISYTTIDSIIKQDFEKEKPTKG-VYIYLLNLGSQSKPYAYKYTDTGESSLGVTKC 229 SNL+SI Y ID IIKQ++EKEK G VYIYL++LGSQ+KPYAY Y+ G+SS G TKC Sbjct: 173 SNLLSIQYNPIDEIIKQEYEKEKHGDGGVYIYLISLGSQAKPYAYSYSH-GDSSAGFTKC 231 Query: 228 SGSIWTGKDRYLWIDLSAGPVDYGPALSGDGVLPRGEFHPLTALHGRPKSQKALLADMAS 49 GSIWTGKDRYLWIDLSAGPVDYGPALSGDGVLPRGEFHPL ALHGRPKS+KALLAD+AS Sbjct: 232 LGSIWTGKDRYLWIDLSAGPVDYGPALSGDGVLPRGEFHPLAALHGRPKSEKALLADLAS 291 Query: 48 LVWSAYKVLLVPSLRI 1 LV++AY+VL+VPSLRI Sbjct: 292 LVYNAYQVLIVPSLRI 307 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,933,211 Number of Sequences: 27288 Number of extensions: 440635 Number of successful extensions: 3072 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2439 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1192191032 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB11A05.yg.ab1 (615 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g55300.1 Serine/arginine-rich protein, putative / similar ... 185 1e-47 >At1g55300.1 Serine/arginine-rich protein, putative / similar to GI:6572475 from [Arabidopsis thaliana] Length = 203 Score = 185 bits (470), Expect = 1e-47 Identities = 85/117 (72%), Positives = 106/117 (89%) Frame = +1 Query: 253 DECQPFLHITEDGRNGTFVIGDDQFPASLLDLPSILESYKTYDDNVLIKTADIGQMIMIR 432 DE L +EDGRNGTF+IG+D+FPASLLDLP+++ES+KTYDD L+KTADIGQMIM+R Sbjct: 29 DEIPLDLFFSEDGRNGTFMIGNDEFPASLLDLPAVVESFKTYDDCALVKTADIGQMIMVR 88 Query: 433 EDGDPAPDGMEYRHGVTPPMRDARRRRFRREPDLNPELVQRVEKDLLNIMNGGMLKS 603 E GDPAP+ +EYRHG+TPPM+DAR+RRFRREPDLNPELVQRVE+DLLNI++GG +++ Sbjct: 89 EPGDPAPNTVEYRHGLTPPMKDARKRRFRREPDLNPELVQRVERDLLNILSGGTVEN 145 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,353,152 Number of Sequences: 27288 Number of extensions: 294033 Number of successful extensions: 645 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 645 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 972741724 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB11H21.yg.ab1 (602 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g51510.1 expressed protein / ;supported by full-length cD... 80 8e-16 >At5g51510.1 expressed protein / ;supported by full-length cDNA: Ceres:20287. Length = 170 Score = 80.1 bits (196), Expect = 8e-16 Identities = 49/137 (35%), Positives = 78/137 (56%) Frame = +1 Query: 4 KSTLSKVLVVQAVVVLLGVVDILFTLLNKEPLEILAAASISITLISIIIGELGRKRSRVS 183 K+ L ++ VQA + ++G+ T K+ LA A+ L+ +IGELG +RSRV+ Sbjct: 36 KARLRPLIFVQAAIYVIGLSCAFLTTTKKDEKNTLAIAAAVAGLVCSLIGELGCRRSRVN 95 Query: 184 LLKLYMAASSVGILGSIASIAQLKATTPLLVGLSNWETDKFDLLKIACVSVGLFVQIFSI 363 LL+LY AAS++ ++ S+ + + T + S+ T K +L C +G VQI +I Sbjct: 96 LLRLYTAASTIVMVLSVFCAVRSRLT--MEERNSSGTTAKLELAGFICAQLGAVVQILAI 153 Query: 364 SKTTSLIGNMSPPKRAS 414 T SL+ NMSPP +A+ Sbjct: 154 IVTGSLVNNMSPPTKAA 170 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,157,195 Number of Sequences: 27288 Number of extensions: 274441 Number of successful extensions: 699 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 698 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 948861544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB11I02.yg.ab1 (712 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53280.1 putative protein / similar to unknown protein (gb... 228 2e-60 At2g16070.1 expressed protein / ;supported by full-length cDN... 53 1e-07 >At5g53280.1 putative protein / similar to unknown protein (gb|AAD26950.1); supported by full-length cDNA: Ceres: 33791. Length = 272 Score = 228 bits (582), Expect = 2e-60 Identities = 128/238 (53%), Positives = 165/238 (68%), Gaps = 17/238 (7%) Frame = +3 Query: 3 EMEEVEAVLEKIWDLHDKLSDAIHSISRSHFLLSVKALRSSNDLFDRAADNNKKVSDDEV 182 E+EE+EAVLEKIWDLHDKLSD IH IS+SHFL SVK S N S ++ Sbjct: 5 EIEEIEAVLEKIWDLHDKLSDEIHLISKSHFLKSVKPSNRSEK-----RKNPHGNSGEDK 59 Query: 183 KGGFVYVKDFPIEEDAHSAIHEAKSLNSIRTALENLEDQLEFFHTVQTQQRAERDAAIAR 362 + G+V++K F ++ D S I EAKSLN+IRTALENLEDQLEFFHT+ TQQR E+D AIAR Sbjct: 60 RPGYVFIKGFAVD-DNDSTIQEAKSLNAIRTALENLEDQLEFFHTIHTQQRTEKDVAIAR 118 Query: 363 LEESRIVLALRLADHHGKNYKVIEEARAFVGQVQNHS---------------CSYNNIEK 497 LE+SRI+LA+RLA+HHGKNY V+EEA AFVG ++++S N+I Sbjct: 119 LEQSRILLAMRLAEHHGKNYGVLEEALAFVGSIKSNSHYVSPDHLYDSSRNPDGANSIPD 178 Query: 498 --KSNILVNVVISSFNFAKKSLKGDNVGGLFGNAALFAXSMLALLHLHHVADRDGEHH 665 +SN ++N S+F FAK++L ++V G+ GNAA+FA S++A+LHLH VA EHH Sbjct: 179 GIESNFVINAFASTFGFAKRALGFNHVKGVLGNAAIFAISVVAMLHLHQVA--TSEHH 234 >At2g16070.1 expressed protein / ;supported by full-length cDNA: Ceres:95679. Length = 307 Score = 53.1 bits (126), Expect = 1e-07 Identities = 45/155 (29%), Positives = 75/155 (48%), Gaps = 5/155 (3%) Frame = +3 Query: 9 EEVEAVLEKIWDLHDKLSDAIHSISRSHFLLSVKALRSSNDLFDRAADNNKKVSDDEVKG 188 E + +L + +L K+SD I + SS + D D N+ +S E + Sbjct: 5 EGIGLILARATELRLKISDCIDN--------------SSTTVSDNG-DGNEDLSPGEGRK 49 Query: 189 GFVYV---KDFPI--EEDAHSAIHEAKSLNSIRTALENLEDQLEFFHTVQTQQRAERDAA 353 + KDF ED A EA+ L IR ALE LE QL ++ +Q+ E+ A Sbjct: 50 SEIIGNQDKDFDSISSEDVDEA--EAERLLRIRDALEALESQLASLQNLRQRQQYEKQLA 107 Query: 354 IARLEESRIVLALRLADHHGKNYKVIEEARAFVGQ 458 ++ ++ SR +L +L ++ GK+++V+ E F G+ Sbjct: 108 LSEIDYSRKMLLEKLKEYKGKDFEVLRETTTFAGE 142 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,326,076 Number of Sequences: 27288 Number of extensions: 327766 Number of successful extensions: 1086 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1049 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1083 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1245572720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB11M13.yg.ab1 (735 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g50840.1 unknown protein / ; supported by cDNA: gi_19698942 321 2e-88 At1g12430.1 armadillo-repeat-containing kinesin-related protein ... 50 1e-06 At5g62410.1 chromosomal protein - like / chromosomal protein ... 49 2e-06 At1g13220.2 putative nuclear matrix constituent protein / sim... 49 3e-06 >At5g50840.1 unknown protein / ; supported by cDNA: gi_19698942 Length = 404 Score = 321 bits (823), Expect = 2e-88 Identities = 167/242 (69%), Positives = 203/242 (83%), Gaps = 2/242 (0%) Frame = +2 Query: 8 TQAANSQGTLSSQ--SSGTSRKDTSEVKRKSSKRTFKTEKEFLEFTLSYQKVLSERDAAI 181 ++ + TLS + S +++ E KRK SK FK+EKEFLEF L YQ+VLSERD+AI Sbjct: 99 SEGSTQNSTLSKEMDSLKPKKQEVVESKRKGSKNMFKSEKEFLEFMLKYQQVLSERDSAI 158 Query: 182 TMRDKLESLCRELQRQNKMLMDECKRVSTESQNLRLDLSNKFQEAIKDVTSKLEEQRDDS 361 T+RDKLESLCRELQRQNKMLM+ECKRVSTE Q LR DLS KFQ+AI DV+ KL+EQ+++S Sbjct: 159 TVRDKLESLCRELQRQNKMLMEECKRVSTEGQTLRSDLSTKFQDAIMDVSIKLDEQKNES 218 Query: 362 LTQLKENEMLRNQLKQKEEHNALTVQQYTQQLKQKSLELQIADLKLQQHEEKLVKEQSQM 541 LTQLKENEMLR +LK + L+ QQ+ Q+LKQK+LELQI+ LK++QHEEKL+ EQSQM Sbjct: 219 LTQLKENEMLRTKLKHLADQFMLSEQQHEQRLKQKTLELQISALKIKQHEEKLIHEQSQM 278 Query: 542 KMYAEQVSQLLATEKNLRLQLTADGEKFQQFQDALVKSNEVF*TFKQEIEKMGKSIKELK 721 K+YA+QVSQLL+TEKNLRLQLT+DG+KFQQFQDALVKSNEVF TFKQEI+KM K+IKEL+ Sbjct: 279 KVYADQVSQLLSTEKNLRLQLTSDGDKFQQFQDALVKSNEVFETFKQEIDKMSKAIKELR 338 Query: 722 KE 727 KE Sbjct: 339 KE 340 >At1g12430.1 armadillo-repeat-containing kinesin-related protein / ; supported by cDNA: gi_9954167_gb_AF159052.1_AF159052 Length = 919 Score = 50.1 bits (118), Expect = 1e-06 Identities = 43/186 (23%), Positives = 91/186 (48%), Gaps = 6/186 (3%) Frame = +2 Query: 194 KLESLCRELQRQNKMLMDECKRVSTESQNLRLDLSNKFQEAIKDVTSKLEEQRDDSLTQL 373 +L++L E +RQ K +DE +R++ E+ N + ++ A++D + + +S+ +L Sbjct: 434 QLDNLIEENERQQKAFVDEIERITVEAHNQISEAEKRYANALEDEKLRYQNDYMESIKKL 493 Query: 374 KENEMLRNQLKQKEEH------NALTVQQYTQQLKQKSLELQIADLKLQQHEEKLVKEQS 535 +EN +NQ K E N L + + +LE ++++LK KL+++++ Sbjct: 494 EEN-WSKNQKKLAAERLALGEKNGLDITSNGNRSIAPALE-EVSELK------KLLQKEA 545 Query: 536 QMKMYAEQVSQLLATEKNLRLQLTADGEKFQQFQDALVKSNEVF*TFKQEIEKMGKSIKE 715 Q KM AE+ L + N ++ A G +++ +++ Q+ EK+ I Sbjct: 546 QSKMAAEEEVNRLKHQLNEFKKVEASG------NSEIMRLHKMLENETQQKEKLEGEIAT 599 Query: 716 LKKEIV 733 L +++ Sbjct: 600 LHSQLL 605 >At5g62410.1 chromosomal protein - like / chromosomal protein XCAP-E, Xenopus laevis, PIR:B55094; supported by cDNA: gi_12382275_gb_AF306547.1_AF306547 Length = 1175 Score = 49.3 bits (116), Expect = 2e-06 Identities = 41/172 (23%), Positives = 79/172 (45%), Gaps = 17/172 (9%) Frame = +2 Query: 197 LESLCRELQRQNKMLMDECKRVSTESQNLRLDLSNKFQEA---IKDVTSKLEEQRDDSLT 367 +ES +ELQ D ++ ++ +L L L Q + + KLEE+ +++ + Sbjct: 696 VESQIKELQPLQMKFTDVYAQLELKTYDLSLFLKRAEQNEHHKLGEAVKKLEEELEEAKS 755 Query: 368 QLKENEM-----------LRNQLKQKEEHNALTVQQYTQQLKQKSLELQIADLKLQQHE- 511 Q+KE E+ L N +K +++ ++ + +K ++Q A L+ HE Sbjct: 756 QIKEKELAYKNCFDAVSKLENSIKDHDKNREGRLKDLEKNIKTIKAQMQAASKDLKSHEN 815 Query: 512 --EKLVKEQSQMKMYAEQVSQLLATEKNLRLQLTADGEKFQQFQDALVKSNE 661 EKLV E+ MK + L + + LT++ ++ + DAL K ++ Sbjct: 816 EKEKLVMEEEAMKQEQSSLESHLTSLETQISTLTSEVDEQRAKVDALQKIHD 867 >At1g13220.2 putative nuclear matrix constituent protein / similar to gb|D64087 nuclear matrix constituent protein 1 (NMCP1) from Daucus carota Length = 1128 Score = 48.9 bits (115), Expect = 3e-06 Identities = 41/193 (21%), Positives = 96/193 (49%), Gaps = 9/193 (4%) Frame = +2 Query: 86 RKSSKRTFKTEKEFLEFTLSYQKVLSERDAAITMRDK-------LESLCRELQRQNKMLM 244 ++ ++ + E++ +E S +K+ A D+ LE+ + ++ + K++ Sbjct: 402 KELQRKIEELERQKVEIDHSEEKLEKRNQAMNKKFDRVNEKEMDLEAKLKTIKEREKIIQ 461 Query: 245 DECKRVSTESQNLRLDLSNKFQEAIKDVTSKLEEQRDDSLT--QLKENEMLRNQLKQKEE 418 E KR+S E Q L D +E+++D+ ++E+ R + ++ E E ++K++E Sbjct: 462 AEEKRLSLEKQQLLSD-----KESLEDLQQEIEKIRAEMTKKEEMIEEECKSLEIKKEER 516 Query: 419 HNALTVQQYTQQLKQKSLELQIADLKLQQHEEKLVKEQSQMKMYAEQVSQLLATEKNLRL 598 L +Q +LK + + ++ + L + E L +E+ + + E + + A R+ Sbjct: 517 EEYLRLQS---ELKSQIEKSRVHEEFLSKEVENLKQEKERFEKEWEILDEKQAVYNKERI 573 Query: 599 QLTADGEKFQQFQ 637 +++ + EKF++FQ Sbjct: 574 RISEEKEKFERFQ 586 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,022,682 Number of Sequences: 27288 Number of extensions: 316413 Number of successful extensions: 1441 Number of sequences better than 1.0e-05: 8 Number of HSP's better than 0.0 without gapping: 1299 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1407 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB11N09.yg.ab1 (732 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20360.1 putative NADH-ubiquinone oxireductase / ;support... 405 e-113 >At2g20360.1 putative NADH-ubiquinone oxireductase / ;supported by full-length cDNA: Ceres:20429. Length = 402 Score = 405 bits (1041), Expect = e-113 Identities = 194/243 (79%),