BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA10F16.yg.ab1 (408 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g28760.1 hypothetical protein / 115 6e-27 >At3g28760.1 hypothetical protein / Length = 357 Score = 115 bits (289), Expect = 6e-27 Identities = 62/95 (65%), Positives = 75/95 (78%) Frame = +1 Query: 1 VDQSGIQRTAVVGRVKIETRPLIIVDAKVDSHKETSYTILLQNSKTVGLVAPTKGGGNEA 180 VDQ G QRTAVVGRVKIE RPLI+V+AK +ET Y+I+LQN++TV LV P +G Sbjct: 269 VDQKGKQRTAVVGRVKIEKRPLIVVEAK---EEETVYSIILQNAETVALVTPHQG----R 321 Query: 181 TAIPVTSLKVGDEVFVRVQGSARHTGIEIQEFTLE 285 TA+PVTSLK GD+V +R+QG ARHTGIEIQEF +E Sbjct: 322 TAVPVTSLKPGDQVLIRLQGGARHTGIEIQEFIVE 356 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,429,657 Number of Sequences: 27288 Number of extensions: 166341 Number of successful extensions: 431 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 418046344 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA10P22.yg.ab1 (747 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54780.1 thylakoid lumen 18.3 kDa protein / SP:Q9ZVL6;supp... 353 5e-98 >At1g54780.1 thylakoid lumen 18.3 kDa protein / SP:Q9ZVL6;supported by full-length cDNA: Ceres:3853. Length = 285 Score = 353 bits (906), Expect = 5e-98 Identities = 171/205 (83%), Positives = 195/205 (94%) Frame = +1 Query: 1 SAFASEFDVLNDGPPKESYVLDDAGVLSRVTKSDLKNLLSDLEYRKKIRINFVTVRKLTS 180 +A ASEF++LNDGPPKE+YV+DDAGVLSRVTKSDLK LLSDLEYRKK+R+NF+TVRKLTS Sbjct: 81 TALASEFNILNDGPPKETYVVDDAGVLSRVTKSDLKKLLSDLEYRKKLRLNFITVRKLTS 140 Query: 181 KADAFEYADQVLERWYPTLEEGNNKGIVVLVTSQKEGAVSGGPEFIKAVGDTVLDATVSQ 360 KADAFEYADQVLE+WYP++EEGNNKGIVVL+TSQKEGA++GGP FI+AVG+ +LDATVS+ Sbjct: 141 KADAFEYADQVLEKWYPSIEEGNNKGIVVLITSQKEGAITGGPAFIEAVGENILDATVSE 200 Query: 361 NLPVLATDEKYNEAVYSTAKRLVAAIDGLPDPGGPEAKENKRESNFKTKEETAEKRDQFT 540 NLPVLATDEKYNEAVYS+AKRLVAAIDG PDPGGP K++KRESNFKTKEET EKR QF+ Sbjct: 201 NLPVLATDEKYNEAVYSSAKRLVAAIDGQPDPGGPTVKDSKRESNFKTKEETDEKRGQFS 260 Query: 541 LVVGGLLAIAFVVPMAQYYAYVSKK 615 LVVGGLL IAFVVPMAQY+AYVS+K Sbjct: 261 LVVGGLLVIAFVVPMAQYFAYVSRK 285 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,677,186 Number of Sequences: 27288 Number of extensions: 374521 Number of successful extensions: 1174 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1174 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA11B23.yg.ab1 (578 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02760.1 putative histidyl tRNA synthetase / similar to hi... 148 2e-36 >At3g02760.1 putative histidyl tRNA synthetase / similar to histidyl tRNA synthetase GB:NP_032240 [Mus musculus] Length = 479 Score = 148 bits (373), Expect = 2e-36 Identities = 78/141 (55%), Positives = 102/141 (72%), Gaps = 5/141 (3%) Frame = +1 Query: 1 RYDNLIGMFGTKRVAAIGVSLGIERVFTIMEEQQRVENQVIRASETQVLVSVLGDD-VGL 177 RYDNLIGMFGTK+V A+G+SLGIERVF IMEE + QVIR +ETQVLVS++ D+ + Sbjct: 339 RYDNLIGMFGTKQVPAVGMSLGIERVFNIMEELNEKQKQVIRPTETQVLVSIMVDNKLAE 398 Query: 178 ASKLVQMCWDAKVNAEFMANKRLNKHFDRAKEFGIPWMVIVGEREIKEGIVKIKNKEVNI 357 A++LV W AK+NAE++ +KR KHF+RAKE GIPWMV+VGE+E+ V +K E Sbjct: 399 AAELVSQLWGAKINAEYLVSKRKEKHFNRAKESGIPWMVMVGEKELSGSFVTLKKLEKGS 458 Query: 358 EQEVAMT----DFVDELIKLM 408 E++ T FV+EL KL+ Sbjct: 459 EEKEDQTCTRDRFVEELKKLL 479 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,692,277 Number of Sequences: 27288 Number of extensions: 278188 Number of successful extensions: 957 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 956 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 877249352 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA11C01.yg.ab1 (473 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03070.1 expressed protein / ; supported by full-length c... 151 2e-37 >At3g03070.1 expressed protein / ; supported by full-length cDNA: Ceres: 35785. Length = 110 Score = 151 bits (381), Expect = 2e-37 Identities = 70/94 (74%), Positives = 78/94 (82%), Gaps = 6/94 (6%) Frame = +3 Query: 63 SSLRPFS------GVVNSEITTSHTAKWMQDTSKKSPMELINEVPPIKVEGRIAACEGDT 224 SS R FS G+ ++ +HTAKWMQD SKKSPMELI+EVPPIKV+GRI ACEGDT Sbjct: 17 SSRRNFSVATTQLGIPTDDLVGNHTAKWMQDRSKKSPMELISEVPPIKVDGRIVACEGDT 76 Query: 225 NPALGHPIEFICLDKSEPAVCKYCGLRYVQDHHH 326 NPALGHPIEFICLD +EPA+CKYCGLRYVQDHHH Sbjct: 77 NPALGHPIEFICLDLNEPAICKYCGLRYVQDHHH 110 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,399,211 Number of Sequences: 27288 Number of extensions: 255256 Number of successful extensions: 891 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 889 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 596203608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA11G16.yg.ab1 (419 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g08580.1 hypothetical protein / predicted by genscan 62 8e-11 >At1g08580.1 hypothetical protein / predicted by genscan Length = 123 Score = 62.4 bits (150), Expect = 8e-11 Identities = 38/79 (48%), Positives = 53/79 (66%) Frame = +3 Query: 12 RDQKEAVEKGLITMEDIEMAVADGSGTSSQDAIKSRVKFHMKKSVKIKSKRATKKEKKGK 191 R+QK+ VEKGL+TMED+EMA A +S+D+ KS KF +KKS+K+ K KGK Sbjct: 54 REQKDMVEKGLVTMEDVEMASAQ---AASEDSKKSPRKFSVKKSLKL-----NKLNNKGK 105 Query: 192 NKRKSDKPAMEGSSDVMME 248 K+K+ K + E S+D M+E Sbjct: 106 -KKKNQKASGEKSADCMLE 123 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,937,066 Number of Sequences: 27288 Number of extensions: 181755 Number of successful extensions: 630 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 454398200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA11M10.yg.ab1 (635 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g65660.1 expressed protein / ;supported by full-length cD... 145 2e-35 >At5g65660.1 expressed protein / ;supported by full-length cDNA: Ceres:25419. Length = 136 Score = 145 bits (366), Expect = 2e-35 Identities = 75/133 (56%), Positives = 91/133 (68%) Frame = +2 Query: 173 MESPTYYPPPPPLHHSDSSRPTLGFPLGTALLLIVIFSLSGIFSCCYHWDKLRHLRGSFT 352 ME+ + PP H D+SRP+LGFPLGTALLLI+IFSLSGIFSCCYHWDK R LR S Sbjct: 1 MENTQDFSPP----HMDASRPSLGFPLGTALLLIIIFSLSGIFSCCYHWDKHRSLRRSLA 56 Query: 353 DAAADDDNDHVHSPSKPKPTFSEKLQNENQSLPVVMPGDRIARFIALPCPCEPEREEKIV 532 + D + +P KPKP F E + +N S+PV+MPGD +FIALPCPC P R EK+ Sbjct: 57 NGRPSADIE--SNPYKPKPPFPEMKKPQNLSVPVLMPGDNTPKFIALPCPCAPPRPEKLT 114 Query: 533 VEEVQKTPKPPHV 571 V +VQ P+ P V Sbjct: 115 V-DVQTPPQSPPV 126 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,022,827 Number of Sequences: 27288 Number of extensions: 373365 Number of successful extensions: 2485 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2410 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA11O04.yg.ab1 (420 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02850.1 putative protein / 102 6e-23 >At5g02850.1 putative protein / Length = 426 Score = 102 bits (255), Expect = 6e-23 Identities = 58/92 (63%), Positives = 65/92 (70%), Gaps = 2/92 (2%) Frame = +2 Query: 5 PYGL*PGMPVQLPTDLPILPPAGWKPGDPVALPPLDSXAVAPRMEEQQQPVHVPGFGKGP 184 P G PGMPV+LP DLP LPP GWKPGDPV LPPL+S A APR E+ Q G + P Sbjct: 337 PSGWKPGMPVELPRDLP-LPPPGWKPGDPVVLPPLESIA-APRAEDHQHMRPSQGLHRPP 394 Query: 185 QPIQVRHVQLDI-DDDSDTEYSSDD-SSDDED 274 IQVR VQLDI +DD ++YSSDD SSDDED Sbjct: 395 DVIQVRAVQLDILEDDDSSDYSSDDASSDDED 426 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,081,480 Number of Sequences: 27288 Number of extensions: 271142 Number of successful extensions: 2618 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1582 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2366 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 454398200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA13F04.yg.ab1 (669 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15770.1 hypothetical protein / 127 4e-30 >At4g15770.1 hypothetical protein / Length = 75 Score = 127 bits (320), Expect = 4e-30 Identities = 61/75 (81%), Positives = 68/75 (90%) Frame = +1 Query: 313 MSFLYGNDVVKGGLGRITDNINAYDGVVVFSMSDLPLGFGIAAKSTQDCRKMDPNGLVVI 492 MSFLYGN V+KGGLGRITD+I DGVVVFSMSD+PLGFGIAAKSTQDCRK+DPNG+VV+ Sbjct: 1 MSFLYGNHVLKGGLGRITDSIVPGDGVVVFSMSDVPLGFGIAAKSTQDCRKLDPNGIVVL 60 Query: 493 RQADTGEYLRNQDDL 537 QAD GEYLR +DDL Sbjct: 61 HQADIGEYLRGEDDL 75 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,285,451 Number of Sequences: 27288 Number of extensions: 362741 Number of successful extensions: 1119 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1118 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA13J12.yg.ab1 (299 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66520.1 formyl transferase, putative / contains Pfam prof... 65 5e-12 >At1g66520.1 formyl transferase, putative / contains Pfam profile: PF00551: Formyl transferase Length = 355 Score = 65.5 bits (158), Expect = 5e-12 Identities = 30/34 (88%), Positives = 33/34 (96%) Frame = +1 Query: 1 GTALEVLEVQLPGKKVVDAAAFWNGLRGQKVKKL 102 GTALEVLEVQLPGKK ++AAAFWNGLRGQK+KKL Sbjct: 322 GTALEVLEVQLPGKKAINAAAFWNGLRGQKLKKL 355 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,228,206 Number of Sequences: 27288 Number of extensions: 114376 Number of successful extensions: 300 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 300 length of database: 11,516,596 effective HSP length: 75 effective length of database: 9,469,996 effective search space used: 227279904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA13N06.yg.ab1 (443 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g59520.1 expressed protein / ; supported by cDNA: gi_65202... 92 9e-20 >At1g59520.1 expressed protein / ; supported by cDNA: gi_6520211_dbj_AB028226.1_AB028226 Length = 388 Score = 92.4 bits (228), Expect = 9e-20 Identities = 55/94 (58%), Positives = 65/94 (68%) Frame = +3 Query: 3 EVEVAVSGVADHSLDEVGFGSPHSPLHISEGGFKIGAMVRKAASVAQVAAKNAYAAAAAT 182 EVEVAVSGV D S +G SP S S+ +G++ RKAASVA VAAK+A AAA A+ Sbjct: 295 EVEVAVSGVVDQSQVVLGPVSPMS----SKKSIDLGSIFRKAASVASVAAKHAIAAATAS 350 Query: 183 RNNSDGGMDMVPLKCCLMSISLPWEHIAHDLLFK 284 + + M PLKCCLMSISLPW+ IAHDLLFK Sbjct: 351 YDEDE----MFPLKCCLMSISLPWDTIAHDLLFK 380 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,412,319 Number of Sequences: 27288 Number of extensions: 232388 Number of successful extensions: 783 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 776 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 516458532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA14A07.yg.ab1 (543 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g43190.1 F-box protein family, AtFBX6 / contains similarit... 186 7e-48 At5g15710.1 F-box protein family / unusual floral organs prot... 61 4e-10 >At5g43190.1 F-box protein family, AtFBX6 / contains similarity to unusual floral organs (UFO) GI:4376159 from [Arabidopsis thaliana] Length = 403 Score = 186 bits (472), Expect = 7e-48 Identities = 78/146 (53%), Positives = 105/146 (71%), Gaps = 4/146 (2%) Frame = +2 Query: 2 KWETLDVD----LPGELTFVRLTAGNGNGEGSKKLFMFGGIGRNGISKSMKVWKLDVKGR 169 KW T D E+TF RL + K L+M GGIG NGI +S+K+W+ + Sbjct: 262 KWTTATGDGVFPADDEITFARLVSD----PEKKILYMVGGIGSNGICRSIKIWEFKEETE 317 Query: 170 NWMEIQSVPEMMCKKLGSVCYHNYEHIYCFCHQGMICVCCYSWPEVLYYKVSRKTWHWLP 349 +W+E++++P+++C+K SVCYHNYEH+YC H+ MICVCCY+WPE+L++ V R+TWHW+P Sbjct: 318 SWIEVETLPDIVCRKFTSVCYHNYEHVYCLWHKEMICVCCYNWPEILFFHVGRRTWHWVP 377 Query: 350 KSPSLPEKWSCGFQWFSFVPELYAFV 427 K PSLPEKWSCGF+WFSFVP L A V Sbjct: 378 KCPSLPEKWSCGFRWFSFVPSLSASV 403 >At5g15710.1 F-box protein family / unusual floral organs protein UFO - Arabidopsis thaliana, PIR:S57710 Length = 448 Score = 60.8 bits (146), Expect = 4e-10 Identities = 34/115 (29%), Positives = 54/115 (46%) Frame = +2 Query: 2 KWETLDVDLPGELTFVRLTAGNGNGEGSKKLFMFGGIGRNGISKSMKVWKLDVKGRNWME 181 +WE + P L L AG K+LF+ G IG +SM++W+LD +W+E Sbjct: 318 QWEHIPAKFPRSLLDGYLVAGT-----QKRLFLVGRIGLYSTLQSMRIWELDHTKVSWVE 372 Query: 182 IQSVPEMMCKKLGSVCYHNYEHIYCFCHQGMICVCCYSWPEVLYYKVSRKTWHWL 346 I +P + L + +E CF +IC ++ + L Y V +K W W+ Sbjct: 373 ISRMPPKYFRALLRLSAERFE---CFGQDNLICFTSWNQGKGLLYNVDKKIWSWI 424 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,499,597 Number of Sequences: 27288 Number of extensions: 339906 Number of successful extensions: 1420 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1418 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 781156644 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA14D11.yg.ab1 (466 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50575.1 expressed protein / ; supported by cDNA: gi_16649... 238 1e-63 >At1g50575.1 expressed protein / ; supported by cDNA: gi_16649026_gb_AY059883.1_ Length = 306 Score = 238 bits (607), Expect = 1e-63 Identities = 113/147 (76%), Positives = 129/147 (86%) Frame = +3 Query: 3 ALEAGKPVGGFKIAKEAGEWTATNFHPYLPSHAYLTCRFFSARKHGLVDAAVRSSKGEKT 182 ALEA KPVGG KI KEAGEWTA+ FHPYLP Y TCRFFSARKHGLVDA +R++ EKT Sbjct: 140 ALEAEKPVGGIKIEKEAGEWTASKFHPYLPPQNYHTCRFFSARKHGLVDAVIRNNVSEKT 199 Query: 183 GVIVLPGGIGTLDEAFEILALIQLERIGSALPVPFVLMNYDSFYSKLLQFLEVCQDWGTV 362 +I LPGGIGTLDE FEILALIQLERIGSALPVPF++MNYD+FYSKLL+F+E C++ GTV Sbjct: 200 AIIALPGGIGTLDEMFEILALIQLERIGSALPVPFIVMNYDAFYSKLLEFIETCENLGTV 259 Query: 363 SKGEVSSLFKVCNNNSEALAYLAQFYN 443 SKGEVS+L+KVCNNN EAL YLA+FY+ Sbjct: 260 SKGEVSALWKVCNNNFEALTYLAEFYD 286 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,298,774 Number of Sequences: 27288 Number of extensions: 258702 Number of successful extensions: 852 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 820 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 852 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 569103444 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA14I20.yg.ab1 (467 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g01350.1 putative protein / ;supported by full-length cDN... 79 8e-16 >At5g01350.1 putative protein / ;supported by full-length cDNA: Ceres:35934. Length = 72 Score = 79.3 bits (194), Expect = 8e-16 Identities = 34/67 (50%), Positives = 54/67 (79%) Frame = +2 Query: 2 GNFVQRVMSYLVNEILVDSLANSRAFQRFAVKTSKSMEEMSSIAAKKRQEIAEQVKEMSR 181 GNF+ RV+SY+ NE +V+ LANS AFQRFAV+TSK +E +S +AA+ R+++A+Q++E ++ Sbjct: 5 GNFIARVISYVANEFIVNGLANSHAFQRFAVRTSKRIENLSKMAAENREKVAQQMEEFAK 64 Query: 182 NFESKNR 202 N +S + Sbjct: 65 NIDSTKK 71 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,518,857 Number of Sequences: 27288 Number of extensions: 189112 Number of successful extensions: 582 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 582 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 578136832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA14J03.yg.ab1 (746 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g26370.1 putative protein / transcription termination fact... 258 2e-69 >At4g26370.1 putative protein / transcription termination factor nusB, Synechocystis sp., PIR2:S76233;supported by full-length cDNA: Ceres:943. Length = 301 Score = 258 bits (659), Expect = 2e-69 Identities = 128/174 (73%), Positives = 146/174 (83%) Frame = +1 Query: 1 ARRELGYEFDKETLMEYNHMSFGGPPVKTETAEEADELLQLDEKASEIEAEVLSAPPKLV 180 ARRE GYEFDK +L+EYNHMSFGGPPVKTET EE DEL++ DEK S+IEAEVLSAPPKLV Sbjct: 128 ARREPGYEFDKSSLLEYNHMSFGGPPVKTETKEEEDELVRHDEKESKIEAEVLSAPPKLV 187 Query: 181 YSKLILRFTRKLLVAVAEKWDDHVVVIEKVAPQNWKNEPAGRILELSILHLAMSEIDVLG 360 YSKL+LRF +KLL AV +KWD HVV+IEK++P +WK+ PAGRILE SILHLAMSE+ VL Sbjct: 188 YSKLVLRFAKKLLAAVVDKWDSHVVIIEKISPPDWKSAPAGRILEFSILHLAMSEVAVLE 247 Query: 361 TRHQIVINEAVDLAKRFCDGSAPRTVNGCLRTFIKGIKGNSVALAQDLETKKEI 522 TRH IVINEAVDLAKRFCDGSAPR +NGCLRTF+K S Q LE K+E+ Sbjct: 248 TRHPIVINEAVDLAKRFCDGSAPRIINGCLRTFVKDRATTST--PQALELKQEV 299 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,410,645 Number of Sequences: 27288 Number of extensions: 397232 Number of successful extensions: 1212 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1212 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA14K02.yg.ab1 (565 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50170.1 expressed protein / similar to hypothetical prote... 187 3e-48 >At1g50170.1 expressed protein / similar to hypothetical protein GB:AAD50047 GI:5734782 from [Arabidopsis thaliana];supported by full-length cDNA: Ceres:96741. Length = 225 Score = 187 bits (475), Expect = 3e-48 Identities = 83/110 (75%), Positives = 99/110 (89%) Frame = +1 Query: 1 YPIVEPAHMELAKPSIQDAFHACVEKGANRVIVSPFFLFPGRHWHQDIPSLTAEAAKDYP 180 YPIVEPAHMELA+PSI+DAF CV++GA RV+VSPFFLFPGRHWH DIPSLTA+AAK++ Sbjct: 113 YPIVEPAHMELAEPSIKDAFSLCVQQGAKRVVVSPFFLFPGRHWHTDIPSLTADAAKEFS 172 Query: 181 DVSYLITAPLGLHSLLLDVVDDRIKHCLSHIAGDAEECAVCVGTGKCRLH 330 +SYLITAPLG H+LLLDVV+DRI+HCLSH+ GDA+EC VC GT KC+L+ Sbjct: 173 GISYLITAPLGPHNLLLDVVNDRIQHCLSHVEGDADECLVCAGTNKCKLY 222 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,597,172 Number of Sequences: 27288 Number of extensions: 272370 Number of successful extensions: 589 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 589 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 832491732 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA15F05.yg.ab1 (588 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27710.1 putative protein / 82 3e-16 >At5g27710.1 putative protein / Length = 380 Score = 81.6 bits (200), Expect = 3e-16 Identities = 44/89 (49%), Positives = 49/89 (54%) Frame = +2 Query: 2 VLVVLDAHPGGIIYRDIIPNYVKYARTIYEG*KVFT*FVFFDFD*KY**VYKLFRFLVFF 181 VLVVLDAHP GIIYRD+IP+YVK+ RTIYE Sbjct: 324 VLVVLDAHPDGIIYRDLIPDYVKFVRTIYE------------------------------ 353 Query: 182 LADDFGDNVVDVNYLNVGTAKPDYQLFIC 268 DD G VDVNYLNVG +PDYQLF+C Sbjct: 354 --DDLGTTAVDVNYLNVGAHEPDYQLFMC 380 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,426,969 Number of Sequences: 27288 Number of extensions: 250993 Number of successful extensions: 492 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 904103924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA15F17.yg.ab1 (527 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g16450.1 expressed protein / ;supported by full-length cDN... 179 6e-46 >At4g16450.1 expressed protein / ;supported by full-length cDNA: Ceres:16090. Length = 106 Score = 179 bits (455), Expect = 6e-46 Identities = 85/100 (85%), Positives = 92/100 (92%) Frame = +3 Query: 60 MNTDITALAKPEYPVIDRNPPFTKTVANFNTLDYLRLTTISGISVTVGYLSGIKPGIRGP 239 MNTDITAL K +YPV+DRNP FTK V NF TLDYLR +TI+GISVTVGYLSGIKPGI+GP Sbjct: 1 MNTDITALEKAQYPVVDRNPAFTKVVGNFRTLDYLRFSTITGISVTVGYLSGIKPGIKGP 60 Query: 240 SMVTGGLIGVMGGFMYAYQNSAGRLMGFFPNDGEVARYKK 359 SMVTGGLIG+MGGFMYAYQNSAGRLMGFFPNDGEVA Y+K Sbjct: 61 SMVTGGLIGLMGGFMYAYQNSAGRLMGFFPNDGEVASYQK 100 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,978,421 Number of Sequences: 27288 Number of extensions: 340149 Number of successful extensions: 2292 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2208 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 736262584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA15I24.yg.ab1 (570 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18660.1 putative protein / 2'-hydroxyisoflavone reductase... 258 1e-69 >At5g18660.1 putative protein / 2'-hydroxyisoflavone reductase (EC 1.3.1.45) - Nicotiana tabacum, PIR:T02202;supported by full-length cDNA: Ceres:17121. Length = 417 Score = 258 bits (660), Expect = 1e-69 Identities = 122/154 (79%), Positives = 137/154 (88%) Frame = +1 Query: 1 KPYVMFGDGKLCACKPISEPDLASFIADCVLSTDKTNQILPIGGPGKALTPLEQGEMLFK 180 KPYVMFGDGKLCACKPISE DLA+FIADCVL +K NQ+LPIGGPGKALTPLEQGE+LFK Sbjct: 262 KPYVMFGDGKLCACKPISEQDLAAFIADCVLEENKINQVLPIGGPGKALTPLEQGEILFK 321 Query: 181 LAGKKPNFIKVPIEIMDFAIGVLDFLVKIFPSMEDVAEFGKIGRYYAAESMLVYDPETKE 360 + G++P F+KVPIEIMDF IGVLD + KIFPS+ + AEFGKIGRYYAAESML+ DPET E Sbjct: 322 ILGREPKFLKVPIEIMDFVIGVLDSIAKIFPSVGEAAEFGKIGRYYAAESMLILDPETGE 381 Query: 361 YKAEETPSYGEDTLEDFFKKVLEEGMAGQELGEQ 462 Y E+TPSYG+DTLEDFF KV+ EGMAGQELGEQ Sbjct: 382 YSEEKTPSYGKDTLEDFFAKVIREGMAGQELGEQ 415 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,219,555 Number of Sequences: 27288 Number of extensions: 304547 Number of successful extensions: 983 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 950 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 983 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 850394780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA16B16.yg.ab1 (644 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58040.1 putative protein / predicted proteins, Drosophila... 115 3e-26 >At5g58040.1 putative protein / predicted proteins, Drosophila melanogaster and Arabidopsis thaliana Length = 1192 Score = 115 bits (287), Expect = 3e-26 Identities = 75/151 (49%), Positives = 91/151 (59%), Gaps = 13/151 (8%) Frame = +1 Query: 25 GLSSSGARVLERSGTEGGGG-------DDWDDSDSEDDLQIVLNDNT-----GGGIMGMD 168 G+S R+ ++ G G GG DDWD SDSEDDLQIVLND++ GG Sbjct: 117 GVSQVTTRIEQQVGGGGDGGYGGQGEGDDWD-SDSEDDLQIVLNDSSRNVMIGGADRRSR 175 Query: 169 VGGGQDEEDDEDGDNLVIVTGNADPNHHHHPPMDDLQDWGEDPSQAAEGAGERKDLLGGE 348 +G +D++D++D D LVIV + DPN PM++ Q WGED Q EG G KD GGE Sbjct: 176 MGDNEDDDDEDDEDPLVIVA-DTDPNQ----PMEE-QMWGEDGLQGIEGDG--KD--GGE 225 Query: 349 AGRPE-VGGATAAQKVGYGSHGYHPFHSQFK 438 AG+ GGAT K GY SHGYHPFHSQFK Sbjct: 226 AGKGSGPGGATGPPKAGYSSHGYHPFHSQFK 256 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,024,570 Number of Sequences: 27288 Number of extensions: 454760 Number of successful extensions: 4261 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3589 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1061984084 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA16E05.yg.ab1 (602 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59140.1 elongin - like protein / elongin C, Drosophila me... 162 9e-41 >At5g59140.1 elongin - like protein / elongin C, Drosophila melanogaster, PIR:JC5794; supported by cDNA: gi_15028384_gb_AY045995.1_ Length = 96 Score = 162 bits (411), Expect = 9e-41 Identities = 79/94 (84%), Positives = 87/94 (92%) Frame = +3 Query: 45 DTVKLISAEGFEFVIDKNAAMVSQTIRNMLTSPGDFAETEHQEVTFPEISTTILEKICQY 224 +TVKLIS EGFEFVID+ AAMVSQTIR+MLTSPG F+E++ VTFP+ISTTILEKICQY Sbjct: 3 ETVKLISMEGFEFVIDREAAMVSQTIRSMLTSPGGFSESKDGVVTFPDISTTILEKICQY 62 Query: 225 FYWSLQYASGKETEFHIEPELTLELMMAANYLHT 326 FYWSLQY+ GKETEFHIEPELTLELMMAANYLHT Sbjct: 63 FYWSLQYSRGKETEFHIEPELTLELMMAANYLHT 96 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,160,274 Number of Sequences: 27288 Number of extensions: 330158 Number of successful extensions: 925 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 898 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 925 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 948861544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA16G16.yg.ab1 (490 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03420.1 expressed protein / similar to Ku70-binding prote... 235 8e-63 >At3g03420.1 expressed protein / similar to Ku70-binding protein GB:AAD31085 [Homo sapiens]; supported by cDNA: gi_13877934_gb_AF370230.1_AF370230 Length = 194 Score = 235 bits (600), Expect = 8e-63 Identities = 103/118 (87%), Positives = 112/118 (94%) Frame = +1 Query: 1 IVVCSNYMNIQDEVNQVVIHELIHAYDDCRAANLDWTNCAHHACSEIRAGHLSGDCHYKR 180 I VCSNY+ IQDEVNQVVIHELIHAYD+CRA NLDWTNCAHHACSEIRAGHLSGDCH+KR Sbjct: 77 ITVCSNYLTIQDEVNQVVIHELIHAYDECRAKNLDWTNCAHHACSEIRAGHLSGDCHFKR 136 Query: 181 ELLRGFVKIRGHEQECVRRRVMKSLANNPYCSEAAAKDAMEAVWETCYNDTKPFDRAP 354 ELLRGF+K+RGHEQEC++RRV+KSL NPYCSE AAKDAMEAVW+TCYNDTKPFDRAP Sbjct: 137 ELLRGFIKLRGHEQECIKRRVLKSLRGNPYCSEVAAKDAMEAVWDTCYNDTKPFDRAP 194 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,784,186 Number of Sequences: 27288 Number of extensions: 227822 Number of successful extensions: 582 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 568 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 582 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 630427000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA16L10.yg.ab1 (489 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g17560.1 putative protein / ;supported by full-length cDN... 137 4e-33 At1g55805.1 Expressed protein / ; supported by cDNA: gi_14488... 47 5e-06 >At5g17560.1 putative protein / ;supported by full-length cDNA: Ceres:9667. Length = 177 Score = 137 bits (344), Expect = 4e-33 Identities = 70/89 (78%), Positives = 76/89 (84%) Frame = +3 Query: 3 TSPSNASGPIDSPLMQSMQNKIKEELNAELVTVNDAYGDGRHVSIDVVSSAFEGKSAVNR 182 +S N +G ID LMQSM+ KIKE+LNAE VTV D GDGRHV I+VVSSAFEG+SAVNR Sbjct: 88 SSQINDAGSIDQTLMQSMELKIKEQLNAESVTVTDMSGDGRHVCINVVSSAFEGQSAVNR 147 Query: 183 QRMVYKAIWEELQNVVHAVDQMTTKTPEE 269 QRMVYKAIWEELQNVVHAVDQMTTKTP E Sbjct: 148 QRMVYKAIWEELQNVVHAVDQMTTKTPSE 176 >At1g55805.1 Expressed protein / ; supported by cDNA: gi_14488091_gb_AF389294.1_AF389294 Length = 109 Score = 47.0 bits (110), Expect = 5e-06 Identities = 33/99 (33%), Positives = 53/99 (53%), Gaps = 13/99 (13%) Frame = +3 Query: 21 SGPIDSPLMQSMQNKIKEELN-AELVTVNDAY------------GDGRHVSIDVVSSAFE 161 SG I++ + M+ K+++EL ELV + +Y D H ++ +VS FE Sbjct: 11 SGAIENRASR-MREKLQKELEPVELVIEDVSYQHAGHAGMKGRTDDETHFNVKIVSKGFE 69 Query: 162 GKSAVNRQRMVYKAIWEELQNVVHAVDQMTTKTPEEAAS 278 G + V R R+VY + EEL +HA+ + +KTP E+ S Sbjct: 70 GMNLVKRHRLVYHLLREELDTGLHAL-SIVSKTPSESPS 107 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,380,336 Number of Sequences: 27288 Number of extensions: 215156 Number of successful extensions: 622 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 630427000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA17D15.yg.ab1 (413 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55540.1 putative protein / similar to unknown protein (gb... 116 5e-27 >At5g55540.1 putative protein / similar to unknown protein (gb|AAD39572.1) Length = 1380 Score = 116 bits (290), Expect = 5e-27 Identities = 49/73 (67%), Positives = 64/73 (87%), Gaps = 1/73 (1%) Frame = +1 Query: 40 RGRGRSTNVQ-QDMKAAHQWVVDFLRERGCSTGKDIAEKFGLWRVRYRDDGQIAWVCRRH 216 R RGR ++Q Q+ +AA QW++D+LRE+ CSTG+DIAEKFGLWRVRYRDDG IAW+C+RH Sbjct: 1308 RNRGRDRDIQEQEQRAAQQWLIDYLREQTCSTGRDIAEKFGLWRVRYRDDGSIAWICKRH 1367 Query: 217 MYTRANEIVEVPL 255 M TRA+E+++VPL Sbjct: 1368 MITRAHEVIQVPL 1380 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,750,292 Number of Sequences: 27288 Number of extensions: 263931 Number of successful extensions: 918 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 874 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 916 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 436222272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA18P22.yg.ab1 (689 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66680.1 dolichyl-di-phosphooligosaccharide-protein glycotran... 347 3e-96 >At5g66680.1 dolichyl-di-phosphooligosaccharide-protein glycotransferase (oligosaccharyltransferase)-like / ;supported by full-length cDNA: Ceres:18419. Length = 437 Score = 347 bits (891), Expect = 3e-96 Identities = 161/203 (79%), Positives = 184/203 (90%) Frame = +1 Query: 1 QARNNARIVFSGSLDLFSNKFFKSPVQKAGSSNKYAKSGNQQFATEISKWVFHERGHLKA 180 QARNNAR+V SGS+ LFS++ +S VQKAGS N+Y KSGN+QF TE+SKWVFHERGHLKA Sbjct: 235 QARNNARVVISGSVQLFSDRLIRSGVQKAGSPNQYEKSGNEQFVTELSKWVFHERGHLKA 294 Query: 181 VNVRHHRVGETDEPSIYRINDDLEYLVEIYEWSGSSWEPYVANDVQVQFYMMSPYVLKTM 360 N+ HHRVGETDEP+IYRI DDLE+ VEIYEWSG SWEPYVANDVQVQFYMMSPYVLKT+ Sbjct: 295 GNLVHHRVGETDEPAIYRIKDDLEFSVEIYEWSGKSWEPYVANDVQVQFYMMSPYVLKTL 354 Query: 361 SSNNKGLYIASFKVPDVYGVFQFKVEYQRLGYTSLSLAKQIPVRPFRHNEYERFIPTAFP 540 S++ KGL+ SFKVPDVYGVFQFKVEY++LGYT+LSL+KQIPVRP+RHNEYERFIPTA+P Sbjct: 355 STDKKGLFHTSFKVPDVYGVFQFKVEYEKLGYTTLSLSKQIPVRPYRHNEYERFIPTAYP 414 Query: 541 YYGASFSTMAAFFIFSFVYLYSK 609 YYGA F+TMA FF+FSFVYLY K Sbjct: 415 YYGACFTTMAGFFVFSFVYLYHK 437 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,294,489 Number of Sequences: 27288 Number of extensions: 335139 Number of successful extensions: 855 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 854 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1183294084 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA19B01.yg.ab1 (523 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27990.1 putative protein / predicted proteins, Saccharomy... 86 9e-18 >At5g27990.1 putative protein / predicted proteins, Saccharomyces cerevisiae and Schizosaccharomyces pombe;supported by full-length cDNA: Ceres:5109. Length = 184 Score = 86.3 bits (212), Expect = 9e-18 Identities = 51/154 (33%), Positives = 90/154 (58%), Gaps = 1/154 (0%) Frame = +2 Query: 2 GRDTRQKAQQLAVDIYQWLIRPSEALY-VDELENLLDDFMLSLNTEIDDGSIEEIADNLM 178 GRD++ KA + ++ + I+ + + +++L +LLD + LNT +DGS++E+A+ L+ Sbjct: 39 GRDSQAKANETVATVFDFFIQSKDPVKDIEKLGDLLDKGLDELNTTAEDGSVDEVANLLV 98 Query: 179 IIHEECLEGNFASIERLRQSAPQIAAASHQMQVVNGGEDDSDSTSSSGDESMEMADGVDP 358 ++E+C GN+ +E LR + Q +A+ ++V NG DD +S D++ +M VD Sbjct: 99 DLYEDCCNGNYEMLEELRATYSQTSAS--VVKVSNG--DDEESDDEDDDQTTDMM--VDA 152 Query: 359 TSNMADMTLNESARPAAPTVDADGWTVVSSRRNR 460 ++ + A P V DGWTVVSSR+N+ Sbjct: 153 SNQ------KQEAMPVDEPVADDGWTVVSSRKNK 180 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,889,690 Number of Sequences: 27288 Number of extensions: 224813 Number of successful extensions: 965 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 961 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 729494100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA19C02.yg.ab1 (256 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54855.1 Expressed protein / ; supported by full-length cD... 100 2e-22 >At5g54855.1 Expressed protein / ; supported by full-length cDNA: Ceres: 9159. Length = 146 Score = 99.8 bits (247), Expect = 2e-22 Identities = 45/67 (67%), Positives = 50/67 (74%) Frame = +2 Query: 2 IYTVAETMPESERWDACLARPISSFHEHCTHLGDGFSGVKFGYNHVSGYSHAVRPFVYRH 181 +YTVAETMPESERWDACLARPISSFH C L +G+KF YN SG+ HAV+PFVYR Sbjct: 80 VYTVAETMPESERWDACLARPISSFHTPCNRLHQTNTGIKFTYNRPSGFFHAVKPFVYRP 139 Query: 182 ASIPMYC 202 P YC Sbjct: 140 QYAPSYC 146 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,801,086 Number of Sequences: 27288 Number of extensions: 110320 Number of successful extensions: 290 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 290 length of database: 11,516,596 effective HSP length: 60 effective length of database: 9,879,316 effective search space used: 237103584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA19L01.yg.ab1 (592 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25400.1 unknown protein / 111 3e-25 >At3g25400.1 unknown protein / Length = 99 Score = 111 bits (277), Expect = 3e-25 Identities = 52/71 (73%), Positives = 61/71 (85%) Frame = +3 Query: 156 VGEVGELSEIFQWKGEVERGLPNWSDDDKEHLEEELSDVLLYLVQLADVCGLDLGQAALS 335 VGEVGELSEIFQWKGEV RG P+W +++K HL EELSDVLLYLV+L+D CG+DLG+AAL Sbjct: 4 VGEVGELSEIFQWKGEVARGCPDWKEEEKVHLGEELSDVLLYLVRLSDACGVDLGKAALR 63 Query: 336 KIVKNAQKYPI 368 KI NA KYP+ Sbjct: 64 KIELNAIKYPV 74 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,782,592 Number of Sequences: 27288 Number of extensions: 316433 Number of successful extensions: 1047 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1033 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 913055448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA1c03.yg.ab1 (492 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g01710.1 putative actin polymerization factor / similar to... 233 3e-62 >At4g01710.1 putative actin polymerization factor / similar to human ARP2/3 complex 16 kd subunit, GenBank accession number O15511 likely functions to control the polymerization of actin; supported by cDNA: gi_15529134_gb_AY052191.1_ Length = 132 Score = 233 bits (595), Expect = 3e-62 Identities = 115/132 (87%), Positives = 121/132 (91%) Frame = +3 Query: 21 MGEHVEADNAEAIITRIEHKSRKIESLLKQYKPVEALKTALEGSPPKTRDERCKSANWIV 200 M E VEADNAEAII RIE KSRKIESLLKQYK VEALKTALEGSPPKTRDERCKSANWIV Sbjct: 1 MAEFVEADNAEAIIARIETKSRKIESLLKQYKHVEALKTALEGSPPKTRDERCKSANWIV 60 Query: 201 VHRALMAIKDVDLMFTSLDPEYYDILMKYLYRGLSTGDRPTCDQCLRIHEKLTHKAGLGC 380 VHRALMAIKD+D M +LD EYYDILMKYLYRGLSTGDRPTCDQCL+IHEKLT +AGLGC Sbjct: 61 VHRALMAIKDIDGMLNALDVEYYDILMKYLYRGLSTGDRPTCDQCLKIHEKLTERAGLGC 120 Query: 381 ILRALSDTVNTV 416 ILR L+DT+NTV Sbjct: 121 ILRCLTDTINTV 132 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,891,207 Number of Sequences: 27288 Number of extensions: 263476 Number of successful extensions: 751 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 751 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 639433100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA20G07.yg.ab1 (484 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13225.1 hypothetical protein / predicted by genemark.hmm 103 3e-23 >At3g13225.1 hypothetical protein / predicted by genemark.hmm Length = 863 Score = 103 bits (258), Expect = 3e-23 Identities = 48/82 (58%), Positives = 63/82 (76%), Gaps = 2/82 (2%) Frame = +2 Query: 2 ANFQPLGGDWRERVRRKR--AKKSMEAEDKEAKGTVDTTNQKPDLVQLTKQLPSPWQAYW 175 ANFQPLGGDWRE+V+RKR A+KS + + ++ QKPDL +L+ LPS WQAYW Sbjct: 788 ANFQPLGGDWREKVKRKRERAEKSQKKDPEK--------QQKPDLTKLSANLPSEWQAYW 839 Query: 176 DEASKQVYYGNSKTSETSWTKP 241 DE++K+VYYGN+ TS+TSWT+P Sbjct: 840 DESTKKVYYGNTSTSQTSWTRP 861 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,035,752 Number of Sequences: 27288 Number of extensions: 234320 Number of successful extensions: 941 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 940 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 623303772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA20M11.yg.ab1 (756 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g22750.1 expressed protein / strong similarity to hypothet... 122 3e-57 >At1g22750.1 expressed protein / strong similarity to hypothetical protein gb|Y09823 from A. thaliana. ESTs gb|T76118, gb|T04263 and gb|ATYU9823 come from this gene; supported by cDNA: gi_15292832_gb_AY050850.1_ Length = 244 Score = 122 bits (307), Expect(2) = 3e-57 Identities = 59/113 (52%), Positives = 75/113 (66%) Frame = +2 Query: 353 KGLSVVIARVIFGVLGCLMLGTLLYTLIVDGSPFRAELYTPWIVATLIDFYINVVALSVW 532 K VV AR +FG LGC+MLG L+YT GSPF EL PW+V L++FYI+V LSVW Sbjct: 129 KNSLVVTARFVFGALGCVMLGALVYTCFTYGSPFHMELLYPWMVVLLVNFYIDVAVLSVW 188 Query: 533 IAYKESSWISALLWIVFLVCCGSITTCVYIVKQLFYLSPDQPISLILFKNNHR 691 + YKESS I +LW+ L+ GS+ T IV QLF LSP P+ L+L N++R Sbjct: 189 VVYKESSLIIGILWVALLIGLGSVGTSAVIVVQLFRLSPLDPLYLVLVNNSNR 241 Score = 117 bits (292), Expect(2) = 3e-57 Identities = 52/107 (48%), Positives = 77/107 (71%), Gaps = 2/107 (1%) Frame = +1 Query: 7 VRTLLSVLGCFMVAVLIYTIATDGLPF--RTELLTRWMAALLIDFYIHIAIIGAWVVYKE 180 ++ +L V+ C M+A L+YTI TDGLP R ++ T W ++DFYI++ I W+VYKE Sbjct: 10 LKVVLPVMFCLMLATLVYTIITDGLPLPDRQDVFTPWFVTTILDFYINLVPIAVWIVYKE 69 Query: 181 SSWIIASVWVILLICFGSVTTCGYIVLQFYKLTPEESSKDPIYFVLV 321 S+W + +W ILLI FGS+TTC Y+ LQ KLT +E+S+DP+Y++L+ Sbjct: 70 STWSGSILWTILLIIFGSLTTCVYLFLQLLKLTNQEASEDPMYYLLL 116 Score = 112 bits (279), Expect = 3e-25 Identities = 50/112 (44%), Positives = 78/112 (69%), Gaps = 6/112 (5%) Frame = +2 Query: 377 RVIFGVLGCLMLGTLLYTLIVDGSPF--RAELYTPWIVATLIDFYINVVALSVWIAYKES 550 +V+ V+ CLML TL+YT+I DG P R +++TPW V T++DFYIN+V ++VWI YKES Sbjct: 11 KVVLPVMFCLMLATLVYTIITDGLPLPDRQDVFTPWFVTTILDFYINLVPIAVWIVYKES 70 Query: 551 SWISALLWIVFLVCCGSITTCVYIVKQLFYL----SPDQPISLILFKNNHRD 694 +W ++LW + L+ GS+TTCVY+ QL L + + P+ +L +++ +D Sbjct: 71 TWSGSILWTILLIIFGSLTTCVYLFLQLLKLTNQEASEDPMYYLLLRDSIKD 122 Score = 109 bits (272), Expect = 2e-24 Identities = 55/112 (49%), Positives = 70/112 (62%) Frame = +1 Query: 1 VAVRTLLSVLGCFMVAVLIYTIATDGLPFRTELLTRWMAALLIDFYIHIAIIGAWVVYKE 180 V R + LGC M+ L+YT T G PF ELL WM LL++FYI +A++ WVVYKE Sbjct: 134 VTARFVFGALGCVMLGALVYTCFTYGSPFHMELLYPWMVVLLVNFYIDVAVLSVWVVYKE 193 Query: 181 SSWIIASVWVILLICFGSVTTCGYIVLQFYKLTPEESSKDPIYFVLVTHQKR 336 SS II +WV LLI GSV T IV+Q ++L+P DP+Y VLV + R Sbjct: 194 SSLIIGILWVALLIGLGSVGTSAVIVVQLFRLSP----LDPLYLVLVNNSNR 241 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,632,101 Number of Sequences: 27288 Number of extensions: 406485 Number of successful extensions: 1026 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1023 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA21F08.yg.ab1 (396 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77710.1 unknown protein / similar to hypothetical protein... 163 3e-41 >At1g77710.1 unknown protein / similar to hypothetical protein GB:P34661 [Caenorhabditis elegans]; supported by cDNA: gi_20260379 Length = 93 Score = 163 bits (412), Expect = 3e-41 Identities = 80/83 (96%), Positives = 82/83 (98%) Frame = +1 Query: 1 GKVSFKVILTSDPKLPFKVFSVPEGAPFTAVLKYAAEEFKVPPQTSAIITNDGVGINPQQ 180 GKVSFKV LTSDPKLPFKVFSVPEGAPFTAVLK+AAEEFKVPPQTSAIITNDG+GINPQQ Sbjct: 5 GKVSFKVTLTSDPKLPFKVFSVPEGAPFTAVLKFAAEEFKVPPQTSAIITNDGIGINPQQ 64 Query: 181 SAGNVFLKHGSELRLIPRDRVGA 249 SAGNVFLKHGSELRLIPRDRVGA Sbjct: 65 SAGNVFLKHGSELRLIPRDRVGA 87 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,397,462 Number of Sequences: 27288 Number of extensions: 173195 Number of successful extensions: 739 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 391955836 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA21N22.yg.ab1 (428 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55610.1 unknown protein / 90 5e-19 >At5g55610.1 unknown protein / Length = 329 Score = 89.7 bits (221), Expect = 5e-19 Identities = 41/60 (68%), Positives = 50/60 (83%) Frame = +3 Query: 3 EQVKGLGKKVYGVTVRCGASLLFASIGAGIGATLFRPSTGQSVGCLIGDLAGPIIVSFCL 182 +Q K LG KV G+TVRCGASL+FA+IGAGI + L RPSTGQ +GC +GDLAGP++VS CL Sbjct: 262 QQAKDLGNKVVGITVRCGASLVFAAIGAGICSCLIRPSTGQWIGCALGDLAGPMVVSVCL 321 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,031,619 Number of Sequences: 27288 Number of extensions: 218333 Number of successful extensions: 636 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 634 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 481662092 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA3d10.yg.ab1 (475 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g46030.1 expressed protein / similar to unknown protein (p... 166 7e-42 >At5g46030.1 expressed protein / similar to unknown protein (pir||T27174); supported by full-length cDNA: Ceres: 15222. Length = 120 Score = 166 bits (419), Expect = 7e-42 Identities = 75/94 (79%), Positives = 87/94 (91%) Frame = +3 Query: 15 MGKRKSRAKPAPRKRMDKLDTVFSCPFCNHGTSVECRIDMKNLIGEASCRICQENFSTTV 194 MGKRKSRAKPAP KRMDKLDT+FSCPFCNHG+SVEC IDMK+LIG+A+CRIC+E+FSTT+ Sbjct: 1 MGKRKSRAKPAPTKRMDKLDTIFSCPFCNHGSSVECIIDMKHLIGKAACRICEESFSTTI 60 Query: 195 TALTEPIDIYSEWIDECERVNTVDEDGVPVEDDE 296 TALTE IDIYSEWIDECERVNT ++D V E++E Sbjct: 61 TALTEAIDIYSEWIDECERVNTAEDDVVQEEEEE 94 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,722,436 Number of Sequences: 27288 Number of extensions: 233584 Number of successful extensions: 917 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 911 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 596203608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA5C07.yg.ab1 (670 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g36980.1 expressed protein / ; supported by cDNA: gi_15292... 254 4e-68 >At1g36980.1 expressed protein / ; supported by cDNA: gi_15292702_gb_AY050785.1_ Length = 135 Score = 254 bits (648), Expect = 4e-68 Identities = 115/135 (85%), Positives = 126/135 (93%) Frame = +2 Query: 59 MDLSELWAIFGPGFAGAVFGAGWWFWVDAVVCSSVQVSFLHYLPGIFASLAALMFNCVRR 238 MDL+ELWAIFGPGF+GAVFG GWWFWVDAVVCSS+QV F+HYLPGIFASL ALMFNCVR+ Sbjct: 1 MDLAELWAIFGPGFSGAVFGTGWWFWVDAVVCSSIQVPFVHYLPGIFASLGALMFNCVRK 60 Query: 239 EDIDYSPYEEGEWRLKLWLFLAYVVSFVSLAASVGLLIQDALVPEGPSAWTGTAGVLQCV 418 EDIDYSPY+EGEWRLKLWLF+AYVV+FVSLAASVGLLIQD++V GPS WTG AGV QCV Sbjct: 61 EDIDYSPYDEGEWRLKLWLFIAYVVAFVSLAASVGLLIQDSVVKTGPSTWTGVAGVFQCV 120 Query: 419 LVLISGLVYWTSHSE 463 VLISGL+YWTSHSE Sbjct: 121 FVLISGLMYWTSHSE 135 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,993,486 Number of Sequences: 27288 Number of extensions: 378238 Number of successful extensions: 1183 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1181 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA5J19.yg.ab1 (409 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g31860.1 phosphoribosyl-ATP pyrophosphohydrolase (At-IE) / ... 99 1e-21 >At1g31860.1 phosphoribosyl-ATP pyrophosphohydrolase (At-IE) / identical to phosphoribosyl-ATP pyrophosphohydrolase (At-IE) [Arabidopsis thaliana] GI:3461884 (Plant Physiol. 118 (1), 275-283 (1998)); supported by full-length cDNA: Ceres: 25538. Length = 281 Score = 98.6 bits (244), Expect = 1e-21 Identities = 49/62 (79%), Positives = 55/62 (88%) Frame = +3 Query: 3 EADELCRTLEENEDESRSVSEMADVLYHEMVLLIRRGLKFEDVLEVLRCRFTQSGIEEKN 182 EADELCRTLE+NE+ SR+ SEMADVLYH MVLL +RG+K EDVLEVLR RF+QSGIEEK Sbjct: 218 EADELCRTLEDNEEVSRTPSEMADVLYHAMVLLSKRGVKMEDVLEVLRKRFSQSGIEEKQ 277 Query: 183 NR 188 NR Sbjct: 278 NR 279 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,064,520 Number of Sequences: 27288 Number of extensions: 150931 Number of successful extensions: 472 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 466 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 418046344 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA5M06.yg.ab1 (607 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32690.1 Expressed protein / ; supported by cDNA: gi_14165... 246 7e-66 >At4g32690.1 Expressed protein / ; supported by cDNA: gi_14165162_gb_AF376062.1_AF376062 Length = 175 Score = 246 bits (628), Expect = 7e-66 Identities = 117/158 (74%), Positives = 136/158 (86%), Gaps = 5/158 (3%) Frame = +3 Query: 3 DAFSIDEVNLFEKLGLQTFINLSTDFYTRVYDEGEEWFRSIFADSKKEDAIQNQYEFFVQ 182 +AF+IDE NLF+KLGLQTFINLST+FYTRVYD+ EEWF+SIF++S KEDAIQNQYEFFVQ Sbjct: 18 EAFAIDESNLFDKLGLQTFINLSTNFYTRVYDDEEEWFQSIFSNSNKEDAIQNQYEFFVQ 77 Query: 183 RMGGPPLYSQRKGHPALIGRHRPFLVTHKAAERWLHHMQQALDNTTDIDHDSKTRMLNFF 362 RMGGPPLYSQRKGHPALIGRHRPF VTH+AAERWL HMQ ALD++ DID DSK +M+ FF Sbjct: 78 RMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALDDSVDIDQDSKIKMMKFF 137 Query: 363 RHTAYFLVAGNDLKSQSQGAP-----PCKNGTNKPAAE 461 RHTA+FLVAGN+LK+Q++ CK+ NKPA E Sbjct: 138 RHTAFFLVAGNELKNQNEKPKHKPQCACKHAANKPAEE 175 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,594,790 Number of Sequences: 27288 Number of extensions: 301912 Number of successful extensions: 743 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 742 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 957813068 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA5N24.yg.ab1 (436 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15030.1 putative protein / 155 6e-39 >At4g15030.1 putative protein / Length = 179 Score = 155 bits (393), Expect = 6e-39 Identities = 82/139 (58%), Positives = 94/139 (66%) Frame = +2 Query: 17 LPIKTDQDTLREGYRFIRSEEDDMDFSWEQRLVKRYYDKLFKEYCIADMSHYKSGKIGLR 196 LP+KTDQDTLREGYRFIRSEEDD+D SWEQRLVKRYYDKLFKEYCIADMS YK+GK+GLR Sbjct: 11 LPVKTDQDTLREGYRFIRSEEDDLDPSWEQRLVKRYYDKLFKEYCIADMSKYKTGKMGLR 70 Query: 197 WRTEKEVTSGKGQFVCGNKHCNEEEGLTSYEVNFAYFEAGENKQALVKLVTCERCAKKLV 376 WRTEKEV +GK AGE+KQALVKLV CER Sbjct: 71 WRTEKEVMTGK---------------------------AGEDKQALVKLVACERSKSHSE 103 Query: 377 YKKMKEKEKEESKRREKEE 433 +E++++E +R E E Sbjct: 104 DDTDEEEKRKEGERSESNE 122 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,280,117 Number of Sequences: 27288 Number of extensions: 197796 Number of successful extensions: 1085 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1049 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 489276504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA6G19.yg.ab1 (358 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76200.1 expressed protein / ; supported by full-length cD... 132 4e-32 >At1g76200.1 expressed protein / ; supported by full-length cDNA: Ceres: 20257. Length = 69 Score = 132 bits (331), Expect = 4e-32 Identities = 55/69 (79%), Positives = 61/69 (87%), Gaps = 2/69 (2%) Frame = +3 Query: 33 MAGGGYGQG-TYKGVNLHQPKRWHTVTGKGMCAMMWFWILYRAKQDGPVVLGWRHPWEGH 209 M GGG+G G TYKGV +H PK WHTVTGKG+CA+MWFWILYRAKQDGPVV+GWRHPW+GH Sbjct: 1 MGGGGHGGGITYKGVTVHTPKTWHTVTGKGLCAVMWFWILYRAKQDGPVVMGWRHPWDGH 60 Query: 210 G-HGHGDEH 233 G HGHGD H Sbjct: 61 GDHGHGDHH 69 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,909,078 Number of Sequences: 27288 Number of extensions: 204440 Number of successful extensions: 631 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 615 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 214836576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA6G22.yg.ab1 (431 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21105.1 Expressed protein / ; supported by full-length cD... 115 7e-27 >At4g21105.1 Expressed protein / ; supported by full-length cDNA: Ceres: 23587. Length = 68 Score = 115 bits (289), Expect = 7e-27 Identities = 53/68 (77%), Positives = 64/68 (93%) Frame = +3 Query: 36 MVEEPPFRPREKLIEKQKMYQSIQKHTYLKGPMDKITSVAIPLALAGSSLYLIGRGIYNM 215 M+ E PFRPREKL+EKQ+++QSIQ+HTYLKGPMDKITSVAIP+ALA SSLY+IG GIYNM Sbjct: 1 MLTETPFRPREKLLEKQRLFQSIQRHTYLKGPMDKITSVAIPIALAASSLYMIGTGIYNM 60 Query: 216 SHGIGRKD 239 S+GIG+K+ Sbjct: 61 SNGIGKKE 68 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,710,353 Number of Sequences: 27288 Number of extensions: 205757 Number of successful extensions: 531 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 531 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 480215828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA6H08.yg.ab1 (506 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g18593.1 Expressed protein / ; supported by full-length cD... 112 1e-25 >At4g18593.1 Expressed protein / ; supported by full-length cDNA: Ceres: 29009. Length = 142 Score = 112 bits (280), Expect = 1e-25 Identities = 44/85 (51%), Positives = 66/85 (76%) Frame = +1 Query: 1 EGESSFEWHRRRSDNYFNKYDELECTSIFVEPLRWMKTVEEGALEGKLWCSHCEGRLGYF 180 +GE F W +R ++ ++++C+SIFVEP++WM+T+ +G +E KL C C GRLGYF Sbjct: 49 KGEECFAWKKRSGNS-----EQVQCSSIFVEPMKWMQTIHDGMVEEKLLCFGCNGRLGYF 103 Query: 181 NWSGIQCSCGSWITPAFQLHRSRVD 255 NW+G+QCSCG+W+ PAFQL++SR+D Sbjct: 104 NWAGMQCSCGAWVNPAFQLNKSRID 128 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,046,163 Number of Sequences: 27288 Number of extensions: 237936 Number of successful extensions: 680 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 684463600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA6H24.yg.ab1 (635 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g02620.1 putative vacuolar ATPase / similar to vacuolar AT... 219 9e-58 >At4g02620.1 putative vacuolar ATPase / similar to vacuolar ATPase, GenBank accession number P50408;supported by full-length cDNA: Ceres:10207. Length = 128 Score = 219 bits (558), Expect = 9e-58 Identities = 104/126 (82%), Positives = 119/126 (93%) Frame = +3 Query: 93 MASRAQIPTNNSALIAMIADEDTITGFLLAGVGNVDIRRKTNYMIVDSKTTVKQIEDAFK 272 MA RA IP NSALIAMIADEDT+ GFL+AGVGNVDIRRKTNY+IVDSKTTV+QIEDAFK Sbjct: 1 MAGRATIPARNSALIAMIADEDTVVGFLMAGVGNVDIRRKTNYLIVDSKTTVRQIEDAFK 60 Query: 273 EFTTRDDVAIVLISQYVANMIRFVVDSYNNPIPAILEIPSKDHPYDPAHDSVLSRVKYLF 452 EF+ RDD+AI+L+SQY+ANMIRF+VDSYN P+PAILEIPSKDHPYDPAHDSVLSRVKYLF Sbjct: 61 EFSARDDIAIILLSQYIANMIRFLVDSYNKPVPAILEIPSKDHPYDPAHDSVLSRVKYLF 120 Query: 453 NSDSVA 470 +++SV+ Sbjct: 121 SAESVS 126 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,666,826 Number of Sequences: 27288 Number of extensions: 299377 Number of successful extensions: 777 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 777 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA6K13.yg.ab1 (313 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g23395.1 unknown protein / predicted by genemarkHMM 144 1e-35 >At5g23395.1 unknown protein / predicted by genemarkHMM Length = 162 Score = 144 bits (362), Expect = 1e-35 Identities = 71/99 (71%), Positives = 84/99 (84%), Gaps = 1/99 (1%) Frame = +1 Query: 16 SGSESESSSPPSMESLLAEAAAFGNED-ESLSMEAKAQKALECPCIQNLRSGPCGSQFSD 192 S +SE +S PSM+SLLAEAAA+G +D E+ S+EAKAQ+AL+CPCI +LR+G CGSQFS+ Sbjct: 26 SPRDSEDTSSPSMDSLLAEAAAYGEDDNENESLEAKAQRALDCPCIADLRNGSCGSQFSE 85 Query: 193 AFLCFLKSTAEEKGSDCVIPFVALQRCIKTNPNAFPKDV 309 AFLCFLKSTAEEKGSDCV PFVALQ CI NP+AF K V Sbjct: 86 AFLCFLKSTAEEKGSDCVNPFVALQSCINANPDAFSKSV 124 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.310 0.126 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,866,611 Number of Sequences: 27288 Number of extensions: 164868 Number of successful extensions: 589 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 11,516,596 effective HSP length: 79 effective length of database: 9,360,844 effective search space used: 224660256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA6O06.yg.ab1 (439 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06780.1 expressed protein / ; supported by cDNA: gi_15450... 93 6e-20 >At3g06780.1 expressed protein / ; supported by cDNA: gi_15450370_gb_AY052286.1_ Length = 201 Score = 92.8 bits (229), Expect = 6e-20 Identities = 47/81 (58%), Positives = 52/81 (64%), Gaps = 12/81 (14%) Frame = +1 Query: 4 GFFGGGDGPFGGGGGS-----------GGGGNFHGFNWDESSSSS-SDPAFDFVYEALTW 147 G FGG DGPFG GGG GGGG F NWD SS SS SDPA +FVYE + W Sbjct: 108 GDFGGSDGPFGFGGGGNDGGGKGWNYGGGGGGFGRDNWDGSSFSSWSDPAMEFVYEVICW 167 Query: 148 FVLSNCLHFALKRVVRMVADG 210 LSNC+HFA KR+VR+V DG Sbjct: 168 IALSNCVHFAFKRIVRIVTDG 188 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,037,747 Number of Sequences: 27288 Number of extensions: 300509 Number of successful extensions: 15294 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2419 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8975 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 498337180 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA8A18.yg.ab1 (711 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g45050.1 putative protein / 159 1e-39 >At3g45050.1 putative protein / Length = 148 Score = 159 bits (402), Expect = 1e-39 Identities = 78/121 (64%), Positives = 89/121 (73%) Frame = +2 Query: 212 KPKETLIPNGLPETAASVAVAATVVGAAATLLARRTKSVEAANATPTRPCEDCGGSGICS 391 K T++P L ETA S+A+AATVVG AAT+L RR + CE C GSGIC Sbjct: 28 KRSSTVVP-ALAETAVSIAIAATVVGTAATILVRRNNKASEEAEASMKECEACLGSGICP 86 Query: 392 ECKGEGFVVKRMSDSSAEKARLNAKNMATRYTAGLPKKWSYCTKCLSARSCKSCDGSGKL 571 ECKGEGFV+K++SD++AEKARL AKNMATRYTAGLPKKWSYCTKC S RSC C GSGK Sbjct: 87 ECKGEGFVLKKLSDANAEKARLAAKNMATRYTAGLPKKWSYCTKCSSTRSCMICGGSGKT 146 Query: 572 S 574 S Sbjct: 147 S 147 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,329,587 Number of Sequences: 27288 Number of extensions: 408500 Number of successful extensions: 1356 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1352 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1245572720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA8B24.yg.ab1 (565 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g52730.1 ubiquinol--cytochrome-c reductase-like protein / ... 116 7e-27 >At3g52730.1 ubiquinol--cytochrome-c reductase-like protein / ubiquinol--cytochrome-c reductase, 8K chain, potato, PIR:T07369; supported by cDNA: gi_15451023_gb_AY054592.1_ Length = 72 Score = 116 bits (291), Expect = 7e-27 Identities = 54/68 (79%), Positives = 58/68 (84%) Frame = +3 Query: 78 SAARKSGGLFEGLYKVLMRRNSVYVTFVIAGAFIGERAVDYGVHKLWENNNVGKRYEDIP 257 +A R G FEG YK++MRRNSVYVTF+IAGAF GERAVDYGVHKLWE NNVGKRYEDI Sbjct: 4 AARRNQKGAFEGFYKLIMRRNSVYVTFIIAGAFFGERAVDYGVHKLWERNNVGKRYEDIS 63 Query: 258 VLGQRPTE 281 VLGQRP E Sbjct: 64 VLGQRPVE 71 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,522,735 Number of Sequences: 27288 Number of extensions: 269411 Number of successful extensions: 805 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 832491732 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGA9F21.yg.ab1 (687 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54770.1 thiazole biosynthetic enzyme precursor (ARA6) (sp Q3... 277 3e-75 >At5g54770.1 thiazole biosynthetic enzyme precursor (ARA6) (sp Q38814) / ; supported by cDNA: gi_1113782_gb_U17589.1_ATU17589 Length = 349 Score = 277 bits (709), Expect = 3e-75 Identities = 134/163 (82%), Positives = 149/163 (91%) Frame = +1 Query: 19 AGDLIIKGGRVSGVVTNWALVAMNHDTQSCMDPNVMEAKVVVSSCGHDGPMGATGVKRLR 198 A DLI+KG RV GVVTNWALVA NH TQSCMDPNVMEAK+VVSSCGHDGP GATGVKRL+ Sbjct: 187 AEDLIVKGNRVGGVVTNWALVAQNHHTQSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLK 246 Query: 199 SVGLIESVPGMKALDMNAAEDAIVKLTREIVPGMIVTGMEVAEIDGSPRMGPTFGAMMIS 378 S+G+I+ VPGMKALDMN AEDAIV+LTRE+VPGMIVTGMEVAEIDG+PRMGPTFGAMMIS Sbjct: 247 SIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMIS 306 Query: 379 GQKAAHLALRALGLPNALDGTSVGSVHPEMILAAVDSGETVDA 507 GQKA LAL+ALGLPNA+DGT VG++ PE++LAA DS ETVDA Sbjct: 307 GQKAGQLALKALGLPNAIDGTLVGNLSPELVLAAADSAETVDA 349 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,755,484 Number of Sequences: 27288 Number of extensions: 397078 Number of successful extensions: 1538 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1522 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1174397136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB10P09.yg.ab1 (693 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g28720.1 hypothetical protein / 268 2e-72 >At3g28720.1 hypothetical protein / Length = 687 Score = 268 bits (686), Expect = 2e-72 Identities = 135/196 (68%), Positives = 165/196 (83%), Gaps = 2/196 (1%) Frame = -1 Query: 582 AAISSDHYHVITPF-SSNTNHRLSLTHMLALDVDLSSPSLSSKLSDKIKSEIATTASPLR 406 AA+++D++HVI+P S+TNH+L ++H L LD LS SLS++L +K+ I++T S LR Sbjct: 113 AAVTNDNFHVISPSPDSSTNHKLVISHSLHLDASLSPQSLSTRLDSTLKTLISSTTSSLR 172 Query: 405 SNLISISYTTIDSIIKQDFEKEKPTKG-VYIYLLNLGSQSKPYAYKYTDTGESSLGVTKC 229 SNL+SI Y ID IIKQ++EKEK G VYIYL++LGSQ+KPYAY Y+ G+SS G TKC Sbjct: 173 SNLLSIQYNPIDEIIKQEYEKEKHGDGGVYIYLISLGSQAKPYAYSYSH-GDSSAGFTKC 231 Query: 228 SGSIWTGKDRYLWIDLSAGPVDYGPALSGDGVLPRGEFHPLTALHGRPKSQKALLADMAS 49 GSIWTGKDRYLWIDLSAGPVDYGPALSGDGVLPRGEFHPL ALHGRPKS+KALLAD+AS Sbjct: 232 LGSIWTGKDRYLWIDLSAGPVDYGPALSGDGVLPRGEFHPLAALHGRPKSEKALLADLAS 291 Query: 48 LVWSAYKVLLVPSLRI 1 LV++AY+VL+VPSLRI Sbjct: 292 LVYNAYQVLIVPSLRI 307 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,933,211 Number of Sequences: 27288 Number of extensions: 440635 Number of successful extensions: 3072 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2439 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1192191032 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB11A05.yg.ab1 (615 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g55300.1 Serine/arginine-rich protein, putative / similar ... 185 1e-47 >At1g55300.1 Serine/arginine-rich protein, putative / similar to GI:6572475 from [Arabidopsis thaliana] Length = 203 Score = 185 bits (470), Expect = 1e-47 Identities = 85/117 (72%), Positives = 106/117 (89%) Frame = +1 Query: 253 DECQPFLHITEDGRNGTFVIGDDQFPASLLDLPSILESYKTYDDNVLIKTADIGQMIMIR 432 DE L +EDGRNGTF+IG+D+FPASLLDLP+++ES+KTYDD L+KTADIGQMIM+R Sbjct: 29 DEIPLDLFFSEDGRNGTFMIGNDEFPASLLDLPAVVESFKTYDDCALVKTADIGQMIMVR 88 Query: 433 EDGDPAPDGMEYRHGVTPPMRDARRRRFRREPDLNPELVQRVEKDLLNIMNGGMLKS 603 E GDPAP+ +EYRHG+TPPM+DAR+RRFRREPDLNPELVQRVE+DLLNI++GG +++ Sbjct: 89 EPGDPAPNTVEYRHGLTPPMKDARKRRFRREPDLNPELVQRVERDLLNILSGGTVEN 145 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,353,152 Number of Sequences: 27288 Number of extensions: 294033 Number of successful extensions: 645 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 645 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 972741724 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB11H21.yg.ab1 (602 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g51510.1 expressed protein / ;supported by full-length cD... 80 8e-16 >At5g51510.1 expressed protein / ;supported by full-length cDNA: Ceres:20287. Length = 170 Score = 80.1 bits (196), Expect = 8e-16 Identities = 49/137 (35%), Positives = 78/137 (56%) Frame = +1 Query: 4 KSTLSKVLVVQAVVVLLGVVDILFTLLNKEPLEILAAASISITLISIIIGELGRKRSRVS 183 K+ L ++ VQA + ++G+ T K+ LA A+ L+ +IGELG +RSRV+ Sbjct: 36 KARLRPLIFVQAAIYVIGLSCAFLTTTKKDEKNTLAIAAAVAGLVCSLIGELGCRRSRVN 95 Query: 184 LLKLYMAASSVGILGSIASIAQLKATTPLLVGLSNWETDKFDLLKIACVSVGLFVQIFSI 363 LL+LY AAS++ ++ S+ + + T + S+ T K +L C +G VQI +I Sbjct: 96 LLRLYTAASTIVMVLSVFCAVRSRLT--MEERNSSGTTAKLELAGFICAQLGAVVQILAI 153 Query: 364 SKTTSLIGNMSPPKRAS 414 T SL+ NMSPP +A+ Sbjct: 154 IVTGSLVNNMSPPTKAA 170 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,157,195 Number of Sequences: 27288 Number of extensions: 274441 Number of successful extensions: 699 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 698 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 948861544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB11I02.yg.ab1 (712 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53280.1 putative protein / similar to unknown protein (gb... 228 2e-60 At2g16070.1 expressed protein / ;supported by full-length cDN... 53 1e-07 >At5g53280.1 putative protein / similar to unknown protein (gb|AAD26950.1); supported by full-length cDNA: Ceres: 33791. Length = 272 Score = 228 bits (582), Expect = 2e-60 Identities = 128/238 (53%), Positives = 165/238 (68%), Gaps = 17/238 (7%) Frame = +3 Query: 3 EMEEVEAVLEKIWDLHDKLSDAIHSISRSHFLLSVKALRSSNDLFDRAADNNKKVSDDEV 182 E+EE+EAVLEKIWDLHDKLSD IH IS+SHFL SVK S N S ++ Sbjct: 5 EIEEIEAVLEKIWDLHDKLSDEIHLISKSHFLKSVKPSNRSEK-----RKNPHGNSGEDK 59 Query: 183 KGGFVYVKDFPIEEDAHSAIHEAKSLNSIRTALENLEDQLEFFHTVQTQQRAERDAAIAR 362 + G+V++K F ++ D S I EAKSLN+IRTALENLEDQLEFFHT+ TQQR E+D AIAR Sbjct: 60 RPGYVFIKGFAVD-DNDSTIQEAKSLNAIRTALENLEDQLEFFHTIHTQQRTEKDVAIAR 118 Query: 363 LEESRIVLALRLADHHGKNYKVIEEARAFVGQVQNHS---------------CSYNNIEK 497 LE+SRI+LA+RLA+HHGKNY V+EEA AFVG ++++S N+I Sbjct: 119 LEQSRILLAMRLAEHHGKNYGVLEEALAFVGSIKSNSHYVSPDHLYDSSRNPDGANSIPD 178 Query: 498 --KSNILVNVVISSFNFAKKSLKGDNVGGLFGNAALFAXSMLALLHLHHVADRDGEHH 665 +SN ++N S+F FAK++L ++V G+ GNAA+FA S++A+LHLH VA EHH Sbjct: 179 GIESNFVINAFASTFGFAKRALGFNHVKGVLGNAAIFAISVVAMLHLHQVA--TSEHH 234 >At2g16070.1 expressed protein / ;supported by full-length cDNA: Ceres:95679. Length = 307 Score = 53.1 bits (126), Expect = 1e-07 Identities = 45/155 (29%), Positives = 75/155 (48%), Gaps = 5/155 (3%) Frame = +3 Query: 9 EEVEAVLEKIWDLHDKLSDAIHSISRSHFLLSVKALRSSNDLFDRAADNNKKVSDDEVKG 188 E + +L + +L K+SD I + SS + D D N+ +S E + Sbjct: 5 EGIGLILARATELRLKISDCIDN--------------SSTTVSDNG-DGNEDLSPGEGRK 49 Query: 189 GFVYV---KDFPI--EEDAHSAIHEAKSLNSIRTALENLEDQLEFFHTVQTQQRAERDAA 353 + KDF ED A EA+ L IR ALE LE QL ++ +Q+ E+ A Sbjct: 50 SEIIGNQDKDFDSISSEDVDEA--EAERLLRIRDALEALESQLASLQNLRQRQQYEKQLA 107 Query: 354 IARLEESRIVLALRLADHHGKNYKVIEEARAFVGQ 458 ++ ++ SR +L +L ++ GK+++V+ E F G+ Sbjct: 108 LSEIDYSRKMLLEKLKEYKGKDFEVLRETTTFAGE 142 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,326,076 Number of Sequences: 27288 Number of extensions: 327766 Number of successful extensions: 1086 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1049 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1083 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1245572720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB11M13.yg.ab1 (735 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g50840.1 unknown protein / ; supported by cDNA: gi_19698942 321 2e-88 At1g12430.1 armadillo-repeat-containing kinesin-related protein ... 50 1e-06 At5g62410.1 chromosomal protein - like / chromosomal protein ... 49 2e-06 At1g13220.2 putative nuclear matrix constituent protein / sim... 49 3e-06 >At5g50840.1 unknown protein / ; supported by cDNA: gi_19698942 Length = 404 Score = 321 bits (823), Expect = 2e-88 Identities = 167/242 (69%), Positives = 203/242 (83%), Gaps = 2/242 (0%) Frame = +2 Query: 8 TQAANSQGTLSSQ--SSGTSRKDTSEVKRKSSKRTFKTEKEFLEFTLSYQKVLSERDAAI 181 ++ + TLS + S +++ E KRK SK FK+EKEFLEF L YQ+VLSERD+AI Sbjct: 99 SEGSTQNSTLSKEMDSLKPKKQEVVESKRKGSKNMFKSEKEFLEFMLKYQQVLSERDSAI 158 Query: 182 TMRDKLESLCRELQRQNKMLMDECKRVSTESQNLRLDLSNKFQEAIKDVTSKLEEQRDDS 361 T+RDKLESLCRELQRQNKMLM+ECKRVSTE Q LR DLS KFQ+AI DV+ KL+EQ+++S Sbjct: 159 TVRDKLESLCRELQRQNKMLMEECKRVSTEGQTLRSDLSTKFQDAIMDVSIKLDEQKNES 218 Query: 362 LTQLKENEMLRNQLKQKEEHNALTVQQYTQQLKQKSLELQIADLKLQQHEEKLVKEQSQM 541 LTQLKENEMLR +LK + L+ QQ+ Q+LKQK+LELQI+ LK++QHEEKL+ EQSQM Sbjct: 219 LTQLKENEMLRTKLKHLADQFMLSEQQHEQRLKQKTLELQISALKIKQHEEKLIHEQSQM 278 Query: 542 KMYAEQVSQLLATEKNLRLQLTADGEKFQQFQDALVKSNEVF*TFKQEIEKMGKSIKELK 721 K+YA+QVSQLL+TEKNLRLQLT+DG+KFQQFQDALVKSNEVF TFKQEI+KM K+IKEL+ Sbjct: 279 KVYADQVSQLLSTEKNLRLQLTSDGDKFQQFQDALVKSNEVFETFKQEIDKMSKAIKELR 338 Query: 722 KE 727 KE Sbjct: 339 KE 340 >At1g12430.1 armadillo-repeat-containing kinesin-related protein / ; supported by cDNA: gi_9954167_gb_AF159052.1_AF159052 Length = 919 Score = 50.1 bits (118), Expect = 1e-06 Identities = 43/186 (23%), Positives = 91/186 (48%), Gaps = 6/186 (3%) Frame = +2 Query: 194 KLESLCRELQRQNKMLMDECKRVSTESQNLRLDLSNKFQEAIKDVTSKLEEQRDDSLTQL 373 +L++L E +RQ K +DE +R++ E+ N + ++ A++D + + +S+ +L Sbjct: 434 QLDNLIEENERQQKAFVDEIERITVEAHNQISEAEKRYANALEDEKLRYQNDYMESIKKL 493 Query: 374 KENEMLRNQLKQKEEH------NALTVQQYTQQLKQKSLELQIADLKLQQHEEKLVKEQS 535 +EN +NQ K E N L + + +LE ++++LK KL+++++ Sbjct: 494 EEN-WSKNQKKLAAERLALGEKNGLDITSNGNRSIAPALE-EVSELK------KLLQKEA 545 Query: 536 QMKMYAEQVSQLLATEKNLRLQLTADGEKFQQFQDALVKSNEVF*TFKQEIEKMGKSIKE 715 Q KM AE+ L + N ++ A G +++ +++ Q+ EK+ I Sbjct: 546 QSKMAAEEEVNRLKHQLNEFKKVEASG------NSEIMRLHKMLENETQQKEKLEGEIAT 599 Query: 716 LKKEIV 733 L +++ Sbjct: 600 LHSQLL 605 >At5g62410.1 chromosomal protein - like / chromosomal protein XCAP-E, Xenopus laevis, PIR:B55094; supported by cDNA: gi_12382275_gb_AF306547.1_AF306547 Length = 1175 Score = 49.3 bits (116), Expect = 2e-06 Identities = 41/172 (23%), Positives = 79/172 (45%), Gaps = 17/172 (9%) Frame = +2 Query: 197 LESLCRELQRQNKMLMDECKRVSTESQNLRLDLSNKFQEA---IKDVTSKLEEQRDDSLT 367 +ES +ELQ D ++ ++ +L L L Q + + KLEE+ +++ + Sbjct: 696 VESQIKELQPLQMKFTDVYAQLELKTYDLSLFLKRAEQNEHHKLGEAVKKLEEELEEAKS 755 Query: 368 QLKENEM-----------LRNQLKQKEEHNALTVQQYTQQLKQKSLELQIADLKLQQHE- 511 Q+KE E+ L N +K +++ ++ + +K ++Q A L+ HE Sbjct: 756 QIKEKELAYKNCFDAVSKLENSIKDHDKNREGRLKDLEKNIKTIKAQMQAASKDLKSHEN 815 Query: 512 --EKLVKEQSQMKMYAEQVSQLLATEKNLRLQLTADGEKFQQFQDALVKSNE 661 EKLV E+ MK + L + + LT++ ++ + DAL K ++ Sbjct: 816 EKEKLVMEEEAMKQEQSSLESHLTSLETQISTLTSEVDEQRAKVDALQKIHD 867 >At1g13220.2 putative nuclear matrix constituent protein / similar to gb|D64087 nuclear matrix constituent protein 1 (NMCP1) from Daucus carota Length = 1128 Score = 48.9 bits (115), Expect = 3e-06 Identities = 41/193 (21%), Positives = 96/193 (49%), Gaps = 9/193 (4%) Frame = +2 Query: 86 RKSSKRTFKTEKEFLEFTLSYQKVLSERDAAITMRDK-------LESLCRELQRQNKMLM 244 ++ ++ + E++ +E S +K+ A D+ LE+ + ++ + K++ Sbjct: 402 KELQRKIEELERQKVEIDHSEEKLEKRNQAMNKKFDRVNEKEMDLEAKLKTIKEREKIIQ 461 Query: 245 DECKRVSTESQNLRLDLSNKFQEAIKDVTSKLEEQRDDSLT--QLKENEMLRNQLKQKEE 418 E KR+S E Q L D +E+++D+ ++E+ R + ++ E E ++K++E Sbjct: 462 AEEKRLSLEKQQLLSD-----KESLEDLQQEIEKIRAEMTKKEEMIEEECKSLEIKKEER 516 Query: 419 HNALTVQQYTQQLKQKSLELQIADLKLQQHEEKLVKEQSQMKMYAEQVSQLLATEKNLRL 598 L +Q +LK + + ++ + L + E L +E+ + + E + + A R+ Sbjct: 517 EEYLRLQS---ELKSQIEKSRVHEEFLSKEVENLKQEKERFEKEWEILDEKQAVYNKERI 573 Query: 599 QLTADGEKFQQFQ 637 +++ + EKF++FQ Sbjct: 574 RISEEKEKFERFQ 586 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,022,682 Number of Sequences: 27288 Number of extensions: 316413 Number of successful extensions: 1441 Number of sequences better than 1.0e-05: 8 Number of HSP's better than 0.0 without gapping: 1299 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1407 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB11N09.yg.ab1 (732 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20360.1 putative NADH-ubiquinone oxireductase / ;support... 405 e-113 >At2g20360.1 putative NADH-ubiquinone oxireductase / ;supported by full-length cDNA: Ceres:20429. Length = 402 Score = 405 bits (1041), Expect = e-113 Identities = 194/243 (79%), Positives = 222/243 (90%) Frame = +2 Query: 2 ATGFLGRYLVQELAKMGSQVLVPFRGSEDAPRRLKLMGDLGQIVPMKYNPRDEDSIKAVM 181 ATGFLGRYLVQ+LAKMGSQVLVPFRGSED+PR LKLMGDLGQ+VPMK++PRDEDSIKAVM Sbjct: 76 ATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGDLGQVVPMKFDPRDEDSIKAVM 135 Query: 182 AKANVVINLIGREYETRNYSFEVVNHHMAEQLAKISKEHGGIMRFIQLSCLGASESSPSR 361 AKANVVINLIGREYETRN+SFE NHH+AE+LA ++KEHGGIMR+IQ+SCLGAS SSPSR Sbjct: 136 AKANVVINLIGREYETRNFSFEDANHHIAEKLALVAKEHGGIMRYIQVSCLGASVSSPSR 195 Query: 362 MLQAKAAAEESILRELPEATILRPAVMLGTEDRLLNPWAQFAKKYNFLPLIGNGSTKIQP 541 ML+AKAAAEE++L LPEATI+RPA M+GTEDR+LNPW+ F KKY FLPLIG G+TK QP Sbjct: 196 MLRAKAAAEEAVLNALPEATIMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQP 255 Query: 542 VYVADVASAVVAALKDDGSSMGKVYELGGPDVYTLHQLAELMYEVIPEWPHYVNGPFPIA 721 VYV DVA+A+VAALKDDGSSMGK YELGGPDV+T H+LAE+MY++I EWP YV PFPIA Sbjct: 256 VYVVDVAAAIVAALKDDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVKLPFPIA 315 Query: 722 KGI 730 K + Sbjct: 316 KAM 318 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,413,442 Number of Sequences: 27288 Number of extensions: 405118 Number of successful extensions: 1155 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1155 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1294970360 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB12P14.yg.ab1 (308 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03455.1 rhodanese-like domain protein / contains Rhodanes... 90 2e-19 >At5g03455.1 rhodanese-like domain protein / contains Rhodanese-like domain PF:00581; supported by full-length cDNA: Ceres: 270908. Length = 146 Score = 89.7 bits (221), Expect = 2e-19 Identities = 39/54 (72%), Positives = 42/54 (77%) Frame = +3 Query: 3 RGPKCARRFADYLAEGKVDAGIKNIMVLERGYNGWEASGKPVCRCRGSTCKGGC 164 RGP CARR +YL E K D GIKNIM+LERG+NGWEASGKPVCRC CKG C Sbjct: 92 RGPTCARRLVNYLDEKKEDTGIKNIMILERGFNGWEASGKPVCRCAEVPCKGDC 145 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,184,919 Number of Sequences: 27288 Number of extensions: 150739 Number of successful extensions: 366 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 366 length of database: 11,516,596 effective HSP length: 78 effective length of database: 9,388,132 effective search space used: 225315168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB13A05.yg.ab1 (753 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g52180.1 putative protein / similar to unknown protein (db... 192 2e-49 >At5g52180.1 putative protein / similar to unknown protein (dbj|BAA83359.1) Length = 458 Score = 192 bits (487), Expect = 2e-49 Identities = 107/249 (42%), Positives = 158/249 (62%), Gaps = 4/249 (1%) Frame = +2 Query: 17 ELKPRKKS-NKFEFDENKAQIFRLKLNHNHLQSRLYFDQFRGVFNFTIVASSCLLLHNFL 193 E++ R +S +K EFDE+ AQIFR+KL+ +HL+SR+YF ++ +F + +A SC LL + Sbjct: 74 EVRRRNRSKDKSEFDESNAQIFRIKLDEDHLRSRMYFTEYNSLFVISFLAVSCFLLDKYF 133 Query: 194 PSSKDSS-GVLPNGTLIPILLGLLGLVRVFVTIARVSFERSASKSSEKQLSVFVGFSATV 370 +D+S GVL NG + PI+LG + L +VFV + ++S ERSASK SEK+LS+ G V Sbjct: 134 GIIEDNSHGVLSNGLMFPIVLGFIALCKVFVALGKISIERSASKESEKRLSLIFGVLGFV 193 Query: 371 IAFLIVLQVFPNWVFDFPFESLDGYGKFCTAVFMGSLAGLLYVPATKTARAYWLGTDQIR 550 +I VFP FDF S+D + + M + G LY+PA ++AR++W+GTDQIR Sbjct: 194 FGIIISAGVFPKG-FDFQLGSVDAFCCIVISFSMACIGGFLYMPAGRSARSFWVGTDQIR 252 Query: 551 CNLSMIHCGWFGRTLLHITYLLANFHFIALD*PFSELLVNKNID--TNKRSQSNHFTQHS 724 NLS+I CGWFGR +L+ Y+++ F + P +E+LV ++ D T+ SQS Sbjct: 253 SNLSIISCGWFGRMILYANYIVSVFTSLLWIHPLAEVLVKRSGDPGTSGSSQS------- 305 Query: 725 HKDRLVGNV 751 + LVGNV Sbjct: 306 -QSGLVGNV 313 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,333,396 Number of Sequences: 27288 Number of extensions: 401741 Number of successful extensions: 1320 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1258 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1317 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1357057980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB13D14.yg.ab1 (713 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g45900.1 ubiquitin activating enzyme E1-like protein / ; ... 252 4e-68 >At5g45900.1 ubiquitin activating enzyme E1-like protein / ; supported by cDNA: gi_14334507_gb_AY034945.1_ Length = 697 Score = 252 bits (643), Expect(2) = 4e-68 Identities = 125/190 (65%), Positives = 146/190 (76%) Frame = +2 Query: 98 LKAWGVRKITLVDSGKVAMSNPLRQSLYTLEDCLNGGDFKALAAVKSLKRIFPAVEAEGV 277 L WG+R IT VD GKVAMSNP+RQSLY EDCL G+FKA+AAVKSLK+IFPA+E GV Sbjct: 376 LMGWGIRNITFVDYGKVAMSNPVRQSLYNFEDCLGRGEFKAVAAVKSLKQIFPAMETSGV 435 Query: 278 VMAIPMPGHPVARQEEEKVVDDCKRLSDLIESHDAVFLLTDTRESRWLPTLLCANANKVT 457 VMAIPMPGHP++ QEE+ V+ DCKRLS+LIESHDAVFLLTDTRESRWLP+LLCANANK+ Sbjct: 436 VMAIPMPGHPISSQEEDSVLGDCKRLSELIESHDAVFLLTDTRESRWLPSLLCANANKIA 495 Query: 458 ITGALGFDSFLVMRHGAGPLLSRNTSSKAETESVVGSSLSAGVEEMSLGQKDSKPRLGCY 637 I ALGFDS++VMRHGAGP +SLS ++ + + K + RLGCY Sbjct: 496 INAALGFDSYMVMRHGAGP-----------------TSLSDDMQNLDI-NKTNTQRLGCY 537 Query: 638 FCNDVVAPVD 667 FCNDVVAP D Sbjct: 538 FCNDVVAPQD 547 Score = 23.9 bits (50), Expect(2) = 4e-68 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +1 Query: 1 TLGCQVARMLM 33 TLGCQVAR LM Sbjct: 367 TLGCQVARTLM 377 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,287,572 Number of Sequences: 27288 Number of extensions: 363293 Number of successful extensions: 1015 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 989 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1014 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1254469668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB13F05.yg.ab1 (722 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11450.1 oxygen-evolving complex related protein / 23 kDa ... 234 3e-62 >At5g11450.1 oxygen-evolving complex related protein / 23 kDa polypeptide of water-oxidizing complex of photosystem II, Nicotiana tabacum, EMBL:NT23WOP2B; supported by cDNA: gi_18252954 Length = 297 Score = 234 bits (598), Expect = 3e-62 Identities = 123/221 (55%), Positives = 152/221 (68%), Gaps = 9/221 (4%) Frame = +3 Query: 69 PKLSLFRDQAKISSSNQKICNSNKKFVACCCESSEPTSQNGFCRRDIVLFGFAASVATVF 248 P LFR ++ SS + + +S+ G RRD+VL G ++ ++ Sbjct: 11 PNSRLFRCRSSNISSKYHGASKELMIARSGVSTRSISSEKGLSRRDLVLIGLSSPLSMFL 70 Query: 249 PVEGSV---------ADEEIKMAPIVDDLNAYSYLIPLEMPSKNFSFKWVESRKPERYPS 401 P+ V + EE+KM +VDD+NAYSY PL+ PS+ FKWVESRKPERY S Sbjct: 71 PLSSPVTHAEEDVKMSGEELKMGTMVDDINAYSYAYPLDYPSEKLVFKWVESRKPERYSS 130 Query: 402 AAPLSPNARLRIVAERVDFFDNLILSVTIGPPNPIFLKSNDKSTWEAKDVADSVLSDKSA 581 AAPLSP+ARLRIV+ERVD DNL++S++IGPPN L S +K TW AK+VADSVLSDKSA Sbjct: 131 AAPLSPDARLRIVSERVDLTDNLVISISIGPPNS-RLTSKEKKTWSAKEVADSVLSDKSA 189 Query: 582 LRVTSSQRMAESSVLDAHTSEIDGEPYWYYEYLVRKSPKKL 704 LRVTSSQR+ ESSVLDAH S+IDGEPYWYYEYLVRKSP K+ Sbjct: 190 LRVTSSQRLEESSVLDAHASDIDGEPYWYYEYLVRKSPTKI 230 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,471,101 Number of Sequences: 27288 Number of extensions: 362327 Number of successful extensions: 1097 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1060 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1095 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1268361380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB13G12.yg.ab1 (338 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g14900.1 hypothetical protein / predicted by genemark.hmm 103 2e-23 >At3g14900.1 hypothetical protein / predicted by genemark.hmm Length = 611 Score = 103 bits (257), Expect = 2e-23 Identities = 49/61 (80%), Positives = 55/61 (89%) Frame = +2 Query: 5 RAKISPEEWKQLGYGPRMKKIKKSRIPPGQFLRAAVRPFLYKNLVKEIVLTRHAIVEGEI 184 +AK+ PEEWK +GYG MKKIKKSRIPP FLRAAVRPF+Y+NLVKEIVLTRHAI+EGEI Sbjct: 548 KAKVKPEEWKTVGYGRWMKKIKKSRIPPELFLRAAVRPFVYRNLVKEIVLTRHAILEGEI 607 Query: 185 G 187 G Sbjct: 608 G 608 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,672,453 Number of Sequences: 27288 Number of extensions: 155634 Number of successful extensions: 403 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 403 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 218766048 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB13G21.yg.ab1 (606 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g38000.1 unknown protein / ; supported by cDNA: gi_19424072 266 8e-72 >At2g38000.1 unknown protein / ; supported by cDNA: gi_19424072 Length = 419 Score = 266 bits (679), Expect = 8e-72 Identities = 120/164 (73%), Positives = 142/164 (86%) Frame = +1 Query: 1 GKGKLPCASCGSRGLIKCTTCSGSGLLLTRKIALVKWDTHATRKLNATSGAASVPDDVFH 180 GKGKLPC +C SRGLIKC TC +G LLT IA+VKW T + RK++AT GA SVP++VF Sbjct: 256 GKGKLPCPTCQSRGLIKCQTCDSTGSLLTSSIAVVKWKTLSKRKVSATRGAGSVPEEVFD 315 Query: 181 RAKGVQLCNTQAYNCTPAFFADSFFLNQFSSEVISERPVIPVTASVICERHTISVIPVTR 360 RA+GVQLCNTQAY CTPA+FADS+FLN+FSSEVIS R +P TA+V+CERHTISV+PVTR Sbjct: 316 RAEGVQLCNTQAYQCTPAYFADSYFLNRFSSEVISLRAEVPPTANVVCERHTISVVPVTR 375 Query: 361 VTMVHRGQAFSFYVIGFSREVYLKDYYPSRFCWGLCPCLEWLKL 492 VTM RG+AFSFY+IGF +E+YLKDYYP+RFCWGLCPCLEWLK+ Sbjct: 376 VTMEDRGKAFSFYIIGFGKEIYLKDYYPARFCWGLCPCLEWLKV 419 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,827,273 Number of Sequences: 27288 Number of extensions: 293514 Number of successful extensions: 923 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 858 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 916 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 957813068 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB13G23.yg.ab1 (676 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g35440.1 putative protein / similar to unknown protein (gb... 188 2e-48 At4g33970.1 extensin-like protein / extensin-like protein, Ze... 49 2e-06 At4g13340.1 extensin-like protein / extensin-like protein, Ze... 49 3e-06 At1g49490.1 hypothetical protein / contains similarity to dis... 49 3e-06 At5g38560.1 putative protein / contains similarity to protein... 47 9e-06 At3g24400.1 protein kinase, putative / similar to protein kin... 47 9e-06 >At5g35440.1 putative protein / similar to unknown protein (gb|AAD55417.1) Length = 597 Score = 188 bits (478), Expect = 2e-48 Identities = 91/215 (42%), Positives = 152/215 (70%), Gaps = 3/215 (1%) Frame = +1 Query: 7 LLQSSINEYEGLCGKEKQMILQAVLADLAFVYLELGNAVKALATARSLLRLPECSRVYVF 186 ++Q+S++ +E + +EKQ++ QA+ A++A+V LEL N +KAL+ A SLL+L +CS++YVF Sbjct: 386 IIQNSLSAFEDIRNREKQLMRQALFANMAYVELELANPIKALSAATSLLQLADCSKIYVF 445 Query: 187 LGNMYAAEAYCLLNQPKQASEHLSVYISGKDNNTEFPYSEQDCDMWQVRKAVDLDE---P 357 LG++YAAEA CLLN+P +A HLS Y+ G+D + + PY+++D D W + D +E P Sbjct: 446 LGHIYAAEALCLLNRPIEAGAHLSAYLLGQD-DFKLPYAQEDFDQWWKHTSSDCEETLDP 504 Query: 358 NSNNALSQDQWLPQGGLCLKPEVARGVLLANIAAIAAAEGDMERAEEAVAMALSVIPDNV 537 ++ N + + LKPE ARG L A++AA+ A +G ++A+ + AL+++P+NV Sbjct: 505 STGNT--------RDSVFLKPEEARGALFADLAALLATQGHHDQAKSLITHALTLLPNNV 556 Query: 538 EVVLTAIYIDLVRGNTREAVGKLKQCSRVRFLPGK 642 + +TA+YIDL+ G +++A+ +LKQC+ V F+PG+ Sbjct: 557 QATVTAVYIDLMLGRSQDALARLKQCTHVSFVPGR 591 >At4g33970.1 extensin-like protein / extensin-like protein, Zea mays, PIR2:S49915 Length = 699 Score = 48.9 bits (115), Expect = 2e-06 Identities = 39/104 (37%), Positives = 44/104 (41%) Frame = -1 Query: 601 SPPPPACSPAPDRYISR*EQPPRCLELPITPLPPPLPPAPYHLLPPLWPQCWPVKPHEPL 422 SPPPP SP P + PP + P P P PP P H PP P P P Sbjct: 574 SPPPPVYSPPPPVH-----SPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSP 628 Query: 421 PASNTVPPAVTIGPVKGHYWNSARLNPPLSSPATCHNPVRCKET 290 P S + PP V P + NS PP+ SP PV KET Sbjct: 629 PPSQS-PPVVYSPPPRPPKINS----PPVQSPPPA--PVEKKET 665 >At4g13340.1 extensin-like protein / extensin-like protein, Zea mays, PIR2:S49915 Length = 760 Score = 48.5 bits (114), Expect = 3e-06 Identities = 41/120 (34%), Positives = 47/120 (39%), Gaps = 3/120 (2%) Frame = -1 Query: 649 TFTSPEEILPGCTVSTSPPPPACSPAPDRYISR*EQPPRC---LELPITPLPPPLPPAPY 479 T TSP P V + PPPP P P Y PP + P P PPP PP P Sbjct: 422 TLTSPPPPSPPPPVYSPPPPPP--PPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPV 479 Query: 478 HLLPPLWPQCWPVKPHEPLPASNTVPPAVTIGPVKGHYWNSARLNPPLSSPATCHNPVRC 299 + PP P P + P P PP P ++S PP SPA PV C Sbjct: 480 YSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSP---PPPPSPAP--TPVYC 534 Score = 47.8 bits (112), Expect = 5e-06 Identities = 36/122 (29%), Positives = 46/122 (37%), Gaps = 17/122 (13%) Frame = -1 Query: 622 PGCTVSTSPPPPACSPAPDRYISR*EQPPRCLELPITPLPPPLPPAPYHLLPPLWPQCWP 443 P S PPPP P P Y PP +P PPP PP P + P P + Sbjct: 460 PPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYS 519 Query: 442 VKPHEPLPASNTV--------------PPAVTIGPVKGHYWNS---ARLNPPLSSPATCH 314 P P PA V PP + P + +Y++S +PP SP H Sbjct: 520 SPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPH 579 Query: 313 NP 308 +P Sbjct: 580 SP 581 >At1g49490.1 hypothetical protein / contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum] Length = 847 Score = 48.5 bits (114), Expect = 3e-06 Identities = 38/119 (31%), Positives = 41/119 (33%), Gaps = 15/119 (12%) Frame = -1 Query: 601 SPPPPACSPAPDRYIS----R*EQPPRCLELPITPLPPP-----------LPPAPYHLLP 467 SPPPP SP P Y S PP + P P PPP PP P P Sbjct: 551 SPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPP 610 Query: 466 PLWPQCWPVKPHEPLPASNTVPPAVTIGPVKGHYWNSARLNPPLSSPATCHNPVRCKET 290 P P P P P PP T P H N PP+ +P P ET Sbjct: 611 PPSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTN----QPPMGAPTPTQAPTPSSET 665 >At5g38560.1 putative protein / contains similarity to protein kinase; supported by cDNA: gi_15983496_gb_AF424623.1_AF424623 Length = 681 Score = 47.0 bits (110), Expect = 9e-06 Identities = 35/110 (31%), Positives = 45/110 (40%), Gaps = 11/110 (10%) Frame = -1 Query: 622 PGCTVSTSPPPPA--CSPAPDRYISR*EQPPRCLELPITPLPPPLPPAPYHLLPPLWPQC 449 P TV++SPPPP SP P + PP+ + P P P PPAP PP P Sbjct: 80 PPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSP 139 Query: 448 WP---------VKPHEPLPASNTVPPAVTIGPVKGHYWNSARLNPPLSSP 326 P P P P+ +T P T P + +PP S+P Sbjct: 140 SPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPP---PATSASPPSSNP 186 >At3g24400.1 protein kinase, putative / similar to protein kinase GB:BAA24694 from [Arabidopsis thaliana] Length = 694 Score = 47.0 bits (110), Expect = 9e-06 Identities = 40/117 (34%), Positives = 48/117 (40%), Gaps = 5/117 (4%) Frame = -1 Query: 637 PEEILPGCTVSTSPPPPACSPAPDRYISR*EQPPRCLELPITPLPP--PLPPAPYHLLPP 464 P +P ST PPP +P+P PP P TP PP P PP PP Sbjct: 60 PPTTVPPIPPSTPSPPPPLTPSPLPPSPTTPSPP-LTPSPTTPSPPLTPSPPPAITPSPP 118 Query: 463 LWPQCWPVKP--HEPLPASNTVP-PAVTIGPVKGHYWNSARLNPPLSSPATCHNPVR 302 L P P P P P S ++P P +T P + +PP SPAT P R Sbjct: 119 LTPSPLPPSPTTPSPPPPSPSIPSPPLTPSPPPSSPLRPS--SPPPPSPATPSTPPR 173 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,383,517 Number of Sequences: 27288 Number of extensions: 500930 Number of successful extensions: 7366 Number of sequences better than 1.0e-05: 12 Number of HSP's better than 0.0 without gapping: 2308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4141 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1138809344 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB13H05.yg.ab1 (720 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g30320.1 putative pseudouridine synthase / 221 2e-58 At1g20370.1 expressed protein / contains Pfam profile: PF0141... 62 4e-10 At1g76120.1 expressed protein / contains similarity to pseudo... 57 8e-09 >At2g30320.1 putative pseudouridine synthase / Length = 510 Score = 221 bits (564), Expect = 2e-58 Identities = 110/209 (52%), Positives = 151/209 (71%), Gaps = 8/209 (3%) Frame = +1 Query: 7 LETDETIDESDANGDTLKDVPIP--------ILAKWLHEPDDKDRISASHFRRIFQCSCG 162 +E E +E + +G++ + V P AKWL+EPD+ D+IS +HFR++F+C G Sbjct: 274 IEIGEEEEEKEVDGESDEHVVTPDSDNSQVYSRAKWLYEPDETDKISGAHFRKVFRCRSG 333 Query: 163 KLEQLFGARYVEISICGESFMLHQIRKMVGTAVAVKRGLLRKDVITLSLNKFSRIVVPIA 342 KLE G +VEISI GESFMLHQIRKM+GTAVAVKR LL +D+I LSLNKF+RIV+P+A Sbjct: 334 KLENSLGFGFVEISIWGESFMLHQIRKMIGTAVAVKRELLPRDIIRLSLNKFTRIVLPLA 393 Query: 343 PSEVLFLRSNNFSMRTRIGTRPEIVTLVESEEILKDVDDFYKSIMLPQVSEFLDPSRPPW 522 PSEVL LR N+F +R R+ RP + ESEE+ K++++FY+++M+PQVS FLD + PW Sbjct: 394 PSEVLILRGNSFEVR-RLPERPGMEATGESEEVEKEIEEFYRAVMVPQVSIFLDSEKSPW 452 Query: 523 KEXVELLDRNTGIPDSQLDEVKNAWIAWK 609 KE V+ LDRN G+ D +L++V+ W WK Sbjct: 453 KEWVDHLDRNDGLIDEELEDVRKGWEEWK 481 >At1g20370.1 expressed protein / contains Pfam profile: PF01416 tRNA pseudouridine synthase; supported by cDNA: gi_14334543_gb_AY035176.1_ Length = 549 Score = 61.6 bits (148), Expect = 4e-10 Identities = 39/106 (36%), Positives = 57/106 (52%), Gaps = 1/106 (0%) Frame = +1 Query: 136 RRIFQCSCGKLEQLFGARYVEISICGESFMLHQIRKMVGTAVAVKRGLLRKDVITLSLNK 315 R I + + L G +V+ + G+SFMLHQIRKM+G AVA+ R + +I S K Sbjct: 350 RYILSFNANTVINLDGKDFVKCEVVGQSFMLHQIRKMIGLAVAIMRNYAPESLIEASFKK 409 Query: 316 FSRIVVPIAPSEVLFLRSNNF-SMRTRIGTRPEIVTLVESEEILKD 450 RI VP+AP L+L F S R E V++ E +E+ ++ Sbjct: 410 DVRINVPMAPEVGLYLDECFFTSYNKRFKGSHEEVSMEEYKEVAEE 455 >At1g76120.1 expressed protein / contains similarity to pseudouridylate synthase 2 GI:1403092 from [Saccharomyces cerevisiae];supported by full-length cDNA: Ceres:247783. Length = 463 Score = 57.4 bits (137), Expect = 8e-09 Identities = 31/86 (36%), Positives = 48/86 (55%) Frame = +1 Query: 136 RRIFQCSCGKLEQLFGARYVEISICGESFMLHQIRKMVGTAVAVKRGLLRKDVITLSLNK 315 R+I + + L G +++ + G+SFMLHQIRKM+G AVA+ R + +I + +K Sbjct: 297 RQIISFTANTVINLDGIDFIKCEVLGKSFMLHQIRKMMGLAVAIMRNCASESLIQSAFSK 356 Query: 316 FSRIVVPIAPSEVLFLRSNNFSMRTR 393 I VP+AP L+L F+ R Sbjct: 357 DVNITVPMAPEVGLYLDECFFTSYNR 382 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,732,431 Number of Sequences: 27288 Number of extensions: 380754 Number of successful extensions: 1120 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 1090 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1119 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1272263564 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB13H14.yg.ab1 (394 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g29220.1 expressed protein / contains similarity to transc... 79 7e-16 >At1g29220.1 expressed protein / contains similarity to transcriptional regulator protein GB:X68061 GI:57911 from [Mus musculus];supported by full-length cDNA: Ceres:20945. Length = 351 Score = 79.0 bits (193), Expect = 7e-16 Identities = 42/79 (53%), Positives = 53/79 (66%), Gaps = 7/79 (8%) Frame = +2 Query: 41 DTGTREGRLNKKSKWDKVDGDRRQ-------DSSHATALLSGSAASANNAGSGYTAFAQQ 199 + R+GR NKKSKWDKVDGD + S ++ + + SA +AGSGY+AFAQQ Sbjct: 273 EIAARDGRPNKKSKWDKVDGDVKNPPLAAGTQDSISSIRSNAALVSATSAGSGYSAFAQQ 332 Query: 200 RRREAEERRSIDRKLDRRS 256 RRRE E RRS +RKL+RRS Sbjct: 333 RRREVEGRRSSERKLERRS 351 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,311,343 Number of Sequences: 27288 Number of extensions: 204477 Number of successful extensions: 723 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 721 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 382840584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB14A01.yg.ab1 (334 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g31130.1 putative protein / ;supported by full-length cDN... 64 1e-11 >At4g31130.1 putative protein / ;supported by full-length cDNA: Ceres:8077. Length = 195 Score = 63.9 bits (154), Expect = 1e-11 Identities = 31/47 (65%), Positives = 39/47 (82%), Gaps = 2/47 (4%) Frame = +1 Query: 1 LLGGGAFLALDSALFWLVSLMLADNAREDYFDDV--KGADGVTNDYD 135 LLGGGAF++LDS LFWLV+LMLADNARED+FD+V + DG ++ D Sbjct: 142 LLGGGAFVSLDSCLFWLVALMLADNAREDHFDEVESRSIDGNSSSRD 188 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,934,274 Number of Sequences: 27288 Number of extensions: 121652 Number of successful extensions: 531 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 455 length of database: 11,516,596 effective HSP length: 86 effective length of database: 9,169,828 effective search space used: 220075872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB14C08.yg.ab1 (694 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47390.1 unknown protein / ; supported by cDNA: gi_18086369 413 e-116 >At2g47390.1 unknown protein / ; supported by cDNA: gi_18086369 Length = 961 Score = 413 bits (1062), Expect = e-116 Identities = 198/228 (86%), Positives = 215/228 (93%) Frame = +3 Query: 3 KYYESVVALMSDQKEGELQVNELKVLTSKESKTENTQYYIQRWPERKACQITRFPHPYPQ 182 KY+E+VVALMSDQKEG+L++ ELK+LTSKESKTENTQY +Q WP+RK QIT FPHPYPQ Sbjct: 588 KYFETVVALMSDQKEGDLKMEELKILTSKESKTENTQYSLQLWPDRKVQQITNFPHPYPQ 647 Query: 183 LASLQKEMVRYERKDGVQLTATLYLPPGYDPTRDGPLPCLVWSYPGEFKNKEAAGQVRGS 362 LASLQKEM+RY+RKDGVQLTATLYLPPGYDP++DGPLPCL WSYPGEFK+K+AAGQVRGS Sbjct: 648 LASLQKEMIRYQRKDGVQLTATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGS 707 Query: 363 PNEFAGIGPTSPLLWLARRFAILSGPTIPIIGEGKEEANDRYVEQLVASAEAAVEEVIRR 542 PNEFAGIG TS LLWLARRFAILSGPTIPIIGEG EEANDRYVEQLVASAEAAVEEV+RR Sbjct: 708 PNEFAGIGSTSALLWLARRFAILSGPTIPIIGEGDEEANDRYVEQLVASAEAAVEEVVRR 767 Query: 543 GVAHPRKIAIGGHSYGAFMTANLLAHAPHLFSCGIARSGAYNRTLTPF 686 GVA KIA+GGHSYGAFMTANLLAHAPHLF+CGIARSGAYNRTLTPF Sbjct: 768 GVADRSKIAVGGHSYGAFMTANLLAHAPHLFACGIARSGAYNRTLTPF 815 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,494,804 Number of Sequences: 27288 Number of extensions: 432157 Number of successful extensions: 1249 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1249 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1192191032 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB14D16.yg.ab1 (744 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80500.1 unknown protein / 142 2e-34 >At1g80500.1 unknown protein / Length = 81 Score = 142 bits (357), Expect = 2e-34 Identities = 69/80 (86%), Positives = 75/80 (93%) Frame = +2 Query: 122 MASTACFMIISRNDIPIYDAEVGSAPKKEEAAHQHQFILHAALDVVQDLAWTPSAMFLKS 301 MA+TACF+I+ RNDIPIY+AEVGSA K+E+AA HQFILHAALDVVQDLAWT SAMFLKS Sbjct: 1 MANTACFIIVGRNDIPIYEAEVGSAAKREDAAQLHQFILHAALDVVQDLAWTTSAMFLKS 60 Query: 302 VDRFNDLVVSVYVTAGHILF 361 VDRFNDLVVSVYVTAGHILF Sbjct: 61 VDRFNDLVVSVYVTAGHILF 80 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,304,244 Number of Sequences: 27288 Number of extensions: 322354 Number of successful extensions: 619 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1330449000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB14E07.yg.ab1 (622 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g07060.1 hypothetical protein / predicted by genemark.hmm;... 153 8e-38 >At1g07060.1 hypothetical protein / predicted by genemark.hmm; supported by cDNA: gi_20258793 Length = 233 Score = 153 bits (386), Expect = 8e-38 Identities = 82/187 (43%), Positives = 118/187 (62%) Frame = +1 Query: 7 KMCDSEVVSQQISLFRSLIQTRRFDDGTLRILESVLISRDVKLMLDVRRSLRDFMRHESL 186 K C +++ Q LF + +Q RRFD+ +LRILE L++ +VK L+VR LRDFMR ES+ Sbjct: 25 KKCSDSMIADQTYLFINRVQDRRFDEESLRILELSLVAMNVKSFLEVRSRLRDFMRSESV 84 Query: 187 CVLSEFKEKSVDHNLLIIEFFVHAFAFIGDPESCLSLRYEALILRELKSATDHQLHVSYG 366 + E +S+ L ++EFF AFA +GD ESCL++RYEAL LR+LKS + L VS+ Sbjct: 85 VIFGELTGESMVAKLSVLEFFARAFALLGDMESCLAMRYEALNLRQLKSPSCLWLGVSHS 144 Query: 367 EWLTFAEHAFENRFYAISRKACEKALACFQTNDVLKPKETDALSDIEAIRKVKRLKDLAM 546 EW FA + EN F +I+ KA E AL + + +++PK D ++A KV+RL+D A Sbjct: 145 EWTKFAVQSMENGFPSIAGKASENALLSLKKDSLIEPKSEDNSDILDAAEKVRRLRDSAA 204 Query: 547 IRVASQS 567 +S S Sbjct: 205 SLTSSHS 211 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,226,894 Number of Sequences: 27288 Number of extensions: 237571 Number of successful extensions: 662 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 662 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 990590196 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB14F02.yg.ab1 (682 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20220.1 zinc finger protein / ;supported by full-length ... 325 1e-89 >At5g20220.1 zinc finger protein / ;supported by full-length cDNA: Ceres:152664. Length = 393 Score = 325 bits (834), Expect = 1e-89 Identities = 156/219 (71%), Positives = 181/219 (82%), Gaps = 1/219 (0%) Frame = +3 Query: 3 RGYTPCTICGIERARLDCSQCNGKGMVTCHQCSGECVIWEESIDERPWEKARSISPLRVK 182 RGYT C+ CGIER+RLDC QC GKG++TC +C G+CVIWEESIDERPWEKARS SP RVK Sbjct: 98 RGYTSCSNCGIERSRLDCPQCKGKGIMTCLRCLGDCVIWEESIDERPWEKARSSSPFRVK 157 Query: 183 EDDEVDNLEIKLSVRKKSKRVYHSPSPEVGLKISKALKAIG*LQSLNAKTGLFTNRMKLI 362 EDDEVDNLEIK S R+KSKR+Y SP+PEVG KIS++LK SLNAKTGLF+ RMK+I Sbjct: 158 EDDEVDNLEIKFSKRRKSKRIYQSPTPEVGQKISRSLK------SLNAKTGLFSKRMKII 211 Query: 363 HGNPKLHAQRVAAIKKSKGSVDARKHASESMKAFFSNPENRRKRSISMKGVDFYCKNCGR 542 H +P LHAQRVAAIKK+KG+ ARKHASESMKAFFSNP NR +RS+SMKG FYCKNCG+ Sbjct: 212 HRDPVLHAQRVAAIKKAKGTPAARKHASESMKAFFSNPVNREQRSLSMKGTKFYCKNCGQ 271 Query: 543 LGHRRHYCPEV-DQTDRRFRCSLCGEKGSHRRSCKNNES 656 GHRRHYCPE+ DR+FRC CG KG +RR+C ++S Sbjct: 272 EGHRRHYCPELGTNADRKFRCRGCGGKGHNRRTCPKSKS 310 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,643,764 Number of Sequences: 27288 Number of extensions: 359887 Number of successful extensions: 1439 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1414 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1156603240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB14G21.yg.ab1 (624 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g09730.1 unknown protein / 136 8e-33 At1g10570.1 putative protein-tyrosine phosphatase 2 / similar... 54 7e-08 At3g48480.1 putative protein / predicted protein, Arabidopsis... 53 1e-07 At1g60220.1 hypothetical protein / predicted by genemark.hmm 48 5e-06 >At1g09730.1 unknown protein / Length = 865 Score = 136 bits (343), Expect = 8e-33 Identities = 75/147 (51%), Positives = 99/147 (67%), Gaps = 3/147 (2%) Frame = +2 Query: 5 SEDISSRFDNLRFISLELPQQPNSFDCGLFLLHYAELFLEQAPINFNPFKITKSVHFLNA 184 S+DISSRF NLRF+SLELPQQ NSFDCGLFLLHY ELFL +AP+NF+PFKI + +FL Sbjct: 485 SDDISSRFMNLRFVSLELPQQENSFDCGLFLLHYLELFLAEAPLNFSPFKIYNASNFLYL 544 Query: 185 DWFPPADASLKRVVIPRLVYDLLQQPYDEAEAPSSMAAANKVATAVNFFGEI-HRHYSP- 358 +WFPPA+ASLKR +I +L+++LL+ E + + + VA + E+ SP Sbjct: 545 NWFPPAEASLKRTLIQKLIFELLENRSREVSNEQNQSCESPVAVNDDMGIEVLSERCSPL 604 Query: 359 -SRNGQTSQAADADDGIEISLLPSLSI 436 NG +Q D D GIE++LL S+ Sbjct: 605 IDCNGDMTQTQD-DQGIEMTLLERSSM 630 >At1g10570.1 putative protein-tyrosine phosphatase 2 / similar to protein-tyrosine phosphatase 2 (gi|3249071), similar to EST gb|N96456; supported by cDNA: gi_20260163 Length = 571 Score = 53.9 bits (128), Expect = 7e-08 Identities = 25/70 (35%), Positives = 41/70 (57%) Frame = +2 Query: 50 LELPQQPNSFDCGLFLLHYAELFLEQAPINFNPFKITKSVHFLNADWFPPADASLKRVVI 229 +++PQQ N FDCGLFLL + F+E+AP + + ++ WF P +AS R+ I Sbjct: 501 VQVPQQKNDFDCGLFLLFFIRRFIEEAPQRLT----LQDLKMIHKKWFKPEEASALRIKI 556 Query: 230 PRLVYDLLQQ 259 ++ DL ++ Sbjct: 557 WNILVDLFRK 566 >At3g48480.1 putative protein / predicted protein, Arabidopsis thaliana Length = 169 Score = 52.8 bits (125), Expect = 1e-07 Identities = 27/68 (39%), Positives = 36/68 (52%) Frame = +2 Query: 2 GSEDISSRFDNLRFISLELPQQPNSFDCGLFLLHYAELFLEQAPINFNPFKITKSVHFLN 181 G + SS D + F +PQQ N +CG F+L+Y F+E AP NFN + +FL Sbjct: 90 GRTEDSSLVDEIPFYVPMVPQQTNDVECGSFVLYYIHRFIEDAPENFN---VEDMPYFLK 146 Query: 182 ADWFPPAD 205 DWF D Sbjct: 147 EDWFSHKD 154 >At1g60220.1 hypothetical protein / predicted by genemark.hmm Length = 604 Score = 47.8 bits (112), Expect = 5e-06 Identities = 23/69 (33%), Positives = 38/69 (54%) Frame = +2 Query: 50 LELPQQPNSFDCGLFLLHYAELFLEQAPINFNPFKITKSVHFLNADWFPPADASLKRVVI 229 +++PQQ N FDCG F+L + + F+E+AP K + + WF P +AS R+ I Sbjct: 534 VQVPQQKNDFDCGPFVLFFIKRFIEEAPQRLK----RKDLGMFDKKWFRPDEASALRIKI 589 Query: 230 PRLVYDLLQ 256 + +L + Sbjct: 590 RNTLIELFR 598 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,088,670 Number of Sequences: 27288 Number of extensions: 350487 Number of successful extensions: 1030 Number of sequences better than 1.0e-05: 8 Number of HSP's better than 0.0 without gapping: 1005 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1030 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 999514432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB14L22.yg.ab1 (562 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32570.1 putative protein / ;supported by full-length cDN... 86 2e-17 At1g70700.1 hypothetical protein / predicted by genefinder; s... 47 7e-06 >At4g32570.1 putative protein / ;supported by full-length cDNA: Ceres:2508. Length = 361 Score = 85.5 bits (210), Expect = 2e-17 Identities = 39/50 (78%), Positives = 42/50 (84%) Frame = +3 Query: 63 SVSRQMTIFYGGQAHVFDDVHPNKADAIMAMAGSSGGSWSTNYSQNPSIK 212 S ++QMTIFYGGQAHVFDDVHPNKAD IMA+AGSSGGSWST S P K Sbjct: 234 SSTKQMTIFYGGQAHVFDDVHPNKADVIMALAGSSGGSWSTGLSHKPKSK 283 >At1g70700.1 hypothetical protein / predicted by genefinder; supported by cDNA: gi_17064877 Length = 238 Score = 47.0 bits (110), Expect = 7e-06 Identities = 31/94 (32%), Positives = 45/94 (46%), Gaps = 7/94 (7%) Frame = +3 Query: 27 GSSAPLR-------RLGSTSVSRQMTIFYGGQAHVFDDVHPNKADAIMAMAGSSGGSWST 185 G S PL R+ S+ S Q+TIFYGG VF+D+ P+KA AIM AG+ + Sbjct: 96 GGSVPLPTHPSLVPRVASSGSSPQLTIFYGGTISVFNDISPDKAQAIMLCAGNGLKGETG 155 Query: 186 NYSQNPSIKPFIGIGDNNTLSRERLNSTHGTGLS 287 + + G +NT + ++TH S Sbjct: 156 DSKPVREAERMYGKQIHNTAATSSSSATHTDNFS 189 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,703,546 Number of Sequences: 27288 Number of extensions: 278643 Number of successful extensions: 645 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 645 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 835029516 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB14O10.yg.ab1 (735 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24490.1 putative protein / contains similarity to ribosom... 261 4e-70 >At5g24490.1 putative protein / contains similarity to ribosomal protein 30S subunit; supported by cDNA: gi_13877770_gb_AF370148.1_AF370148 Length = 308 Score = 261 bits (666), Expect = 4e-70 Identities = 132/196 (67%), Positives = 160/196 (81%), Gaps = 6/196 (3%) Frame = +1 Query: 1 EVDVRVSVRGGEFGKGPKVRRTEVTLFTKKHGVIRAEEEAETTYASIDTVSSVIQRKLRK 180 EVDVR+SVRGGEFGKGP++RR EVTLFTKKHGV+RAEE+AET YA ID VS++IQRKLRK Sbjct: 118 EVDVRLSVRGGEFGKGPRIRRCEVTLFTKKHGVVRAEEDAETVYACIDLVSTIIQRKLRK 177 Query: 181 IKEKDSDHGRHMKGFDRLKVRDPQI------LIDQDSLAVTQEEEEEEVEDASETDEIVR 342 IKEKDSDHGRHMKGF+RLKVR+P I + D +V +EEEE+++ EIVR Sbjct: 178 IKEKDSDHGRHMKGFNRLKVREPVIEPVVEDVEDSTDSSVGEEEEEDDL-----IKEIVR 232 Query: 343 TKYFEMPPLTVSEAIEQLENVDHDFYGFRNEETGEINILYKRKSGGYGIIVPKENGETEE 522 TK FEMPPLTV+EA+EQLE V HDFYGF+NEETGEINI+YKRK GGYG+I+PK++G+ E+ Sbjct: 233 TKTFEMPPLTVAEAVEQLELVSHDFYGFQNEETGEINIVYKRKEGGYGLIIPKKDGKAEK 292 Query: 523 LEDVDAEILRQL*FAE 570 +E + E L + FAE Sbjct: 293 VEPLPTEQLNEHSFAE 308 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,301,061 Number of Sequences: 27288 Number of extensions: 414888 Number of successful extensions: 2440 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2123 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB15H18.yg.ab1 (736 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16210.1 putative protein / KIAA1468 - Homo sapiens, EMBL:... 279 7e-79 >At5g16210.1 putative protein / KIAA1468 - Homo sapiens, EMBL:AB040901; supported by cDNA: gi_17978918 Length = 1180 Score = 279 bits (714), Expect(2) = 7e-79 Identities = 140/222 (63%), Positives = 172/222 (77%), Gaps = 1/222 (0%) Frame = +3 Query: 12 FSLQLLQKYAEGRLDWPTFEWLHDDCFPSLIQILSLLPQKEDSLRKRISSFLLAVSTRFG 191 FS+ LL+ YAEGR +WP FEW+H DCF +L+Q+ +LPQKED LR RI+ FLLAVS RFG Sbjct: 723 FSVSLLEIYAEGRSEWPMFEWMHVDCFANLLQLACMLPQKEDHLRNRITKFLLAVSERFG 782 Query: 192 EDYLTHIILPLFLVAVGDN-ADLSCFRSTSQPKIKALRPIIAMDARIATLCVLPVLLAGV 368 YLTHI LP+FLVA GD+ ADL S P+IK L+P A+ R+ATLC+LP+LLAGV Sbjct: 783 SSYLTHIELPVFLVAAGDDEADLRFLPSAIHPRIKGLKPRTAVANRLATLCILPLLLAGV 842 Query: 369 LGFPNKHELLTEYLRNLLIQSADKTTQSAIHSANVYNSVRFLCLFEEHHNLVFNILWEMV 548 LG P+K E LT +LR LL++S K QS+ H+ V ++VRFLC FE HHN++F ILWEMV Sbjct: 843 LGAPSKREELTIFLRQLLVESKTKENQSSKHNNEVLDAVRFLCTFEVHHNMIFGILWEMV 902 Query: 549 VSSNMDLKINAAKLLKVIVPYIDAXVASSHVLPALVTLGSEQ 674 V S +LKINAAKLLK IVPYIDA VAS++VLPAL+TLGS+Q Sbjct: 903 VDSTAELKINAAKLLKTIVPYIDAKVASANVLPALITLGSDQ 944 Score = 32.7 bits (73), Expect(2) = 7e-79 Identities = 15/21 (71%), Positives = 19/21 (90%) Frame = +2 Query: 674 NLHVLYASIDAFGTVAQNSKM 736 NL+V YASIDAFG+VAQ+ K+ Sbjct: 945 NLNVKYASIDAFGSVAQHFKV 965 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,802,094 Number of Sequences: 27288 Number of extensions: 334383 Number of successful extensions: 893 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 859 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 890 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB15I15.yg.ab1 (642 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60990.1 hypothetical protein / predicted by genscan+, sim... 270 6e-73 >At1g60990.1 hypothetical protein / predicted by genscan+, similar to aminomethyltransferase GB:CAA20175 from [Streptomyces coelicolor A3(2)] Length = 436 Score = 270 bits (689), Expect = 6e-73 Identities = 143/226 (63%), Positives = 164/226 (72%), Gaps = 13/226 (5%) Frame = +1 Query: 4 KVSEDWIIETFNNDEDALDAVDNGTVVVDLSHYGRIRVSGEDRIPFLHNQSTANFEALSE 183 KVSED ++E+F+ND++ALDA DNG VVVDLSH+GRIRVSG+DR FLHNQ+TANFE+L E Sbjct: 80 KVSEDGVVESFDNDDEALDAFDNGVVVVDLSHFGRIRVSGDDRAHFLHNQTTANFESLYE 139 Query: 184 GGGCDTVFVTPTARTIDIAQAWIMKTAVTLVVSPSTSKSISEMLNKYIFFADKVEIQDIT 363 G GCDTVFVTPTARTIDIA AWIMK A+ L VSP+T +SI EMLNKYIFFADKVEI+DIT Sbjct: 140 GQGCDTVFVTPTARTIDIAHAWIMKNAILLTVSPTTCQSIIEMLNKYIFFADKVEIKDIT 199 Query: 364 NKTCLFALIGPKSN-------------QVMVDLNLGDLIGQPYGSHKHYNVSGNPVTVAV 504 +TCLFAL GPKSN Q+M LNLGDLIGQPYG H+HY+ G P+TV V Sbjct: 200 KQTCLFALAGPKSNQLHYSYATVKNMKQIMSKLNLGDLIGQPYGRHQHYSFDGMPITVGV 259 Query: 505 GSVISGEGSH**CHHQLQEWFGKLF*VINGTPMGSNAFETYRILQG 642 GS+IS EG K PMGS A+E RI QG Sbjct: 260 GSLISDEGFTMLMSPGGAVSVWKTLLAEGAIPMGSVAWEKLRITQG 305 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,422,235 Number of Sequences: 27288 Number of extensions: 315071 Number of successful extensions: 920 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 884 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 914 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1053059848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB15I17.yg.ab1 (473 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g47030.1 ATP synthase delta chain, mitochondrial precursor (s... 149 7e-37 >At5g47030.1 ATP synthase delta chain, mitochondrial precursor (sp|Q96252) / ; supported by cDNA: gi_1655483_dbj_D88376.1_D88376 Length = 203 Score = 149 bits (376), Expect = 7e-37 Identities = 75/118 (63%), Positives = 94/118 (79%) Frame = -1 Query: 359 MFRQVASRLLTRPTTTYSAAASATTRRPFATEVVADTTSGDEAFVEAWKKVVPNIDPPKT 180 MF+Q ASRLL+R +A++ + T R F+TE+ + D FVEAWKKV PN+DPP+T Sbjct: 1 MFKQ-ASRLLSRSVA--AASSKSVTTRAFSTELPSTL---DSTFVEAWKKVAPNMDPPQT 54 Query: 179 PSQYMHPRPPTPSTLPTKLTVNFVLPYASELSKKEVDMVIVPATTGQMGILPGHVPTM 6 PS +M PRP TPS++PTKLTVNFVLPY SEL+ KEVDMVI+PA+TGQMG+LPGHVPT+ Sbjct: 55 PSAFMKPRPSTPSSIPTKLTVNFVLPYTSELTGKEVDMVIIPASTGQMGVLPGHVPTI 112 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,436,299 Number of Sequences: 27288 Number of extensions: 328638 Number of successful extensions: 4423 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3808 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 596203608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB15L10.yg.ab1 (698 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g00090.1 putative WD repeat membrane protein / ; supporte... 334 3e-92 At1g15440.1 hypothetical protein / Strong similarity to gb X9... 54 6e-08 At5g23430.1 putative protein / contains similarity to unknown... 54 6e-08 At5g08390.1 katanin p80 subunit - like protein / katanin p80 ... 53 2e-07 At1g24130.1 G-protein beta family / similar to hypothetical p... 52 2e-07 At5g52820.1 Notchless protein homolog / 50 1e-06 At3g42660.1 putative protein / AND-1 protein - Homo sapiens, ... 50 1e-06 At4g05410.1 U3 snoRNP-associated-related / U3 snoRNP-associat... 50 1e-06 At1g61210.1 G-protein beta family / contains similarity to ka... 49 3e-06 At5g25150.1 transcription initiation factor IID-associated facto... 48 6e-06 At4g04940.1 putative WD-repeat membrane protein / ; supporte... 47 1e-05 At5g26900.1 fizzy-related (FZR), putative / WD-repeat protein... 47 1e-05 >At4g00090.1 putative WD repeat membrane protein / ; supported by cDNA: gi_15912316_gb_AY056436.1_ Length = 430 Score = 334 bits (856), Expect = 3e-92 Identities = 160/209 (76%), Positives = 183/209 (87%) Frame = +1 Query: 1 EGTDIKLWHGKSGKLLGNVDTNQLKNNMATISPDGRFIAAAAFTADVKVWEIVYSKDSSV 180 EGTDI LWHGK+G+ LG+VDTNQLKN+MA +SP+GRF+AAAAFTADVKVWEIVY KD SV Sbjct: 217 EGTDIVLWHGKTGRNLGHVDTNQLKNHMAAVSPNGRFLAAAAFTADVKVWEIVYQKDGSV 276 Query: 181 KEVTKVMQLKGHKSAVTWLCFTPNSEQIITASKDGSIRVWNINVRYHLDEDPKTLKSFEI 360 KEV++VMQLKGHKSAVTWLCF+PNSEQIITASKDGSIRVWNINVRYHLDEDPKTLK F I Sbjct: 277 KEVSRVMQLKGHKSAVTWLCFSPNSEQIITASKDGSIRVWNINVRYHLDEDPKTLKVFPI 336 Query: 361 PLHDSKGSVLSYDRLSVSPDGKILAATHGSLLQWLSVETGQVLETADKAHDGDITDIAWA 540 PL DS G+ L YDRLS+ P+GKILAA+HGS LQWL ETG VL+TA+KAH+GDIT I+WA Sbjct: 337 PLCDSGGNPLHYDRLSLCPEGKILAASHGSTLQWLCAETGNVLDTAEKAHEGDITCISWA 396 Query: 541 PKPISVGDXRLSILATASVDKKVELWAAP 627 PK I+VG+ +L T+ DKKV+LW AP Sbjct: 397 PKAITVGERHAMVLGTSGDDKKVKLWEAP 425 >At1g15440.1 hypothetical protein / Strong similarity to gb X95263 Periodic tryptophan protein 2 gene (PWP2) from Homo sapiens and contains 6 WD40, G-beta repeat domains; supported by cDNA: gi_17529277 Length = 900 Score = 54.3 bits (129), Expect = 6e-08 Identities = 47/183 (25%), Positives = 80/183 (43%), Gaps = 3/183 (1%) Frame = +1 Query: 79 NMATISPDGRFIAAAAFTADVKVWEIVYSKDSSVKEVTKVMQLKGHKSAVTWLCFTPNSE 258 N T SPD + +A A VKVW ++ T + H +AVT L F ++ Sbjct: 393 NCVTYSPDSQLLATGADDNKVKVWNVMSG--------TCFITFTEHTNAVTALHFMADNH 444 Query: 259 QIITASKDGSIRVWNINVRYHLDEDPKTLKSFEIPLHDSKGSVLSYDRLSVSPDGKILAA 438 +++AS DG++R W+ RY K K++ P + + L+ P G ++ A Sbjct: 445 SLLSASLDGTVRAWDFK-RY------KNYKTYTTP------TPRQFVSLTADPSGDVVCA 491 Query: 439 ---THGSLLQWLSVETGQVLETADKAHDGDITDIAWAPKPISVGDXRLSILATASVDKKV 609 + W S +TGQ+ + H+ + + ++P +LA++S D V Sbjct: 492 GTLDSFEIFVW-SKKTGQIKDIL-SGHEAPVHGLMFSP--------LTQLLASSSWDYTV 541 Query: 610 ELW 618 LW Sbjct: 542 RLW 544 >At5g23430.1 putative protein / contains similarity to unknown protein (gb|AAB71474.1) Length = 922 Score = 54.3 bits (129), Expect = 6e-08 Identities = 45/194 (23%), Positives = 84/194 (43%), Gaps = 1/194 (0%) Frame = +1 Query: 112 IAAAAFTADVKVWEIVYSKDSSVKEVTKVMQLKGHKSAVTWLCFTPNSEQIITASKDGSI 291 +AA A + +K+W++ +E V L GH+S + F P E + S D ++ Sbjct: 74 VAAGAASGTIKLWDL--------EEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNL 125 Query: 292 RVWNINVRYHLDEDPKTLKSFEIPLHDSKGSVLSYDRLSVSPDGK-ILAATHGSLLQWLS 468 ++W+I + + H KG + L +PDG+ +++ ++++ Sbjct: 126 KIWDIRKKGCI--------------HTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWD 171 Query: 469 VETGQVLETADKAHDGDITDIAWAPKPISVGDXRLSILATASVDKKVELWAAPAL**VDS 648 + G++L T K+H+G I + + P +LAT S D+ V+ W + S Sbjct: 172 LTAGKLL-TEFKSHEGQIQSLDFHPHEF--------LLATGSADRTVKFWDLETFELIGS 222 Query: 649 MPPNPSKAVCQSRN 690 P + C S N Sbjct: 223 GGPETAGVRCLSFN 236 Score = 47.4 bits (111), Expect = 7e-06 Identities = 25/106 (23%), Positives = 49/106 (45%) Frame = +1 Query: 13 IKLWHGKSGKLLGNVDTNQLKNNMATISPDGRFIAAAAFTADVKVWEIVYSKDSSVKEVT 192 IKLW + K++ + ++ P G F A+ + ++K+W+I ++ Sbjct: 83 IKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDTNLKIWDI--------RKKG 134 Query: 193 KVMQLKGHKSAVTWLCFTPNSEQIITASKDGSIRVWNINVRYHLDE 330 + KGH V L FTP+ +++ +D ++VW++ L E Sbjct: 135 CIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAGKLLTE 180 >At5g08390.1 katanin p80 subunit - like protein / katanin p80 subunit, Strongylocentrotus purpuratus, EMBL:AF052433 Length = 871 Score = 52.8 bits (125), Expect = 2e-07 Identities = 48/208 (23%), Positives = 91/208 (43%), Gaps = 2/208 (0%) Frame = +1 Query: 1 EGTDIKLWH-GKSGKLLGNVDTNQLKNNMATISPDGRFIAAAAFTADVKVWEIVYSKDSS 177 E + LW GK +L + +++ + +G +AA A + +K+W++ Sbjct: 130 EDHKVNLWAIGKPNAILSLYGHSSGIDSVTFDASEG-LVAAGAASGTIKLWDL------- 181 Query: 178 VKEVTKVMQLKGHKSAVTWLCFTPNSEQIITASKDGSIRVWNINVRYHLDEDPKTLKSFE 357 +E V L GH+S + F P E + S D ++++W+I + + Sbjct: 182 -EEAKVVRTLTGHRSNCVSVNFHPFGEFFASGSLDTNLKIWDIRKKGCI----------- 229 Query: 358 IPLHDSKGSVLSYDRLSVSPDGK-ILAATHGSLLQWLSVETGQVLETADKAHDGDITDIA 534 H KG + L +PDG+ I++ ++++ + G++L K+H+G I + Sbjct: 230 ---HTYKGHTRGVNVLRFTPDGRWIVSGGEDNVVKVWDLTAGKLLHEF-KSHEGKIQSLD 285 Query: 535 WAPKPISVGDXRLSILATASVDKKVELW 618 + P +LAT S DK V+ W Sbjct: 286 FHPHEF--------LLATGSADKTVKFW 305 >At1g24130.1 G-protein beta family / similar to hypothetical protein, GB:AAB61511 Length = 415 Score = 52.4 bits (124), Expect = 2e-07 Identities = 35/131 (26%), Positives = 62/131 (46%), Gaps = 10/131 (7%) Frame = +1 Query: 13 IKLWHGKSGK--LLGNVDTNQLKNNMATISPDGRFIAAAAFTADVKVWEIVYSKDSSVKE 186 IK+W+ K K L+ + + N IS DG+ + + A + VWE + + D Sbjct: 258 IKVWNKKDKKHSLVATLTKHLSAVNALAISEDGKVLYSGACDRSILVWERLINGDDEELH 317 Query: 187 VTKVMQLKGHKSAVTWLCFTPNSEQIITASKDGSIRVWNINVRYH--------LDEDPKT 342 ++ V L+GH+ A+ +C S+ +++ S D S+RVW + L+ K Sbjct: 318 MSVVGALRGHRKAI--MCLAVASDLVLSGSADKSLRVWRRGLMEKEGYSCLAVLEGHTKP 375 Query: 343 LKSFEIPLHDS 375 +KS + + DS Sbjct: 376 VKSLAVSVSDS 386 >At5g52820.1 Notchless protein homolog / Length = 473 Score = 50.1 bits (118), Expect = 1e-06 Identities = 43/164 (26%), Positives = 74/164 (44%), Gaps = 5/164 (3%) Frame = +1 Query: 142 KVWEIVYSKDS--SVKEVTKVMQ-LKGHKSAVTWLCFTPNSEQIITASKDGSIRVWNINV 312 KV IVY + + ++ V + Q + GH AV + F+P+ +Q+ + S D ++R+W++ Sbjct: 81 KVLTIVYQQQAVFRIRPVNRCSQTIAGHAEAVLCVSFSPDGKQLASGSGDTTVRLWDLYT 140 Query: 313 RYHLDEDPKTLKSFEIPLHDSKGSVLSYDRLSVSPDGK--ILAATHGSLLQWLSVETGQV 486 E PL KG ++ SPDGK + + G + W + + G++ Sbjct: 141 --------------ETPLFTCKGHKNWVLTVAWSPDGKHLVSGSKSGEICCW-NPKKGEL 185 Query: 487 LETADKAHDGDITDIAWAPKPISVGDXRLSILATASVDKKVELW 618 + H IT I+W P +S R T+S D +W Sbjct: 186 EGSPLTGHKKWITGISWEPVHLSSPCRR---FVTSSKDGDARIW 226 >At3g42660.1 putative protein / AND-1 protein - Homo sapiens, EMBL:AJ006266 Length = 951 Score = 50.1 bits (118), Expect = 1e-06 Identities = 56/207 (27%), Positives = 87/207 (41%), Gaps = 5/207 (2%) Frame = +1 Query: 13 IKLWHGKSGKLLGNVDTNQLKNNMATISPDGRFIAAAAFTADVKVWEIVYSKDSSVKEVT 192 +KL+ SG+ N+ L + + G +AAA +K ++ + D S+ V Sbjct: 86 VKLYKFPSGEFQTNITRFTLPIRVLAFNGSGSLLAAAGDDEGIK---LINTFDGSIVRV- 141 Query: 193 KVMQLKGHKSAVTWLCFTPNSEQIITASKDGSIRVWNIN---VRYHLDEDPKTLKSFEIP 363 LKGHK VT L F PN E + + G++ W + V + TLK P Sbjct: 142 ----LKGHKGPVTGLDFHPNGELLASIDTTGTVLCWELQNGVVSF-------TLKGV-AP 189 Query: 364 LHDSKGSVLSYDRLSVSPDGKILA--ATHGSLLQWLSVETGQVLETADKAHDGDITDIAW 537 S+++ R SPDG+ LA ++ + TG+ L H I + W Sbjct: 190 DTGFNTSIVNIPRW--SPDGRTLAVPGLRNDVVMY-DRFTGEKLFALRGDHLEAICYLTW 246 Query: 538 APKPISVGDXRLSILATASVDKKVELW 618 AP +AT+ +DK+V LW Sbjct: 247 APNG--------KYIATSGLDKQVLLW 265 >At4g05410.1 U3 snoRNP-associated-related / U3 snoRNP-associated 55-kDa protein, Homo sapiens, gb:NP_004695 Length = 504 Score = 49.7 bits (117), Expect = 1e-06 Identities = 31/115 (26%), Positives = 55/115 (46%), Gaps = 1/115 (0%) Frame = +1 Query: 64 NQLKNNMA-TISPDGRFIAAAAFTADVKVWEIVYSKDSSVKEVTKVMQLKGHKSAVTWLC 240 N + ++A +S DGR++A V +W+ V+ V GH++ V+ LC Sbjct: 220 NHSRESLALAVSSDGRYLATGGVDRHVHIWD--------VRTREHVQAFPGHRNTVSCLC 271 Query: 241 FTPNSEQIITASKDGSIRVWNINVRYHLDEDPKTLKSFEIPLHDSKGSVLSYDRL 405 F + ++ + S D +++VWN+ ED K+F H +G +L+ D L Sbjct: 272 FRYGTSELYSGSFDRTVKVWNV-------ED----KAFITENHGHQGEILAIDAL 315 >At1g61210.1 G-protein beta family / contains similarity to katanin p80 subunit GI:3005601 from [Strongylocentrotus purpuratus] Length = 282 Score = 48.9 bits (115), Expect = 3e-06 Identities = 24/106 (22%), Positives = 51/106 (47%) Frame = +1 Query: 13 IKLWHGKSGKLLGNVDTNQLKNNMATISPDGRFIAAAAFTADVKVWEIVYSKDSSVKEVT 192 IKLW + K++ ++ + P G F+A+ + A++K+W+I ++ Sbjct: 112 IKLWDVEEAKMVRAFTGHRSNCSAVEFHPFGEFLASGSSDANLKIWDI--------RKKG 163 Query: 193 KVMQLKGHKSAVTWLCFTPNSEQIITASKDGSIRVWNINVRYHLDE 330 + KGH ++ + FTP+ +++ D ++VW++ L E Sbjct: 164 CIQTYKGHSRGISTIRFTPDGRWVVSGGLDNVVKVWDLTAGKLLHE 209 >At5g25150.1 transcription initiation factor IID-associated factor-like protein / 100 kDa subunit of Pol II transcription factor - Homo sapiens, EMBL:X95525 Length = 700 Score = 47.8 bits (112), Expect = 6e-06 Identities = 47/197 (23%), Positives = 81/197 (40%), Gaps = 17/197 (8%) Frame = +1 Query: 79 NMATISPDGRFIAAAAFTADVKVWEIVY-----------SKDSSVKEV-----TKVMQLK 210 N ++IS DG +A + +KVW++ DSS + + L Sbjct: 356 NCSSISHDGSLVAGGFSDSSIKVWDMAKIGQAGSGALQAENDSSDQSIGPNGRRSYTLLL 415 Query: 211 GHKSAVTWLCFTPNSEQIITASKDGSIRVWNINVRYHLDEDPKTLKSFEIPLHDSKGSVL 390 GH V F+P + ++++S D +IR+W+ + +L K P+ D++ Sbjct: 416 GHSGPVYSATFSPPGDFVLSSSADTTIRLWSTKLNANL----VCYKGHNYPVWDAQ---- 467 Query: 391 SYDRLSVSPDGKILAA-THGSLLQWLSVETGQVLETADKAHDGDITDIAWAPKPISVGDX 567 SP G A+ +H + S++ Q L + G ++D+ W P Sbjct: 468 ------FSPFGHYFASCSHDRTARIWSMDRIQPL----RIMAGHLSDVDWHP-------- 509 Query: 568 RLSILATASVDKKVELW 618 + +AT S DK V LW Sbjct: 510 NCNYIATGSSDKTVRLW 526 >At4g04940.1 putative WD-repeat membrane protein / ; supported by cDNA: gi_16604678_gb_AY059784.1_ Length = 910 Score = 47.0 bits (110), Expect = 1e-05 Identities = 34/145 (23%), Positives = 67/145 (45%) Frame = +1 Query: 10 DIKLWHGKSGKLLGNVDTNQLKNNMATISPDGRFIAAAAFTADVKVWEIVYSKDSSVKEV 189 D+K+W K +L D + +G +A A ++++++V K Sbjct: 497 DLKVWDFKKRELKSQWDVGCSLVKIVYHRVNG-LLATVADDFVIRLYDVVTLK------- 548 Query: 190 TKVMQLKGHKSAVTWLCFTPNSEQIITASKDGSIRVWNINVRYHLDEDPKTLKSFEIPLH 369 V + +GH +T LCF+ + + +I++S DGS+R+W++ + +D ++P+ Sbjct: 549 -MVREFRGHTDRITDLCFSEDGKWVISSSMDGSLRIWDVILAKQIDG-----VHVDVPI- 601 Query: 370 DSKGSVLSYDRLSVSPDGKILAATH 444 LS+SP+ +LA H Sbjct: 602 ---------TALSLSPNMDVLATAH 617 >At5g26900.1 fizzy-related (FZR), putative / WD-repeat protein, carrot, PIR:T14352 Length = 444 Score = 47.0 bits (110), Expect = 1e-05 Identities = 28/113 (24%), Positives = 56/113 (48%), Gaps = 1/113 (0%) Frame = +1 Query: 13 IKLWHGKSGKLLGNVDTNQLKNNMATISPDGRFIAAAAFTAD-VKVWEIVYSKDSSVKEV 189 IK W+ +G L +V+T ++ + +++ FT + + +W+ + Sbjct: 327 IKFWNTHTGACLNSVETGSQVCSLLWSQSERELLSSHGFTQNQLTLWKY--------PSM 378 Query: 190 TKVMQLKGHKSAVTWLCFTPNSEQIITASKDGSIRVWNINVRYHLDEDPKTLK 348 +K+ +L GH S V ++ +PN + +A+ D ++R+WN+ E PKT K Sbjct: 379 SKMAELNGHTSRVLFMAQSPNGCTVASAAGDENLRLWNV-----FGEPPKTTK 426 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,928,327 Number of Sequences: 27288 Number of extensions: 341878 Number of successful extensions: 1598 Number of sequences better than 1.0e-05: 24 Number of HSP's better than 0.0 without gapping: 1132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1474 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1209984928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB15N11.yg.ab1 (734 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g33480.1 hypothetical protein / 186 8e-48 >At4g33480.1 hypothetical protein / Length = 234 Score = 186 bits (473), Expect = 8e-48 Identities = 93/167 (55%), Positives = 119/167 (70%), Gaps = 3/167 (1%) Frame = +1 Query: 4 PVKKRQSSS--SSTNNKKPVKKNTKNGGSGSGFKKGFGVNEEEDD-DYEETTSSSKARYQ 174 P KK + S SSTN K+ K + EE+DD DY ++SS Sbjct: 61 PTKKASTGSDKSSTNKKRKKKGKIAKPVEDWELRDSEDAFEEDDDADYSSSSSSLATFNS 120 Query: 175 PLPLPKPPAGFLVDDQGRVVAVSDRRIATIVDPANNFPLECVIRRVFRSSQGDECMLLCP 354 P +PKPPAGF++++ GRV+ S +RI T++DP NN PL+CVIRRVF SS+G++CMLLCP Sbjct: 121 PPTIPKPPAGFVINETGRVLMASKKRITTVIDPTNNSPLDCVIRRVFTSSKGEDCMLLCP 180 Query: 355 IDTPVQILKSTNFEGWSAVSDDEVESILPTASYALAKIHMHLVYSGF 495 +DTPVQILKSTN +GWSAVSD+EVES+LP A+YALAKIHMHLV+SG+ Sbjct: 181 VDTPVQILKSTNIDGWSAVSDEEVESLLPAAAYALAKIHMHLVHSGY 227 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,671,210 Number of Sequences: 27288 Number of extensions: 446943 Number of successful extensions: 1942 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1760 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1926 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB16I11.yg.ab1 (607 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g37510.1 putative protein / ribonuclease III, Bacillus sub... 356 5e-99 >At4g37510.1 putative protein / ribonuclease III, Bacillus subtilis, PIR2:B69693 Length = 537 Score = 356 bits (914), Expect = 5e-99 Identities = 164/196 (83%), Positives = 179/196 (90%) Frame = +3 Query: 3 RVYALIGKKYLPKWVKAASLHNLIFQFDDMDKLLRKEREPPVKSVVWALFGAIYLCFGMP 182 RV+ALIGK+YLPKW+KAASL NLIF +DDMDKL+RKEREPPVKSV WALFGAIYLCFGMP Sbjct: 226 RVFALIGKRYLPKWIKAASLQNLIFPYDDMDKLIRKEREPPVKSVFWALFGAIYLCFGMP 285 Query: 183 EVYRVLFEVFGMDPEDEECQPKLRRQLEDVDFVSAEFEGKKLTWQEVAAYKPPEDALFAH 362 EVYRVLFEVFGMDP+ +ECQP+ RRQLEDVD+VS EFEGKKL WQ++A YKPPEDALFAH Sbjct: 286 EVYRVLFEVFGMDPDADECQPRSRRQLEDVDYVSVEFEGKKLGWQDIATYKPPEDALFAH 345 Query: 363 PRLFRACVPPGMHRFRGNIWDYDSRPQVMNTLGYPLQVKDRIPEITNARNIELGLGLQLA 542 PRLFRACVPPGMHRFRGNIWD+DS+P+VM TLGYPL + DRI EIT ARNIELGLGLQL Sbjct: 346 PRLFRACVPPGMHRFRGNIWDFDSKPKVMQTLGYPLTMNDRIKEITEARNIELGLGLQLC 405 Query: 543 FLHPSKHKFEHP*ILF 590 FLHPSKHKFEHP F Sbjct: 406 FLHPSKHKFEHPRFCF 421 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,351,278 Number of Sequences: 27288 Number of extensions: 293702 Number of successful extensions: 847 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 840 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 957813068 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB16I21.yg.ab1 (321 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g64510.1 plastid ribosomal protein S6, putative / similar ... 131 6e-32 >At1g64510.1 plastid ribosomal protein S6, putative / similar to plastid ribosomal protein S6 precursor GB:AAF64311 GI:7582401 from [Spinacia oleracea]; supported by full-length cDNA: Ceres: 15602. Length = 207 Score = 131 bits (330), Expect = 6e-32 Identities = 62/74 (83%), Positives = 69/74 (92%) Frame = +1 Query: 1 GGMYVEVFNRGVIPLAYSIKKKNKAGETNTYLDGIYLLFTFFTKPESLEVLETTLTMDDD 180 GGMYVEVFNRGVIPLAYSI+KKNKAGETNTYLDGIYLLFT+FTKPES+ LET LT DDD Sbjct: 133 GGMYVEVFNRGVIPLAYSIRKKNKAGETNTYLDGIYLLFTYFTKPESIVPLETVLTADDD 192 Query: 181 VIRSSTFLVRKRKY 222 +IRSS+F ++KRKY Sbjct: 193 IIRSSSFKIKKRKY 206 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,053,121 Number of Sequences: 27288 Number of extensions: 139605 Number of successful extensions: 297 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 297 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 297 length of database: 11,516,596 effective HSP length: 82 effective length of database: 9,278,980 effective search space used: 222695520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB16K08.yg.ab1 (552 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g19910.1 SOH1 - like protein / SOH1, Saccharomyces cerevis... 257 3e-69 At2g14890.1 arabinogalactan-protein (AGP9) / identical to gi|... 47 6e-06 >At5g19910.1 SOH1 - like protein / SOH1, Saccharomyces cerevisiae, PIR:S47895; supported by cDNA: gi_18176432 Length = 196 Score = 257 bits (656), Expect = 3e-69 Identities = 127/170 (74%), Positives = 138/170 (80%), Gaps = 1/170 (0%) Frame = +1 Query: 1 GRQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKYIMYPHCL 180 GRQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIK+IMYPHCL Sbjct: 28 GRQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCL 87 Query: 181 YFLELLQNASFRNAMAHPANKELTHRQQFYFWKNYRNNRLKHILPRPLPETTAPPPSNAV 360 YFLELLQN +FR AMAHPANKEL HRQQFY+WKNYRNNRLKHILPRPLPE P P Sbjct: 88 YFLELLQNPNFRTAMAHPANKELAHRQQFYYWKNYRNNRLKHILPRPLPEPVPPQP---- 143 Query: 361 PPPPTTTIAAASSGGPVAVPPVLSPMQY-GVPSGPPLKSDPRSGIDRRKR 507 P P+T++ A S A+ P LSPMQY + S ++ +GIDRRKR Sbjct: 144 PVAPSTSLPPAPS-ATAALSPALSPMQYNNMLSKNDTRNMGATGIDRRKR 192 >At2g14890.1 arabinogalactan-protein (AGP9) / identical to gi|10880495|gb|AAG24277; supported by cDNA: gi_13265425_gb_AF324669.2_AF324669 Length = 191 Score = 47.0 bits (110), Expect = 6e-06 Identities = 27/63 (42%), Positives = 29/63 (45%), Gaps = 9/63 (14%) Frame = +1 Query: 319 PLPETTAPPPSNAVP---------PPPTTTIAAASSGGPVAVPPVLSPMQYGVPSGPPLK 471 P P TTAPPP+N P PPP T AS PVA PP +P P PL Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLA 117 Query: 472 SDP 480 S P Sbjct: 118 SPP 120 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,047,834 Number of Sequences: 27288 Number of extensions: 374271 Number of successful extensions: 5443 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 2005 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3856 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 808093080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB16M05.yg.ab1 (707 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g10320.1 putative protein / 135 7e-33 >At5g10320.1 putative protein / Length = 369 Score = 135 bits (341), Expect(2) = 7e-33 Identities = 69/129 (53%), Positives = 90/129 (69%) Frame = +1 Query: 292 LDTINEKLLQLPSDGIPDSDMMTPDWILRFIKSFKNDTFKPLAVLLESYGIYTDRIRDEL 471 +D +NEK++ + G + W F+ + KPL LLE + T+R++ E Sbjct: 140 MDALNEKIVSESACG-SQVIYSSHGWNAESRVLFETNPLKPLGDLLEREALLTNRVQQEF 198 Query: 472 KCGEEYWALERKLCSALTNKQEIQIEDVMRAIHLKSFDYRVLNLLLYQLNGKDINETHME 651 GEEYWALERKLC AL+NK +I +EDVMRAIHLKSFDYRVLNLLLY+L G+++NE HM+ Sbjct: 199 NSGEEYWALERKLCHALSNKNKICLEDVMRAIHLKSFDYRVLNLLLYKLRGEEVNELHMD 258 Query: 652 FLSVSEFLV 678 FLS+SEFLV Sbjct: 259 FLSISEFLV 267 Score = 22.3 bits (46), Expect(2) = 7e-33 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +2 Query: 674 LWEVSDDLFDY 706 L EV+DDLFDY Sbjct: 266 LVEVADDLFDY 276 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,830,427 Number of Sequences: 27288 Number of extensions: 312746 Number of successful extensions: 819 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 819 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1236675772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB17A10.yg.ab1 (604 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g35630.1 similar to ch-TOG protein from Homo sapiens / ; ... 89 2e-18 >At2g35630.1 similar to ch-TOG protein from Homo sapiens / ; supported by cDNA: gi_14317952_gb_AF367246.1_AF367246 Length = 1611 Score = 88.6 bits (218), Expect = 2e-18 Identities = 64/171 (37%), Positives = 82/171 (47%), Gaps = 3/171 (1%) Frame = +1 Query: 1 GRTPASVPMMPTPPPSALNLSSPKLGHLSPVNTNHNNTLNEGRASVVVNTNFTLPPTSYA 180 GRTP+S+P+ TPPPS+L L SP + LS ++ + P S Sbjct: 1473 GRTPSSLPLS-TPPPSSLALPSPDIPSLSSLDVKP-----------------LMNPRSDL 1514 Query: 181 EDDQRNIDRFQSGGVSSGIDAIRERMKNMQLTTTEA---HIQQTNGSLNSEHQSSNPAVD 351 D G ++ +DAIRERMKNMQL ++E + TN +L+ QS Sbjct: 1515 YTDDIRASNMNPGVMTGTLDAIRERMKNMQLASSEPVSKPLMPTNDNLSMNQQSV----- 1569 Query: 352 EVDISSTTANNPPPPPPPPVPPVHSGVLPMDEKALSGLQARMERLKSGSID 504 PP H VLPMDEKALSGLQARMERLK GS++ Sbjct: 1570 -----------PPSQMGQETVHTHPVVLPMDEKALSGLQARMERLKGGSLE 1609 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.315 0.132 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,503,897 Number of Sequences: 27288 Number of extensions: 421398 Number of successful extensions: 9506 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6335 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 948861544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB17C13.yg.ab1 (648 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g27480.1 expressed protein / similar to lecithin:cholester... 300 3e-82 >At1g27480.1 expressed protein / similar to lecithin:cholesterol acyltransferase precursor (M26268);supported by full-length cDNA: Ceres:35408. Length = 432 Score = 300 bits (769), Expect = 3e-82 Identities = 145/212 (68%), Positives = 169/212 (79%), Gaps = 1/212 (0%) Frame = +1 Query: 1 GHPCDVGSTFLQNIKQLIEEASDSNGGKPVILISHSLGGLFVLQLLNRNPPSWRKQYIKH 180 GHP V S FLQ++KQL+E+ S N GKPVIL+SHSLGGLFVL LNR PSWR++YIKH Sbjct: 174 GHPSRVASQFLQDLKQLVEKTSSENEGKPVILLSHSLGGLFVLHFLNRTTPSWRRKYIKH 233 Query: 181 FIALAAPWGGTVDEMLTFASGNSLGVPLVNPLLVRNEQRSSESNLWLLPRTKQF-PQEKP 357 F+ALAAPWGGT+ +M TFASGN+LGVPLVNPLLVR QR+SESN WLLP TK F + KP Sbjct: 234 FVALAAPWGGTISQMKTFASGNTLGVPLVNPLLVRRHQRTSESNQWLLPSTKVFHDRTKP 293 Query: 358 LVVTKNSTYSSFDISRFLEDIGFPEGVQPYQKRVLPLVEKLAAPGIPVTCIIGSGVQTPE 537 LVVT Y+++++ RF DIGF +GV PY+ RVLPL E+L PG+PVTCI G GV TPE Sbjct: 294 LVVTPQVNYTAYEMDRFFADIGFSQGVVPYKTRVLPLTEELMTPGVPVTCIYGRGVDTPE 353 Query: 538 SLHYGEEGFDKQPEIVYGDGDGTVNMASLLAL 633 L YG+ GFDKQPEI YGDGDGTVN+ASL AL Sbjct: 354 VLMYGKGGFDKQPEIKYGDGDGTVNLASLAAL 385 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,902,293 Number of Sequences: 27288 Number of extensions: 419793 Number of successful extensions: 1640 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1636 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1070908320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB17C23.yg.ab1 (756 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58070.1 outer membrane lipoprotein - like / outer membran... 317 3e-87 >At5g58070.1 outer membrane lipoprotein - like / outer membrane lipoprotein, Citrobacter freundii, PIR:I40710;supported by full-length cDNA: Ceres:17098. Length = 186 Score = 317 bits (813), Expect = 3e-87 Identities = 144/183 (78%), Positives = 165/183 (89%) Frame = +1 Query: 52 KKAMEVVKGIDLQRYMGRWYEIASFPSRFQPKDGINTRATYTLKDDGTVNVLNETWSGGK 231 KK MEVVKG++++RYMGRWYEIASFPSRFQPK+G++TRATYTL DGT++VLNETWS GK Sbjct: 4 KKEMEVVKGLNVERYMGRWYEIASFPSRFQPKNGVDTRATYTLNPDGTIHVLNETWSNGK 63 Query: 232 RGFIEGTAYKADPKSDEAKLKVKFYVPPFLPIIPVTGDYWVLYLDDDYQYALIGQPSRSY 411 RGFIEG+AYKADPKSDEAKLKVKFYVPPFLPIIPVTGDYWVLY+D DYQ+ALIGQPSRSY Sbjct: 64 RGFIEGSAYKADPKSDEAKLKVKFYVPPFLPIIPVTGDYWVLYIDPDYQHALIGQPSRSY 123 Query: 412 LWILCRQTHLDDEIYNQLVQKATEEGYDVSKLKKTTQTEPPPESEDAPADTKGIWWFKSL 591 LWIL R +++E Y QLV+KA EEGYD+SKL KT Q++ PPES AP D+KG+WWFKSL Sbjct: 124 LWILSRTAQMEEETYKQLVEKAVEEGYDISKLHKTPQSDTPPESNTAPEDSKGVWWFKSL 183 Query: 592 FGK 600 FGK Sbjct: 184 FGK 186 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,889,319 Number of Sequences: 27288 Number of extensions: 417897 Number of successful extensions: 1158 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1156 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB17N03.yg.ab1 (478 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g51650.1 epsilon subunit of mitochondrial F1-ATPase / iden... 124 3e-29 >At1g51650.1 epsilon subunit of mitochondrial F1-ATPase / identical to epsilon subunit of mitochondrial F1-ATPase [Arabidopsis thaliana] GI:1655486; supported by cDNA: gi_1655485_dbj_D88377.1_D88377 Length = 70 Score = 124 bits (310), Expect = 3e-29 Identities = 55/68 (80%), Positives = 63/68 (91%) Frame = +1 Query: 61 MASTAAVPFWRSAGMTYISYSNICASLVRNCLKEPYKAEAIGREKVHFSVSKWADGKPEK 240 MAS AAVPFWR+AGMTYISYSNICA++VRNCLKEP+KAEA+ REKVHFS+SKWADGKP+K Sbjct: 1 MASNAAVPFWRAAGMTYISYSNICANIVRNCLKEPHKAEALTREKVHFSLSKWADGKPQK 60 Query: 241 PTIRSSNP 264 P +RS P Sbjct: 61 PVLRSDTP 68 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,596,720 Number of Sequences: 27288 Number of extensions: 225288 Number of successful extensions: 597 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 596 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 605236996 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB18B04.yg.ab1 (630 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g19970.1 putative protein / 145 1e-35 >At5g19970.1 putative protein / Length = 363 Score = 145 bits (367), Expect = 1e-35 Identities = 90/214 (42%), Positives = 126/214 (58%), Gaps = 5/214 (2%) Frame = +3 Query: 3 VISVDPITKTVKRIPQSPLGPRGTSSWRRSGIKLLAGPSGSGQFRFLFAEMVDNNPTLFE 182 +I+VD + K V RI PLGPRGTSSWRRSG+KL+ PS FRF+FAEMV+N P LF Sbjct: 94 IIAVDLVGKIVTRISSCPLGPRGTSSWRRSGMKLVPDPSNPSHFRFMFAEMVNNRPVLFT 153 Query: 183 YDSTTNKWKSTIARENNVNLTHNNVKDKDRIFLSASNGPNTSIVISV--GCDIND-PLVV 353 Y S T W + +E K+ + +FLS SN P+ S V+SV G IN P ++ Sbjct: 154 YYSNTATWHT---KETEDTTNWEVKKNSNVLFLSLSNRPHESTVMSVDDGSIINRFPRIL 210 Query: 354 RPRFTA-VPEDGELAVGFSWGSVINR-LHIYGDGRMLIVRSGSVGLNDSSRRIRCLKHIE 527 RPR +VGFS + ++ LHI+GD +++R + D+S+ + +K +E Sbjct: 211 RPRINQDAIRQCPSSVGFSRNDLESQLLHIHGDEYKVVIRLDRI---DNSKMNKVMKSLE 267 Query: 528 LWGLNPNGSQWAFVSSIPNGLIDEIKKPYGVMMG 629 +W ++ NG +W VS P+ +I KKP GVMMG Sbjct: 268 VWEISSNGEKWELVSRAPSEVIS--KKPCGVMMG 299 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,695,984 Number of Sequences: 27288 Number of extensions: 329408 Number of successful extensions: 795 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 793 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1017362904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB18D17.yg.ab1 (738 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26970.1 hypothetical protein / predicted by grail; suppor... 239 1e-63 >At2g26970.1 hypothetical protein / predicted by grail; supported by cDNA: gi_17381149 Length = 222 Score = 239 bits (609), Expect = 1e-63 Identities = 121/204 (59%), Positives = 157/204 (76%), Gaps = 1/204 (0%) Frame = +3 Query: 126 MSTLSNAFSLLELDVEDDREETTNATDNKKEA-NGNHDKETDSLQDATLIKNDKGTRQTL 302 M+ LSNAFS+L ED ++++T ++E+ NG SL+D Sbjct: 1 MNKLSNAFSVLAFADEDAPMASSSSTGKQEESVNG-------SLED-------------- 39 Query: 303 DMLEGEYRLPLVWIDLEMTGLNIEVDRILEIACVITDGKLTKSVEGPDLVIHQTKECLEK 482 G+Y+ PLVWIDLEMTGLN+EVDRILEIAC+IT+G LT+SVEGPDLV+ QTK+CL+K Sbjct: 40 ----GDYKQPLVWIDLEMTGLNVEVDRILEIACIITNGDLTQSVEGPDLVVRQTKDCLDK 95 Query: 483 MGEWCQDHHAASGLTERVIQSSISEKEAEQQVVDFVKKHVGTYTPLLAGNSIYVDFLFLK 662 M +WCQ HH ASGLT++V+ S+I+E+EAEQ+V++FVKKHVG+ PLLAGNS+YVDFLFLK Sbjct: 96 MDDWCQTHHGASGLTKKVLLSAITEREAEQKVIEFVKKHVGSGNPLLAGNSVYVDFLFLK 155 Query: 663 KYMPDLASLFSHVVVDVSSIKALC 734 KYMP+LA+LF H++VDVSS+KALC Sbjct: 156 KYMPELAALFPHILVDVSSVKALC 179 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,946,596 Number of Sequences: 27288 Number of extensions: 346585 Number of successful extensions: 1308 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1224 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1305 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1312709680 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB18E22.yg.ab1 (710 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g12370.1 putative protein / similarity to sec10, Drosophil... 380 e-106 >At5g12370.1 putative protein / similarity to sec10, Drosophila melanogaster, AE003746~Contains Putative AMP-binding domain signature AA505-516 Length = 863 Score = 380 bits (976), Expect = e-106 Identities = 203/242 (83%), Positives = 217/242 (88%), Gaps = 7/242 (2%) Frame = +1 Query: 4 ESTGSIGRSKGASISSSHQQISVTVVTEFVRWNEEAISRCTLFSPQPGNLATNVKTVFTC 183 ES+G+IGRSKGASISSS QQISVTVVT+FVRWNEEAI+RCTLFS QP LA NVK +FTC Sbjct: 507 ESSGTIGRSKGASISSSLQQISVTVVTDFVRWNEEAITRCTLFSSQPATLAANVKAIFTC 566 Query: 184 LLDQVSQYTTEGLERARDGLTEAAALRERFVLGTSVSRRVAAAAASAAEAAAAAGESSFR 363 LLDQVS Y TEGLERARD L+EAAALRERFVLG RRVAAAAASAAEAAAAAGESSF+ Sbjct: 567 LLDQVSVYITEGLERARDSLSEAAALRERFVLG----RRVAAAAASAAEAAAAAGESSFK 622 Query: 364 SFMVAVQRCGSSVAIVQQ-------YFANSISRLLLPVDGAHAASCEEMATAMSSAEGAA 522 SFMVAVQRCGSSVAIVQQ YFANSISRLLLPVDGAHAASCEEM+TA+S AE AA Sbjct: 623 SFMVAVQRCGSSVAIVQQACWITFMYFANSISRLLLPVDGAHAASCEEMSTALSKAEAAA 682 Query: 523 YKGLQQCIETVMAEVERLLSAEQKATDYKSPDDGIVPDHRPTNACIRVVAYLSRVLEAAF 702 YKGLQQCIETVMAEV+RLLS+EQK+TDY+S DDGI DHRPTNACIRVVAYLSRVLE+AF Sbjct: 683 YKGLQQCIETVMAEVDRLLSSEQKSTDYRSTDDGIASDHRPTNACIRVVAYLSRVLESAF 742 Query: 703 TA 708 TA Sbjct: 743 TA 744 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.315 0.125 0.341 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,279,080 Number of Sequences: 27288 Number of extensions: 365513 Number of successful extensions: 2027 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1841 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1245572720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB18F17.yg.ab1 (735 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62360.1 putative protein / Pm5 protein - Homo sapiens, PI... 329 8e-91 >At3g62360.1 putative protein / Pm5 protein - Homo sapiens, PIR:S21977 Length = 1227 Score = 329 bits (844), Expect = 8e-91 Identities = 157/244 (64%), Positives = 200/244 (81%) Frame = +1 Query: 1 DDITYHIEASKPGYHVKEIGPYSFSCQKLGQISVHIHSKEDANELFPSVLLSLSGEDGYR 180 DDI Y EASKPGYH+K +GPYSFSCQKLGQISV ++SK++A P +LLSLSG+ GYR Sbjct: 855 DDIPYATEASKPGYHIKRLGPYSFSCQKLGQISVRVNSKDNAETSIPPLLLSLSGDHGYR 914 Query: 181 NNSISAAGGTFVFDNLFPGSFYLRPLLKEYAFSPSAEAVELGSGESREVVFQATRVAYSA 360 NNSIS AGG FVFD+LFPG+FYLRPLLKEY+F PS A+EL SGES E VF+ATRVAYSA Sbjct: 915 NNSISGAGGLFVFDSLFPGNFYLRPLLKEYSFKPSTLAIELNSGESSEAVFEATRVAYSA 974 Query: 361 MGIVTLLSGEPKEGVLVEARSELKSFYEETVTDSSGSYRLRGLHPDTTYTIKVARKSGFD 540 MG V LLSG+P+EGV +EARS+ K +YEET +D +G+YRLRGLHPDT Y IKV++K G Sbjct: 975 MGRVALLSGQPQEGVAIEARSDSKGYYEETTSDINGNYRLRGLHPDTAYVIKVSKKIGSA 1034 Query: 541 TSTIERASPDSVVVQVGYEDMRGIDFLVFEKPDVTLVTGTIDGERMKELHEYLRLEVRSA 720 + IERASP+SV +Q+GYED+ G+DFLVFE+P+ T++T ++G++ ++L+ L +E++SA Sbjct: 1035 NNQIERASPESVSLQIGYEDINGLDFLVFEQPETTILTCHVEGKQNEDLNSNLLVEIKSA 1094 Query: 721 TDPS 732 D S Sbjct: 1095 IDKS 1098 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.314 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,452,599 Number of Sequences: 27288 Number of extensions: 373706 Number of successful extensions: 771 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 770 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB18H02.yg.ab1 (531 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16565.1 hypothetical protein / predicted by genemarkHMM 114 4e-26 >At3g16565.1 hypothetical protein / predicted by genemarkHMM Length = 271 Score = 114 bits (284), Expect = 4e-26 Identities = 73/146 (50%), Positives = 84/146 (57%), Gaps = 26/146 (17%) Frame = +1 Query: 172 PTTLDYYHYMSKLQSDATLLSSFLGDDGRHALILDSTIFHPQGGGQPSDTGFITDVSSSS 351 PT LDY+ M LQS + LS F DGR ALIL+ST+FHPQGGGQPSDTG I S S Sbjct: 5 PTKLDYHVDMFNLQSHSRFLSLFKAQDGRIALILESTVFHPQGGGQPSDTGLIV-FSGSD 63 Query: 352 FKFIVQDVRSKNGIVYHYGVFE----KTAEDLERGVQVLLSVNESRPKLNSR-------- 495 KF VQD V HYGVFE ++ D E+G +V L+V+ESR KLNSR Sbjct: 64 LKFSVQD-------VLHYGVFEGSNPESGIDSEKGKEVYLTVDESRRKLNSRQAVEDCSH 116 Query: 496 --------------LHSAGTLLDVCM 531 LHSAG LLD+CM Sbjct: 117 CYAWHGWNKISDVWLHSAGHLLDMCM 142 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,578,708 Number of Sequences: 27288 Number of extensions: 294303 Number of successful extensions: 1102 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1043 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1099 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 745241396 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB18J24.yg.ab1 (739 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g63680.1 putative UDP-N-acetylmuramoylalanyl-D-glutamate--2,6... 424 e-119 >At1g63680.1 putative UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase / similar to UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase (murE) GB:S40595 [Escherichia coli] Length = 767 Score = 424 bits (1091), Expect = e-119 Identities = 203/245 (82%), Positives = 227/245 (91%) Frame = +1 Query: 4 DEEYRNAKLKLFGRMVDPTRHRKVVNIDDENAPLFIAQGNQDVPVVTFAMEDKKADVHPL 183 DEEYR+A+ KLF RMVDP RHRKVVNIDD NA F+ QGN +VPVVTFAME+ KADVHPL Sbjct: 456 DEEYRDAEAKLFSRMVDPERHRKVVNIDDPNAAFFVQQGNPNVPVVTFAMENTKADVHPL 515 Query: 184 QFDLSLFETQVLVDTPQGILEISSGLLGRQNVYNILAAVAVGIAVGAPLEDIVRGIEEVD 363 +F+LSLFETQVLV+TPQGILEISSGLLGR N+YNILAAVAVGIAVGAPLEDIVRG+EEVD Sbjct: 516 KFELSLFETQVLVNTPQGILEISSGLLGRHNIYNILAAVAVGIAVGAPLEDIVRGVEEVD 575 Query: 364 VVPGRCELIDEEQTYGVVVDYANTPDGLSRLLDNVRELNPKRIITVIGCPGETDRGKRPV 543 VPGRCELIDEEQ +GV+VD+ANTPDGLSRLLD++REL P+RIITVIGC GE +RGKRP+ Sbjct: 576 AVPGRCELIDEEQAFGVIVDHANTPDGLSRLLDSIRELKPRRIITVIGCEGENERGKRPL 635 Query: 544 MTKIATEKSDITMLTSDNPRNEDPLDILDDMLAGIGWTMQDYFKHQENDYHPPLKNGHRV 723 MTKIATEKSD+TMLTSDNPRNEDPLDILDDML+GIGWTMQ+Y KH E+DY+PPL NGHR+ Sbjct: 636 MTKIATEKSDVTMLTSDNPRNEDPLDILDDMLSGIGWTMQEYLKHGEHDYYPPLANGHRL 695 Query: 724 FLHDI 738 FLHDI Sbjct: 696 FLHDI 700 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,663,962 Number of Sequences: 27288 Number of extensions: 436364 Number of successful extensions: 1667 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1492 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1645 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1312709680 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB18M10.yg.ab1 (643 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g37830.1 putative protein / ;supported by full-length cDN... 126 8e-30 >At4g37830.1 putative protein / ;supported by full-length cDNA: Ceres:8286. Length = 102 Score = 126 bits (317), Expect = 8e-30 Identities = 64/100 (64%), Positives = 75/100 (75%), Gaps = 1/100 (1%) Frame = +1 Query: 70 MATAIVRSTL-RTALRGGARVNPASTRSFSAGASVEEEAREAAKWEKITYAGIAACSILA 246 MATAIVRS L R R + + A R+FS+ A ++A EAAKWEKITY GIA+C+ LA Sbjct: 1 MATAIVRSALSRAVTRAAPKTSVAPKRNFSSSAG-HDDAYEAAKWEKITYLGIASCTALA 59 Query: 247 FVNLSKGHPHFEEPPAYPYMHIRNKEFPWGPDGLFEVKEH 366 LSKGH H E+PPAYP+MHIRNKEFPWGPDGLFEVK + Sbjct: 60 VYVLSKGHHHGEDPPAYPHMHIRNKEFPWGPDGLFEVKHN 99 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,994,114 Number of Sequences: 27288 Number of extensions: 340814 Number of successful extensions: 933 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1053059848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB18M24.yg.ab1 (740 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g01590.1 expressed protein / ; supported by cDNA: gi_1529... 430 e-121 >At5g01590.1 expressed protein / ; supported by cDNA: gi_15292666_gb_AY050767.1_ Length = 424 Score = 430 bits (1106), Expect = e-121 Identities = 195/246 (79%), Positives = 226/246 (91%) Frame = +1 Query: 1 EVMDEINEMELKENSKPYRREDKKYWQSIPHVIGPDGRPMPRKAIRTRKESDDKFWDFAK 180 E+ D++N+MEL++N PYR+EDK YW++IPHV G DGRPMPRKAI++++ESDDKFWDF K Sbjct: 135 EIADDMNKMELEDNDTPYRKEDKDYWRAIPHVPGFDGRPMPRKAIKSKEESDDKFWDFMK 194 Query: 181 QFFFGLWGFRQRPYPPGRPIDVAQAIGYKRLEKRYYDFIMRSGGFFYKDRIGRTRGPCEL 360 QF FGLWGFRQRPYPPGRPIDVAQAIGYKRLEKRYYDFIM++GG++YKDR+GR+RGPCE+ Sbjct: 195 QFLFGLWGFRQRPYPPGRPIDVAQAIGYKRLEKRYYDFIMKTGGWWYKDRLGRSRGPCEI 254 Query: 361 IQLKTAWGAGIIDKYTFIWGDDMDEWAPIGMIYGMERAIATWEVRLGAAATAFIHKLQKG 540 I LKTA+GAGIID+ TFIWG+DMDEWAPI M+YG+E AIATWEVRLGAAATAF+HKLQKG Sbjct: 255 ITLKTAYGAGIIDRDTFIWGEDMDEWAPIHMVYGLEPAIATWEVRLGAAATAFLHKLQKG 314 Query: 541 IPPWVPLKGFEKKSRKQLQDEAYESKKRDLAVLEANNGIWPGVRIPSHALFLWASGSELT 720 IPPWVPLKG E K+ KQLQ EA ESKKRD+AVLEAN G+WPGVR PSHALFLWASGSELT Sbjct: 315 IPPWVPLKGREPKTYKQLQKEAIESKKRDMAVLEANGGVWPGVRTPSHALFLWASGSELT 374 Query: 721 SILEQD 738 ++LE D Sbjct: 375 TVLESD 380 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,511,734 Number of Sequences: 27288 Number of extensions: 463500 Number of successful extensions: 1223 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1223 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1321579340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB19A03.yg.ab1 (755 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g44050.1 6,7-dimethyl-8-ribityllumazine synthase precursor ... 189 6e-57 >At2g44050.1 6,7-dimethyl-8-ribityllumazine synthase precursor / ; supported by cDNA: gi_15292958_gb_AY050913.1_ Length = 227 Score = 189 bits (479), Expect(3) = 6e-57 Identities = 99/162 (61%), Positives = 124/162 (76%), Gaps = 2/162 (1%) Frame = +2 Query: 173 RSSSLALLPTRRTSSTSHLIQFSPKC--LANPLFVTATTAEKKKSPFQTEAVRQLTGFLT 346 +SSS + + + S+ + FS A+PL A E + S QT AVR +TG L Sbjct: 24 QSSSACYIHGGSSVNKSNNLSFSSSTSGFASPL---AVEKELRSSFVQTAAVRHVTGSLI 80 Query: 347 KAEGFRFAIVVARFNEIVTRPLMDGALDTLKKYSVKEEDIDVVWVPGSFEIGLVAEKLGK 526 + EG RFAIVVARFNE+VT+ L++GA++T KKYSV+EEDI+V+WVPGSFEIG+VA+ LGK Sbjct: 81 RGEGLRFAIVVARFNEVVTKLLLEGAIETFKKYSVREEDIEVIWVPGSFEIGVVAQNLGK 140 Query: 527 SGKYHAILCIGAVVRGDTTHYDAVANSAASGVLSAGLNSGGP 652 SGK+HA+LCIGAV+RGDTTHYDAVANSAASGVLSA +NSG P Sbjct: 141 SGKFHAVLCIGAVIRGDTTHYDAVANSAASGVLSASINSGVP 182 Score = 42.0 bits (97), Expect(3) = 6e-57 Identities = 18/22 (81%), Positives = 21/22 (94%) Frame = +1 Query: 679 KDMDQALNRAGGKAGNKGSEAA 744 +DMDQALNR+GGKAGNKG+E A Sbjct: 191 EDMDQALNRSGGKAGNKGAETA 212 Score = 28.9 bits (63), Expect(3) = 6e-57 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 648 VPCIFGVLTCE 680 VPCIFGVLTCE Sbjct: 181 VPCIFGVLTCE 191 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,771,733 Number of Sequences: 27288 Number of extensions: 417394 Number of successful extensions: 1251 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1251 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB19C20.yg.ab1 (747 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05560.1 E3 ubiquitin ligase APC1, putative / E3, ubiquiti... 99 2e-21 >At5g05560.1 E3 ubiquitin ligase APC1, putative / E3, ubiquitin ligase; contains similarity to Apc1/Tsg24 protein, the largest subunit of human anaphase-promoting complex (APC/C) GI:11967711 from [Homo sapiens] Length = 1678 Score = 99.4 bits (246), Expect = 2e-21 Identities = 77/208 (37%), Positives = 99/208 (47%), Gaps = 6/208 (2%) Frame = +2 Query: 119 VFGLGSLRGCSSSNNDDDEA-AVSVNQLVSTFSSDPSLIAFGALCSDHSWNIKLDTDFQE 295 VFGL +L + N E + SV+ LVSTFSSDPSLIAF LC D SWN D Sbjct: 1483 VFGLRTLGESNLIANSHRELDSDSVDHLVSTFSSDPSLIAFAQLCCDKSWNNSFD----- 1537 Query: 296 FCLQVLFECVSKDRPALLQVYLSLYTTVASMADEVTSGIPPLLNDSQFLPSLKLALAYND 475 L + L L++ VA LAYN+ Sbjct: 1538 ----------------FLILDLILWSQVA--------------------------LAYNE 1555 Query: 476 ALVKGRFMSSRGSIVQSTFLGSLNKRVQELLAYSPCLRNNIILNDYFRTGKWSEDDNIST 655 A+ GR SS G VQS FL SL KR +E+L S L+ N L +Y + W D N Sbjct: 1556 AVSTGRLASS-GGFVQSIFLASLRKRCEEVLNCSTELKIN--LRNYLTSEAWPYDKNSKL 1612 Query: 656 -----LVSWYLQWYNVPPPSLIQAGIKK 724 ++SWYL+W+NVP PS+I+A ++K Sbjct: 1613 QKDIIILSWYLKWFNVPSPSIIKAAVEK 1640 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,972,505 Number of Sequences: 27288 Number of extensions: 370752 Number of successful extensions: 1150 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1093 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1142 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB19C22.yg.ab1 (636 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g73430.1 unknown protein / 328 1e-90 >At1g73430.1 unknown protein / Length = 745 Score = 328 bits (842), Expect = 1e-90 Identities = 179/243 (73%), Positives = 191/243 (77%), Gaps = 32/243 (13%) Frame = +3 Query: 3 AVEVCSLSIQKASKLVAKRSSQMDGQLFLIKHLLILREQIAPFDIEFSVTHKELDFSHLL 182 AVEVCSLSIQKASKL+ KRS+ MDGQLFLIKHLLILREQIAPFDIEFSVTHKELDFSHLL Sbjct: 466 AVEVCSLSIQKASKLIIKRSTTMDGQLFLIKHLLILREQIAPFDIEFSVTHKELDFSHLL 525 Query: 183 EHLRRILRGQTSLFDWSRSTSLARTLSPRVLESQIDAKKELEKNLKATCEEFIMSVTKLV 362 EHLRRILRGQ SLFDWSRSTSLARTLSPRVLESQIDAKKELEK LK TCEEFIMSVTKLV Sbjct: 526 EHLRRILRGQASLFDWSRSTSLARTLSPRVLESQIDAKKELEKCLKTTCEEFIMSVTKLV 585 Query: 363 VDPMLSFVTKVTAVRVALSSGGQNQKLESAMGKSLKEHAFASPDKVAEIVQK-------- 518 VDPMLSFVTKVTA++VALSSG QN K++S M K LKE AFA+PDKV E+VQK Sbjct: 586 VDPMLSFVTKVTAIKVALSSGTQNHKVDSVMAKPLKEQAFATPDKVVELVQKVYLRNRDG 645 Query: 519 ------------------------VNAGMQDELPRVMEXMKLYLQNPSTRTILFXPIKTN 626 V A +Q EL ++ MKLYLQNPSTRTILF PIKTN Sbjct: 646 SYFLFPMQLPLQKHDIENSVHRQFVYAAIQQELLPILAKMKLYLQNPSTRTILFKPIKTN 705 Query: 627 IIE 635 I+E Sbjct: 706 IVE 708 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,555,333 Number of Sequences: 27288 Number of extensions: 284505 Number of successful extensions: 782 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 764 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB19G05.yg.ab1 (724 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g10920.1 argininosuccinate lyase (AtArgH) / ; supported b... 379 e-105 >At5g10920.1 argininosuccinate lyase (AtArgH) / ; supported by cDNA: gi_15028082_gb_AY045898.1_ Length = 517 Score = 379 bits (972), Expect = e-105 Identities = 186/234 (79%), Positives = 207/234 (87%) Frame = +3 Query: 3 HASMLAKQGLISFSDRDSILEGLDQIQARIERGEFEWRTDREDVHMNIEAALTDLIGEPA 182 HASMLA QGLI+ SD+DSIL GLD I+ +IE +FEWRTDREDVHMNIEAALTDLIGEPA Sbjct: 97 HASMLAHQGLITDSDKDSILRGLDDIERQIEANKFEWRTDREDVHMNIEAALTDLIGEPA 156 Query: 183 KKLHTARSRNDQVSTDFRLWCRDAIDMIVARIKHFQIAMVKLAKTNEGVIVPGYTHLQRA 362 KKLHTARSRNDQV+TDFRLWCRDAID I+ +I++ Q A+V+LA NE +IVPGYTHLQRA Sbjct: 157 KKLHTARSRNDQVATDFRLWCRDAIDTIIVKIRNLQRALVELALKNEALIVPGYTHLQRA 216 Query: 363 QPVLLQHHLLAYVEQLDRDAGRLLDCRVRLNFCPLGACALAGTGLPIDRFMTSDALGFTA 542 QPVLL H LL +VEQL+RDAGR +DCR RLNF PLGACALAGTGLPIDRFMT++ALGFT Sbjct: 217 QPVLLPHVLLTFVEQLERDAGRYVDCRARLNFSPLGACALAGTGLPIDRFMTANALGFTE 276 Query: 543 PMRNSMDAVSDRDFVLELLSANAIIAMHLSRLGEEWVLWASEEFGFITPSDSVS 704 PMRNS+DAVSDRDFVLE L NA +HLSRLGEEWVLWASEEFGF+TPSDSVS Sbjct: 277 PMRNSIDAVSDRDFVLEFLYTNANTGIHLSRLGEEWVLWASEEFGFMTPSDSVS 330 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,750,392 Number of Sequences: 27288 Number of extensions: 340260 Number of successful extensions: 993 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 958 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 992 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1268361380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB19G09.yg.ab1 (719 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g22570.1 expressed protein / ; supported by full-length cD... 266 1e-71 >At2g22570.1 expressed protein / ; supported by full-length cDNA: Ceres: 117955. Length = 244 Score = 266 bits (679), Expect = 1e-71 Identities = 121/205 (59%), Positives = 157/205 (76%), Gaps = 1/205 (0%) Frame = +3 Query: 108 LKKEVPL-EEESLCIPKDIKTGLVLVDIINGFCTIGAGNLAPREPNHQISEMVDESVKLS 284 LKK++P+ EEE L + +D GLV+VD++NGFCTIG+GN+AP + N QIS+MV+ES KL+ Sbjct: 11 LKKQIPVDEEEPLILNRDSSVGLVIVDVVNGFCTIGSGNMAPTKHNEQISKMVEESAKLA 70 Query: 285 RIFCENKWPVLAFLDTHQPGKLEHPYPSHCLAGSHESNLVPALEWLEKEPNVTIRRKDCY 464 R FC+ KWPVLAF+D+H P E PYP HC+ G+ ES LVPAL+WLE E T+RRKDC Sbjct: 71 REFCDRKWPVLAFIDSHHPDIPERPYPPHCIIGTEESELVPALKWLESEDCATLRRKDCI 130 Query: 465 DGYIGSIQEDGSNAFADWIKTNNIQLLLVAGICTDICVLDFVCSTLSARNRGFLAPLEEV 644 +G++GS++ DGSN F DW+K I++++V GICTDICV DFV + LSARN G L+P+E+V Sbjct: 131 NGFVGSMESDGSNVFVDWVKEKQIKVIVVVGICTDICVFDFVATALSARNHGVLSPVEDV 190 Query: 645 VVYSHGCATFDFPESDARGTKDALA 719 VVYS GCATFD P A+ K A A Sbjct: 191 VVYSRGCATFDLPLHVAKDIKGAQA 215 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,330,595 Number of Sequences: 27288 Number of extensions: 414105 Number of successful extensions: 1245 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1245 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1272263564 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB19G24.yg.ab1 (661 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g44450.1 unknown protein / 254 4e-68 >At5g44450.1 unknown protein / Length = 252 Score = 254 bits (648), Expect = 4e-68 Identities = 125/169 (73%), Positives = 136/169 (79%), Gaps = 3/169 (1%) Frame = +3 Query: 21 MWREEVG--DSQKKLDWYRNGVGYWQGVDGSVDGVLGGYAHVNEPDIKASEAFLNTLLTE 194 MWREE+G D KK WYR+GV YW+GV+ SVDGVLGGY HVN+ DI SE FL TLL E Sbjct: 1 MWREEIGEGDETKKTQWYRDGVSYWEGVEASVDGVLGGYGHVNDADIIGSEVFLKTLLQE 60 Query: 195 -LVPNGGRNQHLVALDCGSGIGRVTKNLLIRYFNEVDLLEPVSHFLEAARENLAPENLSV 371 LV N G NQHLVALDCGSGIGR+TKNLLIRYFNEVDLLEPV+ FL+AARENLA Sbjct: 61 RLVNNVGANQHLVALDCGSGIGRITKNLLIRYFNEVDLLEPVAQFLDAARENLASAG--- 117 Query: 372 SEEHKASNFYCTPLQEFTPDTQRYDVIWVQWCIGHLADDDFVSFFKRAK 518 SE HKA+NF+C PLQEFTP RYDVIWVQWCIGHL D+DFVSFF RAK Sbjct: 118 SETHKATNFFCVPLQEFTPAAGRYDVIWVQWCIGHLTDNDFVSFFNRAK 166 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,044,729 Number of Sequences: 27288 Number of extensions: 347166 Number of successful extensions: 1270 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1259 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1106605264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB19H21.yg.ab1 (747 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g53000.1 CMP-KDO synthetase, putative / similar to GB:CAB8... 336 2e-95 >At1g53000.1 CMP-KDO synthetase, putative / similar to GB:CAB89846 from [Zea mays] Length = 262 Score = 336 bits (861), Expect(2) = 2e-95 Identities = 166/219 (75%), Positives = 189/219 (85%), Gaps = 3/219 (1%) Frame = +3 Query: 42 STCAESSRPMSTKAWVLHG---GAVAAALVGAHAYFYYRRSATVFRSRVVGIIPARFASS 212 S C+ SS S K W+++G G AA +GA AY + FRSRVVGIIPAR+ASS Sbjct: 2 SVCSSSSS--SQKTWIVNGILAGTAIAAAIGARAYLGRSKK---FRSRVVGIIPARYASS 56 Query: 213 RFQGKPLVEILGKPMIQRTWERAKLATTLDRVVVATDDEKIAECCRGFGADVIMTAESCR 392 RF+GKPLV+ILGKPMIQRTWER+KLATTLD +VVATDDE+IAECCRGFGADVIMT+ESCR Sbjct: 57 RFEGKPLVQILGKPMIQRTWERSKLATTLDHIVVATDDERIAECCRGFGADVIMTSESCR 116 Query: 393 NGAERCSEALQKLDKKYDIVVNIQGDEPLIDPEIIDGIVKALQTTPDAVFSTAVTSLKPE 572 NG ERC+EAL+KL+KKYD+VVNIQGDEPLI+PEIIDG+VKALQ TPDAVFSTAVTSLKPE Sbjct: 117 NGTERCNEALEKLEKKYDVVVNIQGDEPLIEPEIIDGVVKALQVTPDAVFSTAVTSLKPE 176 Query: 573 DAFDPNRVKCGVDNRGYAIYFSRGLIPFNKSGEINTEFP 689 D DPNRVKC VDNRGYAIYFSRGLIP+NKSG++N +FP Sbjct: 177 DGLDPNRVKCVVDNRGYAIYFSRGLIPYNKSGKVNPDFP 215 Score = 31.6 bits (70), Expect(2) = 2e-95 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +2 Query: 689 PYIFILGIQSYDSEFFKIY 745 PY+ LGIQS+DS+F K+Y Sbjct: 215 PYMLHLGIQSFDSKFLKVY 233 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,196,541 Number of Sequences: 27288 Number of extensions: 442552 Number of successful extensions: 1477 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1472 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB19M08.yg.ab1 (398 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g21970.1 expressed protein / ;supported by full-length cD... 115 1e-26 >At2g21970.1 expressed protein / ;supported by full-length cDNA: Ceres:10672. Length = 202 Score = 115 bits (287), Expect = 1e-26 Identities = 53/84 (63%), Positives = 67/84 (79%) Frame = +1 Query: 22 AGTVTMEVVTGNSLFRKMDLQGIEEAAGVCLGVVVCAAAFAWFSGARNTVGGIFSVRCNT 201 A TVT E+VTGNSLF+K+D++G+ EA G L + CAA FAW + +RN VG IF+V CN+ Sbjct: 117 AVTVTEEIVTGNSLFKKLDVEGLSEAIGAGLAAMGCAAMFAWLTISRNRVGRIFTVSCNS 176 Query: 202 FIDSLIDQVVDGLFYETDVSDWSD 273 FIDSL+DQ+VDGLFY+T SDWSD Sbjct: 177 FIDSLVDQIVDGLFYDTKPSDWSD 200 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,928,023 Number of Sequences: 27288 Number of extensions: 189022 Number of successful extensions: 658 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 658 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 401071088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB19M10.yg.ab1 (713 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54310.1 expressed protein / ; supported by cDNA: gi_13605... 258 3e-71 >At1g54310.1 expressed protein / ; supported by cDNA: gi_13605620_gb_AF361636.1_AF361636 Length = 245 Score = 258 bits (659), Expect(2) = 3e-71 Identities = 128/164 (78%), Positives = 147/164 (89%), Gaps = 4/164 (2%) Frame = +2 Query: 107 IASNQSKGVAKVVLKKGKTQLFRDGSPMVYSGAVDRIIGRPPPKTGDVVLVADGTQKPIG 286 IAS++ +GVAKVVLKKGKTQLF+DGSPMVYSGAVDRIIG+PPP+TGDVV+VADGT+ PIG Sbjct: 24 IASSRPQGVAKVVLKKGKTQLFKDGSPMVYSGAVDRIIGKPPPQTGDVVIVADGTENPIG 83 Query: 287 WGLYNSCSMFCVRLMQLEEEVSGDPSCVLNVEKLLETRIDAAIRLRKSLGLPSANTNAYR 466 WGLYNS SMFCVRLMQL+ E + DPSC LN+EKLL+TRI A++LRKSL LPSANTNAYR Sbjct: 84 WGLYNSVSMFCVRLMQLQHESTRDPSCALNIEKLLQTRIAEAVQLRKSLALPSANTNAYR 143 Query: 467 LVNSEGDRLSGLIVDVFGDLAVIASSAAWVEK----TSNILRSV 586 LVNSEGDRLSGLIVDVFGD+AV+ASSAAW+EK + LRS+ Sbjct: 144 LVNSEGDRLSGLIVDVFGDIAVVASSAAWLEKYRIEVESCLRSI 187 Score = 28.5 bits (62), Expect(2) = 3e-71 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +1 Query: 574 IKKCISGLNMIKSVVWRPSTEILKE 648 ++ C+ ++ I + WRPS ++LKE Sbjct: 180 VESCLRSIDGINHINWRPSLDVLKE 204 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,947,821 Number of Sequences: 27288 Number of extensions: 443699 Number of successful extensions: 1676 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1670 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1254469668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB19O17.yg.ab1 (727 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g57290.1 translation initiation factor 3 -like protein / m... 387 e-108 >At3g57290.1 translation initiation factor 3 -like protein / mammary tumor-associated protein INT6 - Homo sapiens, EMBL:U94174; supported by cDNA: gi_14532577_gb_AY039913.1_ Length = 441 Score = 387 bits (993), Expect = e-108 Identities = 181/221 (81%), Positives = 208/221 (93%) Frame = +1 Query: 4 LFIFFNHDNGRTQIIDLFNQDKYLNAIQTNAPHLVRYLATAFIVNKKRRPQFKELIKVIQ 183 L+IFFNHDNGRTQIIDLFNQDKYLNAIQT+APHL+RYLATAFIVNK+RRPQ KE IKVIQ Sbjct: 221 LYIFFNHDNGRTQIIDLFNQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQLKEFIKVIQ 280 Query: 184 QEQHSFADPITEFLACVYVNFDFDGAQKKMKECEDVILNDPFFGKRVEESNYTVVPLKDE 363 QE +S+ DPI EFLACV+VN+DFDGAQKKMKECE+VI+NDPF GKRVE+ N++ VPL+DE Sbjct: 281 QEHYSYKDPIIEFLACVFVNYDFDGAQKKMKECEEVIVNDPFLGKRVEDGNFSTVPLRDE 340 Query: 364 FLENARLFIFEAYCRIHERIDMGVLAEKLNLNYEDAERWILNLIRTSKLDAKIDTQTGTV 543 FLENARLF+FE YC+IH+RIDMGVLAEKLNLNYE+AERWI+NLIRTSKLDAKID+++GTV Sbjct: 341 FLENARLFVFETYCKIHQRIDMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSESGTV 400 Query: 544 VMEPNHPNVYEQLIDHTKGLSGRTYKLVSQLLEHSQAQTAR 666 +MEP PNV+EQLI+HTKGLSGRTYKLV+QLLEH+QAQ R Sbjct: 401 IMEPTQPNVHEQLINHTKGLSGRTYKLVNQLLEHTQAQATR 441 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,657,889 Number of Sequences: 27288 Number of extensions: 334567 Number of successful extensions: 822 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 822 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1277231040 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB19P10.yg.ab1 (704 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g14300.1 hypothetical protein / predicted by genemark.hmm 312 1e-85 >At1g14300.1 hypothetical protein / predicted by genemark.hmm Length = 339 Score = 312 bits (800), Expect = 1e-85 Identities = 164/232 (70%), Positives = 191/232 (81%) Frame = +3 Query: 9 EMEELIGFLSAPSPQVQKVAVDIVRDLTGSEDGLQSLASYSKTVLPSLCRLLGEKKEVSE 188 E+EEL+ FLS+PSP V+K AV+IV LTGSE+GLQSL+ YS+ +LPSL +LL E KEVSE Sbjct: 4 ELEELVEFLSSPSPPVKKAAVEIVSGLTGSEEGLQSLSKYSEILLPSLSQLLNESKEVSE 63 Query: 189 AATQALVNLSQNSDLASKMIEIGIIKDTMDILYKQGCEITGLLVMLLVNLTQLDSGVESL 368 A QALVNLSQ +LA KMI++G+IK MD+LYK IT LLVMLLVNLTQLD GV SL Sbjct: 64 PAAQALVNLSQKCELAKKMIQMGLIKVAMDMLYKPESCITRLLVMLLVNLTQLDDGVSSL 123 Query: 369 LQLGDDKVQGLNVMKLVRSFCTSSNEKKDDPFGHVGSILVNISKNKDGRSLLLDSKRGLL 548 LQ+ D+K+ GL++MKLVRSFC SS E DD F HVGSILVNISK +DGR LLL+ KR LL Sbjct: 124 LQIDDEKMHGLHIMKLVRSFCRSSGETADDQFEHVGSILVNISKTEDGRKLLLEPKRRLL 183 Query: 549 KQIIRQFDSTSILRKKGVSGTIRNCCXEADHQIQXLLLISEVLWPALLLPVA 704 KQIIRQFDST+ LRKKGV+GTIRNCC EA +Q+Q +LLISE LWPALLLPVA Sbjct: 184 KQIIRQFDSTNQLRKKGVAGTIRNCCFEAKNQLQNILLISEFLWPALLLPVA 235 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,614,528 Number of Sequences: 27288 Number of extensions: 341425 Number of successful extensions: 1031 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 993 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1030 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1227778824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB1d02.yg.ab1 (629 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g10090.1 expressed protein / ; supported by full-length c... 208 2e-54 >At4g10090.1 expressed protein / ; supported by full-length cDNA: Ceres: 41992. Length = 262 Score = 208 bits (530), Expect = 2e-54 Identities = 106/206 (51%), Positives = 149/206 (71%), Gaps = 6/206 (2%) Frame = +3 Query: 3 GRVVLVEDCVETSGAFVLHHLIKRFLSPNHSSSDSVVIFVAFAQPFSHYDRILRKMGCNF 182 G+V+L+EDCVETSG+FVLH L+KR LS N S + +IF+AFA+PFSHYDRILRK+GCN Sbjct: 26 GKVILIEDCVETSGSFVLHQLMKRVLSSNSSDA---LIFLAFARPFSHYDRILRKLGCNL 82 Query: 183 AVQRENKRLIFFDMLMLECPDDDGVEGGLIA---LYGNIHKAVE--ANSINKNITIIIDD 347 A + N RL+FFDMLM++C D D +E + A L+ I + V + + NIT+++DD Sbjct: 83 ATHKSNNRLVFFDMLMVKCSDGDQMEDNVSAVAKLFREIQETVRKLQSVTSGNITVMVDD 142 Query: 348 ISLLEVAANGSTKD-VLNFMHYCNTLTTQFGCTIITVIHEDIYSNGDEFTLPIQMENLAD 524 +SLLE+A GS D VL+F+HYC+TL+++ C+++ + HEDIY++ + +QM LAD Sbjct: 143 MSLLEIATTGSNSDHVLDFLHYCHTLSSESNCSLVILNHEDIYASMERPAFLLQMVCLAD 202 Query: 525 ITLKAEPLVTD*AEYIHG*LTVLNKG 602 + +KAEPL + A +HG LTVLNKG Sbjct: 203 VVIKAEPLASGLANDVHGQLTVLNKG 228 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,764,638 Number of Sequences: 27288 Number of extensions: 297234 Number of successful extensions: 763 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 759 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1017362904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB1f07.yg.ab1 (763 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g40430.1 expressed protein / ;supported by full-length cD... 245 2e-65 >At2g40430.1 expressed protein / ;supported by full-length cDNA: Ceres:35274. Length = 442 Score = 245 bits (626), Expect = 2e-65 Identities = 125/232 (53%), Positives = 164/232 (69%), Gaps = 4/232 (1%) Frame = +1 Query: 4 SRKGKKAWRANISTEDIEDFYEKSSKDALSGGSLTEVPSDSLFFVDKSRDLSVKRKIDKH 183 SRKGKKAWRANIS+EDIEDF+EK+++DALSGG+L+ PS+ LF VDKS DL VKRKI+KH Sbjct: 8 SRKGKKAWRANISSEDIEDFFEKTTRDALSGGNLSAAPSEDLFHVDKSHDLPVKRKIEKH 67 Query: 184 REKILRVDSILQKNSFVQPVPSSNQKNSFKKRKMI--QRSDDSSQKDGTTDTGIVDIW-- 351 RE++LRVDSIL+KN FVQ VPSS K K+ ++ ++ QK D+ + D+W Sbjct: 68 RERVLRVDSILKKNPFVQLVPSSKPKLKKSKKTIVIEDKAPKQVQKSVGDDSVMADLWGD 127 Query: 352 DDKGERTFKARKVSNKIIVIPAVEVEPPGCSYNPSSESHQDSLAHAVADEMQKIYTKELR 531 D KGE RK+ +I AVE+E PGCSYNP++ESHQD LA AVA EMQK+Y EL Sbjct: 128 DSKGEHESNPRKIFKNPSIISAVEIEHPGCSYNPTTESHQDMLAEAVAQEMQKVYKTELG 187 Query: 532 PTPVPLTVPGEAIDEEDMYFLDADKESDGDDDDDDDEQNVDEDLEKRPFKTK 687 P PVPLT+ G+ + E++ YFLD D S+G+D+ +NV+ ++ + K K Sbjct: 188 PAPVPLTIEGDTLSEDERYFLDVDNFSEGEDN-----ENVENEVSEAGIKLK 234 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.314 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,226,735 Number of Sequences: 27288 Number of extensions: 383529 Number of successful extensions: 7025 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4794 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1383666960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB20D11.yg.ab1 (773 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g37360.1 putative protein / ; supported by cDNA: gi_16604... 240 7e-64 >At5g37360.1 putative protein / ; supported by cDNA: gi_16604481 Length = 309 Score = 240 bits (612), Expect = 7e-64 Identities = 134/242 (55%), Positives = 164/242 (67%), Gaps = 2/242 (0%) Frame = +2 Query: 53 ASSLLLPRPPLPLPRSSPFIIRNPHQIPSNFNPRKHFLNFKPFLSVATNALTES-SDSPK 229 +SS+ L +P L S+ F + S+ P K + ALTES S P Sbjct: 6 SSSISLLQPLHSLSSSTLFFSQPSFHFSSSLKPNKSKRHNLSKSLTLRFALTESDSTKPL 65 Query: 230 SLDPPDPQSLLQELADSFNLPPDYLSQLPRDLRLDLNDAAFDLSNGPVIEQCGQELGMTL 409 ++ P +SLL +L+ F+LP DY QLP DLRLDLNDAAFDLSNGPVI++CGQELG TL Sbjct: 66 EIEEPSSKSLLLQLSKCFDLPSDYFQQLPNDLRLDLNDAAFDLSNGPVIDECGQELGETL 125 Query: 410 LNISRAWESADLSTSSALVNNLPLLVNSLTSNNKSALGKRLVSAGRRFESMGQYGQGELQ 589 LN+SRAWE AD STS +LV LP L LT +SA GKRL+SAG+RF+ MGQY +GELQ Sbjct: 126 LNLSRAWEQADTSTSRSLVEKLPELEILLTDGARSAFGKRLISAGKRFQGMGQYAKGELQ 185 Query: 590 RISKAMISAGNLLSLTPVSES-TEESKEETRMFKFGELQVELTREKAYIGAAIGFVYGII 766 +I+KAMI+ G +LS S S + ESK TRMFKFGELQV +T EKAY GAAI F+YGI+ Sbjct: 186 KIAKAMITTGGVLSAKTSSVSVSNESKSGTRMFKFGELQVAVTPEKAYTGAAIAFIYGIL 245 Query: 767 SW 772 SW Sbjct: 246 SW 247 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,955,164 Number of Sequences: 27288 Number of extensions: 417765 Number of successful extensions: 1812 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1805 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB20D22.yg.ab1 (467 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20495.1 similar to Serine/threonine-protein kinase / temp... 92 1e-19 >At2g20495.1 similar to Serine/threonine-protein kinase / temporary automated functional assignment Length = 294 Score = 92.4 bits (228), Expect = 1e-19 Identities = 39/62 (62%), Positives = 55/62 (87%) Frame = +3 Query: 3 RKEVMSLLNRKKYKEMMLSLVEKKRLRFSPLDIRFHLRDLLGSGHLKTLHTPGGIVIRVV 182 R E++SL+ RK++KEM L+ +EKKRLRFSPLD+RFH+RDL+GSGHLKT+ T G+++R++ Sbjct: 233 RNELLSLIKRKRHKEMFLAELEKKRLRFSPLDVRFHVRDLIGSGHLKTVQTTSGLIVRIL 292 Query: 183 KD 188 KD Sbjct: 293 KD 294 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,897,527 Number of Sequences: 27288 Number of extensions: 205826 Number of successful extensions: 453 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 578136832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB20E06.yg.ab1 (734 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g43250.1 hypothetical protein / predicted by genscan and g... 200 7e-52 >At2g43250.1 hypothetical protein / predicted by genscan and genefinder Length = 625 Score = 200 bits (508), Expect = 7e-52 Identities = 115/252 (45%), Positives = 177/252 (69%), Gaps = 10/252 (3%) Frame = +2 Query: 2 AVVAQVNEIDFEDVQL----LSDGDNEHPIPTSSLEVLKRCFLHKIGKDTYENVAGNLVL 169 AVVAQV++ F + Q+ L +G ++ IPTS+ +VL +CF+ K+ K+ YE++AG +VL Sbjct: 83 AVVAQVDKSAFGEAQVEESVLGNGISDS-IPTSAFKVLIQCFVDKVNKEKYESIAGIVVL 141 Query: 170 KEIFGVGFNGHFSTAKRIAEEVGSSFLLLESPFVQLERDNNNSSSEVESGNNFQGFGLQP 349 +EIFG FNGH AKR+A EVGSSF++LESPFV + ++ ++G Q Sbjct: 142 REIFGTSFNGHLLAAKRVAGEVGSSFMVLESPFVDI-------AAVEDAGGKMQSLA--- 191 Query: 350 SNLMPQKMGSIIPSSSSKYLISDDHIRSQTLKLLSSHLLQLNPNQNPSP-----INIQPK 514 ++L+PQ GS I SSS ++LI++D ++++ LKL+S + Q+N +PS I+ + + Sbjct: 192 NSLVPQLNGSAIFSSSRRFLITND-VQARMLKLISLQMNQVNKKLSPSSSVASGISSEIQ 250 Query: 515 D-DYEAPQYARSVYPLLQDLHNIFLEIPSIGRSLAYAQKMLHDVSKGEGIDTKLLSEVYT 691 +E P +A+++YPLL DLH+IF ++PSIG++LA A++ML DV++GE +DT+++SEVY Sbjct: 251 SCSHEVPPFAQTIYPLLVDLHDIFSDLPSIGKALANARRMLSDVNRGESMDTEVISEVYL 310 Query: 692 FRIAVEGLRIAL 727 F+IAVEGLRIAL Sbjct: 311 FQIAVEGLRIAL 322 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,984,935 Number of Sequences: 27288 Number of extensions: 361568 Number of successful extensions: 1172 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1165 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB20F19.yg.ab1 (672 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g55090.1 hypothetical protein / similar to putative glutam... 421 e-118 >At1g55090.1 hypothetical protein / similar to putative glutamine dependent NAD+ synthetase GB:O74940 GI:8928216 from [Schizosaccharomyces pombe] Length = 725 Score = 421 bits (1083), Expect = e-118 Identities = 201/224 (89%), Positives = 217/224 (96%) Frame = +1 Query: 1 GSNIENLGLQNIQARIRMVLAFMMASLLPWVHSKPGFYLVLGSSNVDEGLRGYLTKYDCS 180 GSN ENLGLQNIQAR+RMVLAFM+ASLLPWVHSKPGFYLVLGSSNVDEGLRGYLTKYDCS Sbjct: 473 GSNAENLGLQNIQARMRMVLAFMLASLLPWVHSKPGFYLVLGSSNVDEGLRGYLTKYDCS 532 Query: 181 SADINPIGSISKQDLRIFLRWAATHLGFSSLAEIEAAPPTAELEPIRSNYSQLDEVDMGM 360 SADINPIGSISK DLR+FL+WAAT+LG+ SLAEIEAAPPTAELEPIRS+YSQLDEVDMGM Sbjct: 533 SADINPIGSISKMDLRLFLKWAATNLGYPSLAEIEAAPPTAELEPIRSDYSQLDEVDMGM 592 Query: 361 TYEELSVYGRLRKIFRCGPVSMFKNLCFGWGSKLSPSEVAEKVKHFFKYYSINRHKMTVL 540 TYEELSVYGR+RKIFRCGPVSMFKNLC+ WG+KLSP+EVAEKVK+FFKYYSINRHKMTVL Sbjct: 593 TYEELSVYGRMRKIFRCGPVSMFKNLCYKWGTKLSPAEVAEKVKYFFKYYSINRHKMTVL 652 Query: 541 TPSYHAESYSPEDNRFDLRQFLYNSRWPYQFRKIDELVKELSVD 672 TPSYHAESYSPEDNRFDLRQFLYNS+WPYQF+KIDE+V L+ D Sbjct: 653 TPSYHAESYSPEDNRFDLRQFLYNSKWPYQFKKIDEIVDSLNGD 696 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,550,994 Number of Sequences: 27288 Number of extensions: 354147 Number of successful extensions: 864 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 863 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1129912396 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB20I23.yg.ab1 (746 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56160.1 putative protein / 211 3e-55 At2g26900.1 putative Na+ dependent ileal bile acid transporter ... 60 2e-09 >At3g56160.1 putative protein / Length = 341 Score = 211 bits (538), Expect = 3e-55 Identities = 103/145 (71%), Positives = 121/145 (83%) Frame = +1 Query: 25 KPLLNFVGSNFLPLALISGVTLGLINPSLGCLAHKYHVAKFSTCGIFLISGLTLRSEEVG 204 K LL+F NFLPLAL+SGV LG NP+LGCLA KY K STCGIF+ISGLTLR+E +G Sbjct: 72 KELLSFASDNFLPLALVSGVGLGFANPTLGCLADKYSFTKISTCGIFIISGLTLRTEAIG 131 Query: 205 AAVAAWPVGLYGLASILLLTPLFSKIILLIHLQPQEFVTGLALFCCMPTTLSSGVALTRL 384 AAV WP+GL+GL SILLLTP FS++I+L+ LQP+E VTGL +FCCMPTTLSSGVALT L Sbjct: 132 AAVKGWPLGLFGLISILLLTPSFSRLIMLVQLQPRELVTGLGIFCCMPTTLSSGVALTHL 191 Query: 385 AGGNSALALAMTVLSSLFGILIVPF 459 AGGN+ALALA+TV S+L GIL VP+ Sbjct: 192 AGGNAALALAVTVASNLLGILTVPW 216 >At2g26900.1 putative Na+ dependent ileal bile acid transporter / ; supported by cDNA: gi_20269900 Length = 409 Score = 59.7 bits (143), Expect = 2e-09 Identities = 60/213 (28%), Positives = 94/213 (43%), Gaps = 4/213 (1%) Frame = +1 Query: 49 SNFLPLALISGVTLGLINPSLGCLAHKYHVAKFSTCGI---FLISGLTLRSEEVGAAVA- 216 + PL +I G +G+ PSL T G+ L GLTL E+ + Sbjct: 102 TTLFPLWVILGTLVGIFKPSLVTWLE----TDLFTLGLGFLMLSMGLTLTFEDFRRCLRN 157 Query: 217 AWPVGLYGLASILLLTPLFSKIILLIHLQPQEFVTGLALFCCMPTTLSSGVALTRLAGGN 396 W VG+ G + ++ P+ +I + TGL L C P +S VA T ++ GN Sbjct: 158 PWTVGV-GFLAQYMIKPILGFLIAMTLKLSAPLATGLILVSCCPGGQASNVA-TYISKGN 215 Query: 397 SALALAMTVLSSLFGILIVPFSISKLIAGGVGASLPADQLFRSLILTLLTPLIFGKVLRE 576 AL++ MT S++ I++ P ++KL+AG + + A L S +L P I G + E Sbjct: 216 VALSVLMTTCSTIGAIIMTPL-LTKLLAGQL-VPVDAAGLALSTFQVVLVPTIIGVLANE 273 Query: 577 SFKGVADFCDSNRKLLSCVNAILLSLVPWIQVS 675 F + L+ + LL P QV+ Sbjct: 274 FFPKFTSKIITVTPLIGVILTTLLCASPIGQVA 306 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,608,411 Number of Sequences: 27288 Number of extensions: 336844 Number of successful extensions: 839 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 839 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB20J07.yg.ab1 (642 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g02160.1 expressed protein / ; supported by cDNA: gi_1660... 184 3e-47 >At2g02160.1 expressed protein / ; supported by cDNA: gi_16604650_gb_AY059770.1_ Length = 669 Score = 184 bits (468), Expect = 3e-47 Identities = 91/152 (59%), Positives = 107/152 (69%), Gaps = 3/152 (1%) Frame = -2 Query: 602 EEEF*KRNTDCVYFLASPLTCKKGSECEYRHSDIARVNPRDCWYWLNGNCLNPKCAFRHP 423 EE+ K NTDCVYFLASPLTCKKG ECEYRHS+ AR+NPRDC+YWLNGNCLNPKC FRHP Sbjct: 25 EEDALKWNTDCVYFLASPLTCKKGPECEYRHSEYARMNPRDCYYWLNGNCLNPKCGFRHP 84 Query: 422 PLDGLLGAEVPPPVGPTLPQAQTPSYP-MSKQGVPCTFFQKGFCLKGHLCPFLHGPPNIS 246 PL+GLLG + P P T +P ++KQ VPC FFQKG C+KG +C FLH PN + Sbjct: 85 PLEGLLGNQGGAPAVSVQPIHATAQHPSVAKQPVPCLFFQKGMCMKGDMCSFLH-TPNPA 143 Query: 245 NNKTMPPVPSNNLTNP--SKIPSEKPIQEQKL 156 K PV + T+P SK P E +E+KL Sbjct: 144 AYKKQHPVEAKPATDPQCSKKPIENNTEEKKL 175 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,066,152 Number of Sequences: 27288 Number of extensions: 516889 Number of successful extensions: 5300 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4554 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1053059848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB20L09.yg.ab1 (755 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01290.1 molybdopterin biosynthesis CNX3 protein, putative ... 193 7e-50 >At1g01290.1 molybdopterin biosynthesis CNX3 protein, putative / similar to molybdopterin biosynthesis CNX3 protein GB:Q39056 from [Arabidopsis thaliana] Length = 270 Score = 193 bits (491), Expect = 7e-50 Identities = 112/226 (49%), Positives = 144/226 (63%), Gaps = 28/226 (12%) Frame = +1 Query: 160 MYLRRASLMLHKSRRPFSSSSSSH--DIASTIDELNKEMEFVFGEAPPTSLTG------- 312 ++LRR ++ +R FSS I+ELN+EM+ +FG+ P G Sbjct: 9 VFLRRFPAVVSPIKRAFSSRIDDEFDPQIMNINELNQEMQSIFGQEPSPDGPGTMDFSEL 68 Query: 313 -SSESQPI------------------SQDSEITPVEKIKMEMENESKLSHISVKGEAQMV 435 SS+ +P+ S ++ +E+ + SKL+H+ + GEAQMV Sbjct: 69 KSSKIEPLRSKNIDFRQQIEYHKSTHSSKNDSQAIEQYAKVASDMSKLTHVGIAGEAQMV 128 Query: 436 DVSDKDISTRVAIASCKVILGKKVYDLVSANQVAKGDVLSVAKIAGITGAKQTSNLIPLC 615 DVS KD S R A+A CKVILGK+V+DLV ANQ+ KGDVL VAKIAGI GAKQTS+LIPLC Sbjct: 129 DVSSKDNSKRTALACCKVILGKRVFDLVLANQMGKGDVLGVAKIAGINGAKQTSSLIPLC 188 Query: 616 HNINLTHVGVDLRLNPCDYCVEIRGEAASTGKTGVEMEALTAVTLA 753 HNI LTHV VDLRLNP D+ V+I GEA+ TGKTGVEMEA+TAV++A Sbjct: 189 HNIALTHVRVDLRLNPEDFSVDIEGEASCTGKTGVEMEAMTAVSVA 234 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,186,320 Number of Sequences: 27288 Number of extensions: 388382 Number of successful extensions: 1115 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1073 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1112 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB20N16.yg.ab1 (757 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25545.1 Expressed protein / ; supported by cDNA: gi_16604... 247 6e-66 >At3g25545.1 Expressed protein / ; supported by cDNA: gi_16604419_gb_AY058108.1_ Length = 267 Score = 247 bits (630), Expect = 6e-66 Identities = 127/234 (54%), Positives = 168/234 (71%), Gaps = 7/234 (2%) Frame = +1 Query: 76 MEDVLTEQPPPSRFFLEDLNNFTPPSPPLPSPFLFLSSPNSKTTLQPSLLIIALSPPSLS 255 MEDVLTE PPPSRFF EDLNNF P LPSPF+ S+P + L+PSLLIIA+S PSL Sbjct: 1 MEDVLTENPPPSRFFQEDLNNFVQPPESLPSPFIIFSNPKPELPLRPSLLIIAISSPSLY 60 Query: 256 LLHHLSSKTLIGTLILPEISPSGNTITPSPKDKSCNLYAINDS-----IILANFQYSVPS 420 + H L SKTL+G+LI+PE+ SGNT+ PS +DKSCN+Y+++ + +L + Q V Sbjct: 61 IFHSLPSKTLLGSLIMPEVPFSGNTMEPSLEDKSCNIYSLSSADDKNLTLLVSVQLPVSP 120 Query: 421 ERTHAIAKTLIGEHILPKRVLILDSIQRRNFRGRISTDDTFAMKLETTAERKEAPL--LK 594 ER++ +++ LI + I+P+RV+ILDSIQ RNFRGR+S D+T A KLET+AE+K L Sbjct: 121 ERSNLVSRLLIAKDIIPERVIILDSIQSRNFRGRLSPDETLAAKLETSAEKKATTHTGLV 180 Query: 595 SLDYLPSRSVVEGLGAALLGRCQMKGIKGILCVTWPEVGGSVTSMVKSLLLKDV 756 +LDY PS SV++GL A+LL RCQ+K I+G L ++WPE G SV +LL K V Sbjct: 181 NLDYFPSGSVIDGLSASLLSRCQLKNIRGTLVISWPEFGPSVIRFAGALLKKIV 234 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,251,555 Number of Sequences: 27288 Number of extensions: 484140 Number of successful extensions: 2754 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2519 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1365927640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB21A17.yg.ab1 (350 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g22330.1 putative protein / ; supported by cDNA: gi_14488... 115 3e-27 >At4g22330.1 putative protein / ; supported by cDNA: gi_14488265_dbj_AB063253.1_AB063253 Length = 255 Score = 115 bits (289), Expect = 3e-27 Identities = 51/61 (83%), Positives = 55/61 (89%) Frame = +1 Query: 4 ISRWPVNPQGHALWHVFMGFNSYFANTFLMFCRAQQREWNPKVVWFLGVLPYVKIDKQKR 183 IS+WPVNPQGHALWHVFM FNSY ANTFLMFCRAQQR WNPKV +FLGVLPYVKI+K K Sbjct: 195 ISQWPVNPQGHALWHVFMSFNSYCANTFLMFCRAQQRGWNPKVKYFLGVLPYVKIEKPKT 254 Query: 184 E 186 + Sbjct: 255 Q 255 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,632,661 Number of Sequences: 27288 Number of extensions: 196208 Number of successful extensions: 515 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 515 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 216146400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB21C02.yg.ab1 (494 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27050.1 expressed protein / ; supported by cDNA: gi_13937... 136 5e-33 >At3g27050.1 expressed protein / ; supported by cDNA: gi_13937132_gb_AF372920.1_AF372920 Length = 182 Score = 136 bits (343), Expect = 5e-33 Identities = 63/114 (55%), Positives = 86/114 (75%) Frame = +3 Query: 3 EILKEMGVDPAYGLACLGKINMDYENDRDLMVRFYAFVAKEEMACEEAELGPDEYSERLQ 182 EI EMG+DP +G+ CLGK+N YEND++LM+ FY F+AKEEMACEEAELG D + ++++ Sbjct: 56 EIFLEMGIDPGFGIGCLGKLNSAYENDKELMIGFYKFLAKEEMACEEAELGQDGFEQKMK 115 Query: 183 MQQTLHSHQLEMLKHMRNYGVDHQSAILEKLRQKMEKEEFENEAFVFSVDEMNE 344 Q L QLEMLK+MR + +D QSAIL+KL++++E FE EA + S +EM E Sbjct: 116 ALQQLQEQQLEMLKYMRKFSLDDQSAILQKLQKQLENAGFEPEASLLSGEEMEE 169 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,461,927 Number of Sequences: 27288 Number of extensions: 250434 Number of successful extensions: 810 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 810 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 648439200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB21C22.yg.ab1 (329 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61570.1 expressed protein / similar to small zinc finger-... 85 6e-18 At5g50810.1 small zinc finger-like protein / ;supported by f... 48 1e-06 >At1g61570.1 expressed protein / similar to small zinc finger-like protein GI:5107149 from [Oryza sativa]; supported by full-length cDNA: Ceres: 21075. Length = 87 Score = 85.1 bits (209), Expect = 6e-18 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +1 Query: 1 EFLETVRGKCFDKCITKPGSSLSGGESSCISRCVDRYTEATGIISRALFNSQ 156 E +ET+R KCFDKC+TKPGSSL G ESSCISRCV+RY EAT IISR+LF + Sbjct: 36 ELIETLRTKCFDKCVTKPGSSLGGSESSCISRCVERYMEATAIISRSLFTQR 87 >At5g50810.1 small zinc finger-like protein / ;supported by full-length cDNA: Ceres:33833. Length = 77 Score = 47.8 bits (112), Expect = 1e-06 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = +1 Query: 1 EFLETVRGKCFDKCITK-PGSSLSGGESSCISRCVDRYTEATGIISRALFNSQ 156 E + + C+DKCIT PGS S ESSC++ C RY + + II + FNSQ Sbjct: 26 EMVSKMTSVCWDKCITSAPGSKFSSSESSCLTHCAQRYMDMSMIIMKR-FNSQ 77 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,150,122 Number of Sequences: 27288 Number of extensions: 128981 Number of successful extensions: 329 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 328 length of database: 11,516,596 effective HSP length: 85 effective length of database: 9,197,116 effective search space used: 220730784 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB21G12.yg.ab1 (754 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62010.1 putative protein / paladin - Mus musculus, EMBL:M... 354 2e-98 >At3g62010.1 putative protein / paladin - Mus musculus, EMBL:MMPAL Length = 1232 Score = 354 bits (909), Expect = 2e-98 Identities = 179/267 (67%), Positives = 210/267 (78%), Gaps = 16/267 (5%) Frame = +1 Query: 1 KGSILKMYFFPGQRTSSHIQIHGAPHVFKVDGYPVYCMATPTISGAKEMLTYLGP----- 165 KGSILKMYFFPGQRTSS +QI+GAPHV+KVD YPVY MATPTISGAK+ML YLG Sbjct: 879 KGSILKMYFFPGQRTSSRLQINGAPHVYKVDRYPVYSMATPTISGAKKMLAYLGTKLKEE 938 Query: 166 -----QKVMLTDLREEAVVYINGTPFVLRELNKPVDTLKHVGITGSVVEHMEARLKEDII 330 +++++TDLREEAVVYINGTPFVLREL+KPVDTLKHVGITG+VVE +E RLKEDI+ Sbjct: 939 GGGSTERIVVTDLREEAVVYINGTPFVLRELSKPVDTLKHVGITGAVVESLETRLKEDIL 998 Query: 331 SEIKKCGGRMLLHREEYNPSLNQANVVGYWENIFVENVKTPTEVYSGLGDDGYDIVYTRI 510 +E+++ GGRMLLHREEY+P+ NQ+ V+GYWENI ENVKTP EVY+ L D+ Y+I Y RI Sbjct: 999 AEVRETGGRMLLHREEYSPASNQSRVIGYWENIQPENVKTPAEVYAALKDENYNISYRRI 1058 Query: 511 PLTREREALASDVDAIQYCMDNCAGCYLFVSHTGFGGVAYAMAIICLRLQSEGKLSSLPL 690 PLTRE++ALASDVDAIQYC D+ AG YLFVSHTGFGGV+YAMAI CL LQ ++ P Sbjct: 1059 PLTREKDALASDVDAIQYCKDDSAGSYLFVSHTGFGGVSYAMAITCLLLQPGQNFTATPT 1118 Query: 691 TKSGNQDLLSS------NEAREKGDYR 753 T S + S EA GDYR Sbjct: 1119 TNSSTLEEDDSPSGACDEEALSMGDYR 1145 Score = 129 bits (323), Expect = 2e-30 Identities = 79/223 (35%), Positives = 122/223 (54%), Gaps = 8/223 (3%) Frame = +1 Query: 7 SILKMYFFPG-QRTSSHIQIHGAPHVFKVDGYPVYCMATPTISGAKEMLTYLGPQK---- 171 ++LK PG Q + ++ GAP+ +V G+PVY +A PTI G + ++ +G + Sbjct: 445 TVLKSDHSPGCQILNLPERVEGAPNFREVPGFPVYGVANPTIDGIRSVIERVGSSRGGRP 504 Query: 172 VMLTDLREEAVVYINGTPFVLRELNKPV-DTLKHVGITGSVVEHMEARLKEDIISEIKKC 348 V ++REE V+YING PFVLRE+ +P + L++ GI VE MEARLKEDI+ E K+ Sbjct: 505 VFWHNMREEPVIYINGKPFVLREVERPYKNMLEYTGIDRDRVEGMEARLKEDILREAKRY 564 Query: 349 GGRMLLHREEYNPSLNQANVVGYWENIFVENVKTPTEVYSGLGDDGYDIVYTRIPLTRER 528 G +++ E + WEN+ ++V+TP EVY L DG+ I Y R+P+T + Sbjct: 565 DGAIMVIHET-----KDGQIFDLWENVDADSVQTPLEVYKCLEADGFPIKYARVPITDGK 619 Query: 529 EALASDVDAIQYCMDNCA--GCYLFVSHTGFGGVAYAMAIICL 651 +SD D + + + + ++F G G I CL Sbjct: 620 APKSSDFDTLTSNIASASKDTAFVFNCQMGRGRTTTGTVIACL 662 Score = 127 bits (320), Expect = 5e-30 Identities = 77/193 (39%), Positives = 108/193 (55%), Gaps = 7/193 (3%) Frame = +1 Query: 1 KGSILKMYFFPG-QRTSSHIQIHGAPHVFKVDGYPVYCMATPTISGAKEMLTYLGPQK-- 171 K +ILK FPG Q QI GAP+ + D V+ +A PT G + +L ++G K Sbjct: 21 KKTILKSDHFPGCQNKRMTPQIEGAPNYRQADSLRVHGVAIPTAVGIRNVLRHIGAHKDG 80 Query: 172 ----VMLTDLREEAVVYINGTPFVLRELNKPVDTLKHVGITGSVVEHMEARLKEDIISEI 339 V+ LREE VVYING PFVLR++ KP L++ GI VE MEARLKEDI+ E Sbjct: 81 KQVKVLWISLREEPVVYINGRPFVLRDVEKPFTNLEYTGINRVRVEQMEARLKEDILMEA 140 Query: 340 KKCGGRMLLHREEYNPSLNQANVVGYWENIFVENVKTPTEVYSGLGDDGYDIVYTRIPLT 519 + G ++L+ E L +V WE + +++KT EVY L +GY + Y R+P+T Sbjct: 141 SRYGNKILVTDE-----LPDGQMVDQWEPVSTDSLKTLLEVYEELQAEGYLVDYERVPIT 195 Query: 520 REREALASDVDAI 558 E+ +D D + Sbjct: 196 DEKSPKETDFDLL 208 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,563,967 Number of Sequences: 27288 Number of extensions: 404390 Number of successful extensions: 970 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 923 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 965 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1357057980 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB22B20.yg.ab1 (663 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g54360.1 RING finger - like protein / DNA-binding Mel-18 p... 298 2e-81 >At3g54360.1 RING finger - like protein / DNA-binding Mel-18 protein, Homo sapiens, PIR:JN0717supported by full-length cDNA: Ceres:20931. Length = 405 Score = 298 bits (763), Expect = 2e-81 Identities = 142/214 (66%), Positives = 170/214 (79%) Frame = +2 Query: 5 QGCPMSKVKQDSEESKSNVISPKCPFGYDSQTFKIGPFSCLICQALLFECSRCVPCTHVF 184 +GCP + + + + S + KCPFGYDSQTFK+GPFSC++CQALL+E SRCVPCTHVF Sbjct: 69 KGCPEQEGNLNKDSTDSATVPAKCPFGYDSQTFKLGPFSCMLCQALLYESSRCVPCTHVF 128 Query: 185 CKACISKFNDCPLCGADIEKIEADANLQSVVDRFIDGHARIKRSPVDTDEKEKEKEIIGE 364 CK C+++F DCPLCGADIE IE D NLQ +VD+FI+GHARIKRS V+ EKE E+ + Sbjct: 129 CKVCLTRFKDCPLCGADIESIEVDENLQKMVDQFIEGHARIKRSVVNGTEKE---EVEND 185 Query: 365 KKTVIYEDVSLERGAFLVQHAMRAFRANNVESAKSRLSLCAQDIREQLEVAGNTSELCSQ 544 K VIY DVS+ERG+FLVQ AMRAF A N ESAKSRL++C +DIR+QL GNT ELCSQ Sbjct: 186 NKKVIYADVSMERGSFLVQQAMRAFSAQNYESAKSRLAMCTEDIRDQLGREGNTPELCSQ 245 Query: 545 LGAVLGMLGDCCRAMGDGNSAVGYFDESVNFLSK 646 LGAVLGMLGDC RAMGD +SAV +F+ESV FL K Sbjct: 246 LGAVLGMLGDCSRAMGDSSSAVKHFEESVEFLMK 279 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,468,197 Number of Sequences: 27288 Number of extensions: 323436 Number of successful extensions: 1345 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1238 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1336 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1103221552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB22K20.yg.ab1 (644 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g21760.1 F-box protein family / Contains PF|00646 F-box do... 293 7e-80 >At1g21760.1 F-box protein family / Contains PF|00646 F-box domain. ESTs gb|Z37267, gb|R90412, gb|Z37268 and gb|T88189 come from this gene;supported by full-length cDNA: Ceres:11543. Length = 328 Score = 293 bits (749), Expect = 7e-80 Identities = 133/179 (74%), Positives = 153/179 (85%) Frame = +3 Query: 108 MASDFAKNIVAELESASQLRAAGFFITRRPWLDLYGVNVRPVAPFGSTCNKPVVDLSLIH 287 M SD A I +ELESA +LR +FIT+RPWLDLYGV+VRPV PFGST KP D +LIH Sbjct: 1 MTSD-ALTIPSELESALRLRTVQYFITKRPWLDLYGVHVRPVPPFGSTSRKPHFDPALIH 59 Query: 288 RSLPDELLFEIFARMTPYNLGKAACVCRKWRNTVRNPVFWRNACLKAWQISGVVENYKLM 467 R LPDELLFE+FARM PY+LG+A+CVCRKWR TVRNP+FWRNACLKAWQ +GV+ENYK++ Sbjct: 60 RCLPDELLFEVFARMMPYDLGRASCVCRKWRYTVRNPMFWRNACLKAWQTAGVIENYKIL 119 Query: 468 QCNYDSSWRKMWLSRPRVRMDGIYVSRNTYIRAGVAEWKVTNPVHVGCYYRYLRFYPSG 644 Q YD SWRKMWL R RVR DG+YVSRNTYIRAG+AEWK+TNPVH+ CYYRY+RFYPSG Sbjct: 120 QSKYDGSWRKMWLLRSRVRTDGLYVSRNTYIRAGIAEWKITNPVHIVCYYRYIRFYPSG 178 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,934,473 Number of Sequences: 27288 Number of extensions: 333173 Number of successful extensions: 1283 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1283 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1061984084 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB22L24.yg.ab1 (680 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g42320.1 unknown protein / 350 4e-97 >At5g42320.1 unknown protein / Length = 461 Score = 350 bits (898), Expect = 4e-97 Identities = 158/226 (69%), Positives = 184/226 (80%) Frame = +2 Query: 2 DVCERRNGRGVDLNRNWSVDWGKKEKDFDPYEENPGIGPFSEPEAQLMRKLSTSFEPHIW 181 D+CERRNGRGVDLNRNW VDWGKKEKD+DP EENPG PFSEPE Q+MRKL+ SF+PHIW Sbjct: 198 DLCERRNGRGVDLNRNWGVDWGKKEKDYDPSEENPGTAPFSEPETQIMRKLAISFDPHIW 257 Query: 182 VNVHSGMEALFMPYDHKNTTPSGVELQKMRLMLETLNHLHCGDRCVVGSGGGSVGYLAHG 361 +NVHSGMEALFMPYDHKN TP G+ QKMR +LE LN HC DRC++GSGGGSVGYLAHG Sbjct: 258 INVHSGMEALFMPYDHKNITPEGLPSQKMRTLLEKLNKFHCHDRCMIGSGGGSVGYLAHG 317 Query: 362 TTTDYMFDVAKVPMAFTFEIYGDEKASSRDCFKMFNPVDHPTFNRVLNEWSATFFTMFNM 541 T TDY++DV K PMAFTFEIYGD + +SRDCFKMFNPVD P F RVLN+WSA FFT+F + Sbjct: 318 TATDYIYDVVKAPMAFTFEIYGDNQTASRDCFKMFNPVDLPNFKRVLNDWSAAFFTIFQL 377 Query: 542 GAHQMXDPQESTPFNMDHLISIDDYLNGYLIERKNRYGEKSEFLDL 679 G + +T D +SID+YL+GYL+ERKNRYG+ E +D+ Sbjct: 378 GPLHL---DGNTSKAADKWVSIDEYLDGYLVERKNRYGKNMEVIDV 420 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,974,629 Number of Sequences: 27288 Number of extensions: 401944 Number of successful extensions: 1121 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1042 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1117 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1156603240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB22M15.yg.ab1 (728 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g10840.1 putative translation initiation factor / similar ... 396 e-111 >At1g10840.1 putative translation initiation factor / similar to gb|U54559 eIF3-p40 subunit from Homo sapiens and is a member of the PF|01398 Mov34 family. ESTs gb|N96623 and gb|N07519 come from this gene;supported by full-length cDNA: Ceres:34385. Length = 337 Score = 396 bits (1017), Expect = e-111 Identities = 191/224 (85%), Positives = 207/224 (92%) Frame = +3 Query: 3 EDEEIEADGANYQLEMMRCLREVNVDNNTVGWDQSTLLGSFQTVELIETFMNYQENIRRC 182 +DEEIEADGANYQLEMMRCLREVNVDNNTVGW QST+LGS+QTVELIETFMNYQENI+RC Sbjct: 73 DDEEIEADGANYQLEMMRCLREVNVDNNTVGWYQSTVLGSYQTVELIETFMNYQENIKRC 132 Query: 183 VCIIYDPSKSNQGVLALKALKLSDSFMELYRNNDFNGEKLREKNLTWVDIFEEIPIKVSN 362 VCIIYDPSK++ GVLALKALKLSDSFMELYR +F GEKLREKN +W+DIFEEIPIKVSN Sbjct: 133 VCIIYDPSKADLGVLALKALKLSDSFMELYRGGNFTGEKLREKNFSWMDIFEEIPIKVSN 192 Query: 363 SALVSAFMTELEPDSPVTQSDYDRLQLSTNPFMERNMEFLIECMDDLSMEQQKFQFYYRN 542 SALVSAFMTELE D+PV+Q DYDRL ST PF+E NMEFLI+CMDDLSMEQQKFQ+YYRN Sbjct: 193 SALVSAFMTELETDTPVSQGDYDRLHSSTTPFLENNMEFLIKCMDDLSMEQQKFQYYYRN 252 Query: 543 LSRQQAQQQTWLQKRRSENMARKAAGEEPLPEEDPXNPIFNRFP 674 LSRQQAQQQ WLQKRR+ENMARK+AGEEPLPEEDP NPIF P Sbjct: 253 LSRQQAQQQAWLQKRRTENMARKSAGEEPLPEEDPSNPIFKAIP 296 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,305,496 Number of Sequences: 27288 Number of extensions: 360736 Number of successful extensions: 1075 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1020 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1067 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1286100700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB22N10.yg.ab1 (702 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08170.1 putative protein / hypothetical bacterial proteins 374 e-104 >At5g08170.1 putative protein / hypothetical bacterial proteins Length = 383 Score = 374 bits (960), Expect = e-104 Identities = 176/233 (75%), Positives = 201/233 (85%) Frame = +3 Query: 3 GVDDGCYIDWSHDLLVARKILSMERIPRFPQSIILEGGSIHVDGEGTCLTTEECLLNKNR 182 G +DGCY DWSHDLLV+RKIL++ERIPRF S+ILEGGSIHVDGEGTCL TEECLLNKNR Sbjct: 127 GANDGCYNDWSHDLLVSRKILALERIPRFQHSMILEGGSIHVDGEGTCLVTEECLLNKNR 186 Query: 183 NPHLTKEQIEDELKAYLGVKKIIWLPRGLFGDDDTNGHIDNMCCFVKPGVVLLSWTDEES 362 NPH++KEQIE+ELK YLGV+ IWLPRGL+GD+DTNGHIDNMCCF +PGVVLLSWTD+E+ Sbjct: 187 NPHMSKEQIEEELKKYLGVQSFIWLPRGLYGDEDTNGHIDNMCCFARPGVVLLSWTDDET 246 Query: 363 DPHYERAVEAFTVLSNSTDANGRKFEIIKLHIPGPLYMTDEEAAGFIQVGEAKPRLPGTR 542 DP YER+VEA +VLSNS DA GRK ++IKL+IP PLYMT+EE++G Q GEA PRL GTR Sbjct: 247 DPQYERSVEALSVLSNSIDARGRKIQVIKLYIPEPLYMTEEESSGITQDGEAIPRLAGTR 306 Query: 543 LAASYVNFYIVNGGIIAPQFGDPKWDDEAVRVLSKAFPDRQVVKIDGAKEICL 701 LAASYVNFYI NGGIIAPQFGDP D EA+RVLS FP VV I+ A+EI L Sbjct: 307 LAASYVNFYIANGGIIAPQFGDPIRDKEAIRVLSDTFPHHSVVGIENAREIVL 359 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,049,223 Number of Sequences: 27288 Number of extensions: 408391 Number of successful extensions: 1097 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1065 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1097 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1218881876 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB22P15.yg.ab1 (629 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g62030.1 putative protein / predicted proteins, D.melanoga... 171 3e-57 >At5g62030.1 putative protein / predicted proteins, D.melanogaster, C.elegans and yeast; supported by cDNA: gi_20259527 Length = 453 Score = 171 bits (433), Expect(2) = 3e-57 Identities = 84/143 (58%), Positives = 101/143 (69%), Gaps = 15/143 (10%) Frame = +3 Query: 117 QNNMREKGFSWTIVLMSELSPARISLFGDSVDAWIQIACPRLSIDWGDAFVKPLLTSFEA 296 + M EKG T+VLMSELSP R++LF DSVDAW+QIACPRLSIDWG+AF+KPLLT+FEA Sbjct: 304 EKKMMEKGIDSTVVLMSELSPTRVALFEDSVDAWVQIACPRLSIDWGEAFLKPLLTTFEA 363 Query: 297 EIALGDYPGWWERKAAVIDGSNSNCC--EKNEAC-CGNNN------------GSDYPMDY 431 EIALG GWWE ++ S+S CC +K +C C N N DYPMDY Sbjct: 364 EIALGFIRGWWENDSSSRVNSSSGCCKEDKETSCACKNENVKDDKKDNDGALDGDYPMDY 423 Query: 432 YSQDGGEWNSCYQKKPTRPLRRN 500 Y+Q+GGEWNS Y KK +RP+RRN Sbjct: 424 YAQEGGEWNSSYLKKSSRPIRRN 446 Score = 68.2 bits (165), Expect(2) = 3e-57 Identities = 31/47 (65%), Positives = 38/47 (79%) Frame = +2 Query: 2 GMKECRMNAILKAREAKNWGIVLGTLGRQGNPRILDRFTEQHERKGL 142 GM+E RM AI +AREAK WGIVLGTLGRQGNP+IL+R ++ KG+ Sbjct: 266 GMRETRMRAIARAREAKTWGIVLGTLGRQGNPKILERLEKKMMEKGI 312 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,818,405 Number of Sequences: 27288 Number of extensions: 305733 Number of successful extensions: 888 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 885 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1017362904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB23E09.yg.ab1 (657 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66330.1 expressed protein / ;supported by full-length cDN... 304 3e-83 >At1g66330.1 expressed protein / ;supported by full-length cDNA: Ceres:269548. Length = 417 Score = 304 bits (778), Expect = 3e-83 Identities = 158/207 (76%), Positives = 179/207 (86%) Frame = +3 Query: 21 SRARQDVAILGLGFLKLDARAREDTEKIDNNVKKRAERLHHIALILKNKAESKLKSVADR 200 +RARQDVAILG GFLKLDARAREDTEKID +VK++AERLHHIA I KN AESKLK+ AD+ Sbjct: 136 ARARQDVAILGSGFLKLDARAREDTEKIDRDVKRKAERLHHIATIFKNIAESKLKNAADK 195 Query: 201 HWSDGALEADLRRADYIAKKRAMEDALMALEFIKDVQDMMMSKMYKLKNGALSSDDMAGQ 380 HWSDGALEADLRRAD+ AK+RAMEDALMALEFIK++ DMM++KM + + S + Sbjct: 196 HWSDGALEADLRRADFRAKQRAMEDALMALEFIKNIHDMMVNKM--VDSLVTSETGTTDR 253 Query: 381 ITLEKNGKVLDFFPGEVSTDRITAIQEAYRDMASALSEADGIDYTDPEELELLVATLMDL 560 I+LEKNG L FFPGEVS+DRI+AI+EAY+ MASALSEADGIDYTDPEELELLV TL+DL Sbjct: 254 ISLEKNGIALGFFPGEVSSDRISAIEEAYKSMASALSEADGIDYTDPEELELLVTTLIDL 313 Query: 561 DAMDGKGSVSLLAECSSSPDVNTRKTL 641 DAMDGK S SLLAECSSSPDVNTRK L Sbjct: 314 DAMDGKSSASLLAECSSSPDVNTRKAL 340 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,280,141 Number of Sequences: 27288 Number of extensions: 312899 Number of successful extensions: 956 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 921 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 955 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1097681028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB23H16.yg.ab1 (631 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11400.1 expressed protein / ;supported by full-length cDN... 140 4e-34 >At1g11400.1 expressed protein / ;supported by full-length cDNA: Ceres:108306. Length = 204 Score = 140 bits (354), Expect = 4e-34 Identities = 84/156 (53%), Positives = 101/156 (63%), Gaps = 8/156 (5%) Frame = +3 Query: 150 GGGEDEAKEIAAQLSKTLKEGERILAPTRRPDGTLRKPIRIRAGYVPQDEVAIYKSKGAL 329 G E + A+LSK LKEGERIL PTRRPDGTLRKPIRIR GY P+DEV Y+SKG+L Sbjct: 2 GSRSGEQGKRMAELSKNLKEGERILEPTRRPDGTLRKPIRIRPGYTPEDEVVKYQSKGSL 61 Query: 330 LKKEMESLETVPPGYDPELDAISKPKSKSAKRNERKKEKRLQASVEKGKS--EASSTDG- 500 +KKEM S PPGY+P D KPK+K+AKRNERKKEKRLQA+ EK S + S+++G Sbjct: 62 MKKEMAS--QGPPGYEP--DPAPKPKTKAAKRNERKKEKRLQATAEKANSSEDGSASNGS 117 Query: 501 -----VDQALEPLDSIVSQINDITISVATPPLNSTD 593 + +E LD VS ND+ P D Sbjct: 118 QSVNVLASEMEALD--VSSNNDVCGGAPNPGTTGED 151 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,656,727 Number of Sequences: 27288 Number of extensions: 336219 Number of successful extensions: 1716 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1707 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1017362904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB23J16.yg.ab1 (702 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80460.1 putative glycerol kinase / similar to GLYCEROL KI... 404 e-113 >At1g80460.1 putative glycerol kinase / similar to GLYCEROL KINASE GB:O69664 from [Mycobacterium tuberculosis] Length = 522 Score = 404 bits (1038), Expect = e-113 Identities = 201/233 (86%), Positives = 213/233 (91%) Frame = +2 Query: 2 IPISGCLGDQHAAMLGQSCRKGEAKSTYGTGAFILLNTGEEVIPSKHGLLTTLAFKLGKD 181 I I+GCLGDQHAAMLGQ+CRKGEAKSTYGTGAFILLNTGE I S HGLLTTLA+KLG Sbjct: 247 IKIAGCLGDQHAAMLGQACRKGEAKSTYGTGAFILLNTGEVPIKSGHGLLTTLAYKLGPQ 306 Query: 182 APANYALEGSIAIAGAAVQWLRDSLGIIRSASEIEELASQVESTGGVYFVPAFNGLFAPW 361 A NYALEGSIAIAGAAVQWLRDSLGII+SASEIE+LA+ V+STGGVYFVPAFNGLFAPW Sbjct: 307 AQTNYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAAMVDSTGGVYFVPAFNGLFAPW 366 Query: 362 WRDDARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMHKDAGEKGETKNEKGQFLLR 541 WR+DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSM+KDAGEKG N KG+FLLR Sbjct: 367 WREDARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLNNGKGEFLLR 426 Query: 542 VDGGATVNNTLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVWTEEEIF 700 VDGGAT NN LMQIQADL+GSPVVRP DIETTALGAAYAAGLAVG W E +IF Sbjct: 427 VDGGATANNLLMQIQADLMGSPVVRPVDIETTALGAAYAAGLAVGFWKEADIF 479 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,472,628 Number of Sequences: 27288 Number of extensions: 383264 Number of successful extensions: 1176 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1169 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1218881876 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB23K04.yg.ab1 (747 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g57000.1 putative protein / MULTICOPY SUPPRESSOR OF RAS1 -... 320 5e-88 >At3g57000.1 putative protein / MULTICOPY SUPPRESSOR OF RAS1 - Schizosaccharomyces pombe, EMBL:D78582;supported by full-length cDNA: Ceres:40153. Length = 298 Score = 320 bits (820), Expect = 5e-88 Identities = 165/256 (64%), Positives = 208/256 (80%), Gaps = 11/256 (4%) Frame = +1 Query: 7 KEGIQKKLKAGATESDEEKAEE--------AAQEL-SGIPVNLNEQQINDKNSPGVIFIL 159 +E +K K + ++E+ EE AA+++ GIP+ LN +K G++F+L Sbjct: 39 RESSKKAKKESTSRAEEDNDEEEVTVEATAAAEDIVGGIPIVLNAP---NKEKSGIVFVL 95 Query: 160 EKASLEVAKVGKSYQLLNSEDHANFLRKNNRNPADYRPDISHQAILNILDSPLNKAGKLR 339 EKASLEVAKVGK+YQLLNS+DHANFL+KNNRNPADYRPDI+HQA+L ILDSP+NKAG+L+ Sbjct: 96 EKASLEVAKVGKTYQLLNSDDHANFLKKNNRNPADYRPDITHQALLMILDSPVNKAGRLK 155 Query: 340 ALYVRTEKNVLFEIKPHVRIPRTFKRFAGIMLQLLQKLSISAVGKREKLMRVIKNPVTQ- 516 A+YVRTEK VLFE+KPHVRIPRTFKRFAGIMLQLLQKLSI+AV REKL+R +KNP+ + Sbjct: 156 AVYVRTEKGVLFEVKPHVRIPRTFKRFAGIMLQLLQKLSITAVNSREKLLRCVKNPIEEH 215 Query: 517 YLPVNSRRIGFSHSSEKLVDMHDYVATL-DKDATLVFVVGAMAHGKIENDFVEDFISISG 693 +LPVNS RIGFSHSSEKLV+M ++AT+ D D VFVVGAMAHGKI+ +++++F+S+S Sbjct: 216 HLPVNSHRIGFSHSSEKLVNMQKHLATVCDDDRDTVFVVGAMAHGKIDCNYIDEFVSVSE 275 Query: 694 YPLSAAYCITRITNAL 741 YPLSAAYCI+RI AL Sbjct: 276 YPLSAAYCISRICEAL 291 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.134 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,876,238 Number of Sequences: 27288 Number of extensions: 343059 Number of successful extensions: 996 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 963 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 994 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB23O14.yg.ab1 (585 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09050.1 unknown protein / 182 1e-46 At3g02930.1 unknown protein / 53 1e-07 >At3g09050.1 unknown protein / Length = 258 Score = 182 bits (461), Expect = 1e-46 Identities = 92/147 (62%), Positives = 117/147 (79%) Frame = +2 Query: 143 SKNSDENPNTTSDEGDSKKQELLVRIAMLQAQKVRLTDFLDERSDYLTQFAEEANAEFDQ 322 + +SD +P+ EGD+++QELL RIAM+Q KVRLTDFLDERS+YLT+FAEEANAEFD+ Sbjct: 42 TSDSDSDPDPPKPEGDTRRQELLARIAMIQTSKVRLTDFLDERSEYLTKFAEEANAEFDK 101 Query: 323 VGENARKELEEASLRIMGNIESQMQAFEESAESSKLEIEENQKKLDEFEVRFENERNEGL 502 VGE+A K+L+EAS RI+ NIES+MQAFEESA ++LEIEEN KL EFE + + +RNEGL Sbjct: 102 VGEDAMKDLDEASTRILENIESKMQAFEESAGLNRLEIEENDNKLAEFEEKIQVDRNEGL 161 Query: 503 LFKNLGQSTPVDPTIAKGEAEKIKELT 583 FK+L PVD A+ E EKI+E+T Sbjct: 162 FFKSLRDKKPVDREQAREETEKIQEVT 188 >At3g02930.1 unknown protein / Length = 806 Score = 52.8 bits (125), Expect = 1e-07 Identities = 48/170 (28%), Positives = 81/170 (47%), Gaps = 8/170 (4%) Frame = +2 Query: 11 KKNTMISLQSIQTTTFTTSTKHDFFYRTDPPIKNHHHSRL-FLRKSKNSDENPNTTSDEG 187 +K++ SL+ + T T ++ P SRL F R S NS + + S + Sbjct: 15 RKSSSTSLRVPRLTRIVTKPD------SNSPSPTQQQSRLSFERPSSNSKPSTDKRSPKA 68 Query: 188 DS---KKQELLVRIAMLQAQKVRLTDFLDERSDYLTQFAEEANAEFDQVGENARKELEEA 358 + K Q VR++ Q Q V++ + L + ++ + E DQ+ E ARKE EEA Sbjct: 69 PTPPEKTQIRAVRVSESQPQSVQIKEDLKKANELIASLENEKAKALDQLKE-ARKEAEEA 127 Query: 359 SLRIMGNIESQMQAFE----ESAESSKLEIEENQKKLDEFEVRFENERNE 496 S ++ +E+Q ++ E E E + IE Q+K +E + EN +N+ Sbjct: 128 SEKLDEALEAQKKSLENFEIEKFEVVEAGIEAVQRKEEELKKELENVKNQ 177 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,138,766 Number of Sequences: 27288 Number of extensions: 287296 Number of successful extensions: 1558 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1547 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 895152400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB25B09.yg.ab1 (557 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g53180.1 nodulin / glutamate-ammonia ligase - like protein ... 221 3e-58 >At3g53180.1 nodulin / glutamate-ammonia ligase - like protein / MtN6 - nodulin 6, Medicago truncatula, EMBL:MET133118; supported by cDNA: gi_17065449 Length = 394 Score = 221 bits (562), Expect = 3e-58 Identities = 104/174 (59%), Positives = 136/174 (77%) Frame = +1 Query: 1 EEEWVPFDTSHYCSTSAYDAASPILHEIVNSLNSLNIDVEQLHPEAGNGQFEIALRYTTC 180 +EE++PFD YC+TS++DAASPI H+IV +L SLNI+VEQ H E+G GQFE++L +T Sbjct: 97 KEEYMPFDFGPYCATSSFDAASPIFHDIVPALESLNIEVEQFHAESGKGQFEVSLGHTIA 156 Query: 181 TNAADNLIYAREVVRAVARKHGLLATFMPKYNLDDIGSGSHVHISLSENGHNVFAASDGS 360 ++AADNL+Y REV+R+VARK GLLATF+PKY+ DIGSGSHVH+SL +NG NVF AS+ S Sbjct: 157 SHAADNLVYTREVIRSVARKQGLLATFVPKYDYCDIGSGSHVHLSLWKNGENVFPASNNS 216 Query: 361 SKHGMSKIGQEFMAGDLHHLPSLLAFTSDPSQTVTTVYNPIMWSGAYLCWGKDN 522 S HG+S +G+EFMAG L HLPS+LA + + + P WSGA+ CWGK+N Sbjct: 217 SSHGISSVGEEFMAGVLFHLPSILAIIAPLPNSYDRI-QPNTWSGAFQCWGKEN 269 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.132 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,026,175 Number of Sequences: 27288 Number of extensions: 286388 Number of successful extensions: 816 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 815 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 826050704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB25E24.yg.ab1 (477 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g43860.1 expressed protein / ;supported by full-length cDN... 153 5e-38 >At1g43860.1 expressed protein / ;supported by full-length cDNA: Ceres:21241. Length = 370 Score = 153 bits (386), Expect = 5e-38 Identities = 73/142 (51%), Positives = 104/142 (72%), Gaps = 3/142 (2%) Frame = +1 Query: 1 NLQGRSEILAVSVHGEGDINTDDYEGHEEVSVSISST--STSTEPKKLPEPVAQLTEKME 174 ++QGR EILAVSVH EGD + D Y+ H+++++ TE K L +PV +L++K++ Sbjct: 229 SIQGRLEILAVSVHAEGDTSMDHYDEHDDMALQTHKPLLPAETETKDLTDPVVELSKKLQ 288 Query: 175 KQKLAPKTEIT-EGEVKVKQSKCSTCDASVGDTKQYREHFKSDWHKHNLKRKTRQLPPLS 351 KQ+++ I EG + K +KCSTC+ VG+ KQYREH KSDWHKHNLKRKTR+LPP+S Sbjct: 289 KQEISTTDNIKQEGGEEKKGTKCSTCNTFVGEAKQYREHCKSDWHKHNLKRKTRKLPPIS 348 Query: 352 AEECAADEEINDSLGDLKEYSF 417 A+EC ++ +++DS DLK+YSF Sbjct: 349 ADECMSEIDMDDSRADLKDYSF 370 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.314 0.131 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,185,803 Number of Sequences: 27288 Number of extensions: 244012 Number of successful extensions: 851 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 847 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 605236996 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB25J11.yg.ab1 (690 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01180.1 hypothetical protein / identical to hyothetical p... 75 2e-14 >At1g01180.1 hypothetical protein / identical to hyothetical protein GB:AAF26464 GI:6715637 from [Arabidopsis thaliana] Length = 478 Score = 75.5 bits (184), Expect = 2e-14 Identities = 37/108 (34%), Positives = 62/108 (57%), Gaps = 2/108 (1%) Frame = +3 Query: 285 FIKPTSYFVLLLCLSYYHGYLSTVSKNPTHEPHQHYSTTT--SSPPSKVVVDHYQFQTRC 458 F+K + +V+++ L+Y GY S + + STT ++ P +D+++ T C Sbjct: 16 FLKTKAAYVIVIVLTYAFGYFSAYHYHQPLQQQLPPSTTAVETTKPQVCSIDNFRVTTPC 75 Query: 459 ADPIPSQFIRETILNYVFNGTSPYHDFPQPHIKPLLRQKKNQRLGING 602 + +P + IR+T+++ +FNGTSPY DFP PH K LR K+ + G G Sbjct: 76 GNLVPPELIRQTVIDRIFNGTSPYIDFPPPHAKKFLRPKRIKGWGSYG 123 Score = 64.3 bits (155), Expect = 6e-11 Identities = 28/39 (71%), Positives = 34/39 (86%) Frame = +1 Query: 574 KKINGWGSTGAVFRNLIHKVRPKNIIELGTFLGASAIHM 690 K+I GWGS GAVF NLI +V+PK I+E+G+FLGASAIHM Sbjct: 114 KRIKGWGSYGAVFENLIRRVKPKTIVEVGSFLGASAIHM 152 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,786,616 Number of Sequences: 27288 Number of extensions: 472721 Number of successful extensions: 4195 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3706 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1183294084 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB25M10.yg.ab1 (769 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26930.1 putative ripening-associated protein / ; support... 384 e-107 >At2g26930.1 putative ripening-associated protein / ; supported by cDNA: gi_12697584_dbj_AB037877.1_AB037877 Length = 383 Score = 384 bits (985), Expect = e-107 Identities = 186/240 (77%), Positives = 209/240 (86%) Frame = +2 Query: 38 ISDSSKHERKQVELVYNLDEKLNRLADEVDMNAGLSRLSLFSPCKINVFLRITSKRPDGF 217 +S S K RKQVE+V++ DE+LN++ D+VD A LSRL LFSPCKINVFLRIT KR DGF Sbjct: 36 LSFSVKASRKQVEIVFDPDERLNKIGDDVDKEAPLSRLKLFSPCKINVFLRITGKREDGF 95 Query: 218 HDLASLFHVISLGDKIKFSLSPSKSKDRLSTNVPGIPLDERNLIIKALNLYRKKTGSDKF 397 HDLASLFHVISLGD IKFSLSPSKSKDRLSTNV G+P+D RNLIIKALNLYRKKTGS++F Sbjct: 96 HDLASLFHVISLGDTIKFSLSPSKSKDRLSTNVQGVPVDGRNLIIKALNLYRKKTGSNRF 155 Query: 398 FWVHVDKRVPTGAGLGGGSSNAATALWAANRFSGGVATEKELQEWSGEIGSDVPFFFSKG 577 FW+H+DK+VPTGAGLGGGSSNAATALWAAN +GG+ TE ELQ+WS EIGSD+PFFFS G Sbjct: 156 FWIHLDKKVPTGAGLGGGSSNAATALWAANELNGGLVTENELQDWSSEIGSDIPFFFSHG 215 Query: 578 AAYCTGRGEIVQDIPSPVPFDLPMVLIKPPEACSTAEVYKRFRLDVSSTIEPSTLLEKIS 757 AAYCTGRGEIVQD+P P P DLPMVLIKP EACSTAEVYKR RLD +S I P TLLE ++ Sbjct: 216 AAYCTGRGEIVQDLPPPFPLDLPMVLIKPREACSTAEVYKRLRLDQTSNINPLTLLENVT 275 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,499,709 Number of Sequences: 27288 Number of extensions: 425214 Number of successful extensions: 1373 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1293 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1364 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1401406280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB25N01.yg.ab1 (541 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g16080.1 expressed protein / ; supported by cDNA: gi_12083... 287 3e-78 >At1g16080.1 expressed protein / ; supported by cDNA: gi_12083327_gb_AF332460.1_AF332460 Length = 313 Score = 287 bits (734), Expect = 3e-78 Identities = 135/161 (83%), Positives = 149/161 (91%) Frame = +1 Query: 1 KALQQMGAGEDLLVKRGEPVPIDFPGPILVCTRNDDLDAVLQSTPQSRWNDLVFFQNGML 180 +ALQ+MG GEDLLVKRGE VP+DF GPILVCTRNDDLDAVL++TPQSRW DLVFFQNGM+ Sbjct: 67 RALQEMGNGEDLLVKRGEAVPVDFEGPILVCTRNDDLDAVLEATPQSRWKDLVFFQNGMM 126 Query: 181 EPWFESKGLGDADQVLAYFAVAKLGEPPIDGITDTNPEGLTAAFGKWGSAVADRLRAGGL 360 EPWFESKGLGD DQVLAYFAV+KLGEPP+DG TDTNPEGLTAA+GKW S +A RL++GGL Sbjct: 127 EPWFESKGLGDTDQVLAYFAVSKLGEPPVDGKTDTNPEGLTAAYGKWASEIAARLQSGGL 186 Query: 361 SCKVLEKEPFQKQMLEKLIWISAFMLVGARHPGATVGAVEK 483 SCKVL+KE FQKQMLEKLIWI AFMLVGARHPGA+VG VEK Sbjct: 187 SCKVLDKEAFQKQMLEKLIWICAFMLVGARHPGASVGTVEK 227 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,876,640 Number of Sequences: 27288 Number of extensions: 289326 Number of successful extensions: 1002 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 966 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 994 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 772177832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB25O10.yg.ab1 (717 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g29420.1 hypothetical protein / 87 7e-18 >At4g29420.1 hypothetical protein / Length = 446 Score = 87.4 bits (215), Expect = 7e-18 Identities = 49/175 (28%), Positives = 88/175 (50%), Gaps = 9/175 (5%) Frame = +2 Query: 5 LSVEKFENLKTVWIEASFLYPLLVSFRYTDSVENLTLDS-RGLTKGPFARFKFSLENLFN 181 +S +F++LKT+ + + +Y L+ + + + ++ L +DS + + + R + L + Sbjct: 274 VSFGEFQDLKTLELVSPDMYRLISNISFGNKIKKLAVDSVKSIEQSE--RLELGLATILK 331 Query: 182 IFPNMTSLCFRSRAWSEFEVRARIFG-----IGMEGLKTFCGYLMIVD---LSLTLSLVA 337 FP +TSL R WS+ E + G G + LK + + D + T+S + Sbjct: 332 AFPGITSLSLSPRTWSDIETHFQSQGGLGDMKGTDSLKQITARVQMSDHTNVHQTVSFIR 391 Query: 338 CVLDQCFGLVDVSLLIHNNVASYLSKGFMCTCMQRWPNVNWKWGTWEEGKEDSWI 502 ++++ GL D+ L+IH + + + TCM P V WKWG W EG ED W+ Sbjct: 392 SIVNKYRGLTDMRLMIHQDKDPRVRSNLISTCMMSNPRVRWKWGMWAEGGEDMWV 446 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,312,874 Number of Sequences: 27288 Number of extensions: 378779 Number of successful extensions: 1100 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1045 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1099 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1263366616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB25P15.yg.ab1 (750 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g45690.1 expressed protein / ; supported by cDNA: gi_48377... 226 1e-59 >At2g45690.1 expressed protein / ; supported by cDNA: gi_4837732_gb_AF085354.1_AF085354 Length = 367 Score = 226 bits (576), Expect = 1e-59 Identities = 116/200 (58%), Positives = 153/200 (76%), Gaps = 8/200 (4%) Frame = +2 Query: 2 QNGH--FTPQGRALSAMSRFGENARML--SDPTWFRRVEHHQRAVMELPETEIKRPTMSS 169 QN H + +GRA+SA+S FG+NAR S P W RR++H Q+AV+E P + +R TMS Sbjct: 169 QNHHNPWNLEGRAMSALSSFGQNARTTTSSTPGWSRRIQH-QQAVIEPPMIKERRRTMSE 227 Query: 170 FLSEKGISGSLFLMGEVMFIARPLVYVLLIRKYGVKSWLPWLVSLSIDIIGM----TSSI 337 L+EKG++G+LF +GEV++I RPL+YVL IRKYGV+SW+PW +SLS+D +GM S Sbjct: 228 LLTEKGVNGALFAIGEVLYITRPLIYVLFIRKYGVRSWIPWAISLSVDTLGMGLLANSKW 287 Query: 338 ACQKDPKLPLSGPEKDELRRRKLLLALYLMRDPCFAKYTRQRLESTGKTLEHVPVVGFLT 517 +K ++ SGPEKDELRRRKL+ ALYLMRDP F KYTRQ+LES+ K LE +P++GFLT Sbjct: 288 WGEKSKQVHFSGPEKDELRRRKLIWALYLMRDPFFTKYTRQKLESSQKKLELIPLIGFLT 347 Query: 518 AKLIELLVGAQTRYTYMSGS 577 K++ELL GAQ+RYTY+SGS Sbjct: 348 EKIVELLEGAQSRYTYISGS 367 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,367,484 Number of Sequences: 27288 Number of extensions: 401606 Number of successful extensions: 1043 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1040 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB26J21.yg.ab1 (767 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g43710.1 histidine decarboxylase, putative / similar to hi... 459 e-130 At1g65960.1 glutamate decarboxylase 2 (GAD 2) / similar to gl... 56 2e-08 >At1g43710.1 histidine decarboxylase, putative / similar to histidine decarboxylase GB:BAA78331 GI:4996105 from [Brassica napus]; supported by cDNA: gi_15011301_gb_AF389349.1_AF389349 Length = 482 Score = 459 bits (1182), Expect = e-130 Identities = 219/253 (86%), Positives = 236/253 (92%) Frame = +1 Query: 1 REVFPDGILYASCESHYSIFKAARMYRMDCEKVNTLLSGEIDCEDFKAKLSLHKDKPAII 180 RE+FPDGILYAS ESHYS+FKAARMYRM+CEKV+TL+SGEIDC+D + KL +KDKPAI+ Sbjct: 186 REMFPDGILYASRESHYSVFKAARMYRMECEKVDTLMSGEIDCDDLRKKLLANKDKPAIL 245 Query: 181 NVNIGTTVKGAVDDLDLVIKTLEETGFTHDRFYIHCDGALFGLMMPFVKLAPKVSFKKPI 360 NVNIGTTVKGAVDDLDLVIKTLEE GF+HDRFYIHCDGALFGLMMPFVK APKV+F KPI Sbjct: 246 NVNIGTTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPKVTFNKPI 305 Query: 361 GSVSVSGHKFVGCPMPCGVQITRLEHINALSRNVEYLASRDATIMGSRNGHAPLFLWYTL 540 GSVSVSGHKFVGCPMPCGVQITR+EHI LS NVEYLASRDATIMGSRNGHAPLFLWYTL Sbjct: 306 GSVSVSGHKFVGCPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRNGHAPLFLWYTL 365 Query: 541 NRKGYRGFQKEVQKCLRNAHYLKGRLTSAGIGAMLNELSSTVVFERPQDEEFTRKWQLAC 720 NRKGY+GFQKEVQKCLRNAHYLK RL AGI AMLNELSSTVVFERP+DEEF R+WQLAC Sbjct: 366 NRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQLAC 425 Query: 721 QGSIAHVVVMPNI 759 QG IAHVVVMP++ Sbjct: 426 QGDIAHVVVMPSV 438 >At1g65960.1 glutamate decarboxylase 2 (GAD 2) / similar to glutamate decarboxylase (gad) GI:294111 from [Petunia hybrida]; supported by cDNA: gi_1184959_gb_U46665.1_ATU46665 Length = 494 Score = 56.2 bits (134), Expect = 2e-08 Identities = 51/192 (26%), Positives = 93/192 (47%), Gaps = 9/192 (4%) Frame = +1 Query: 61 KAARMYRMDCEKVNTLLSGEIDCEDFKAKLSLHKDKPAIINVNIGTTVKGAVDDL----D 228 K AR + ++ ++VN L G + KA + ++ + + +G+T+ G +D+ D Sbjct: 168 KFARYFEVELKEVN-LSEGYYVMDPDKAAEMVDENTICVAAI-LGSTLNGEFEDVKRLND 225 Query: 229 LVIKTLEETGFTHDRFYIHCDGALFGLMMPFVKLAPKVSFKKP-IGSVSVSGHKFVGCPM 405 L++K EETG+ IH D A G + PF+ + F+ P + S++VSGHK+ Sbjct: 226 LLVKKNEETGWNTP---IHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYA 282 Query: 406 PCGVQITRL--EHINALSRNVEYLASRDA--TIMGSRNGHAPLFLWYTLNRKGYRGFQKE 573 G + R + L ++ YL + T+ S+ + +Y L R G+ G++ Sbjct: 283 GIGWVVWRAAEDLPEELIFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNV 342 Query: 574 VQKCLRNAHYLK 609 ++ C+ N LK Sbjct: 343 MENCIENMVVLK 354 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,718,116 Number of Sequences: 27288 Number of extensions: 399705 Number of successful extensions: 1028 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 990 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1028 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1401406280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB27J17.yg.ab1 (448 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g34520.1 mitochondrial ribosomal protein S14 / ; supporte... 86 6e-18 >At2g34520.1 mitochondrial ribosomal protein S14 / ; supported by cDNA: gi_20260273 Length = 164 Score = 86.3 bits (212), Expect = 6e-18 Identities = 40/59 (67%), Positives = 50/59 (83%) Frame = +3 Query: 3 KHRCKLADLPRNSSFTRVTNRCVFTGRARSVYQMFRVSRIVFRDLASRGLLHGVKKASW 179 K+R KL+ LPRNS+F R+ NRCVFTGR+RSV ++FRVSRIVFR LAS+G L G+ K+SW Sbjct: 106 KNRYKLSKLPRNSAFARIRNRCVFTGRSRSVTELFRVSRIVFRGLASKGALMGITKSSW 164 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,904,284 Number of Sequences: 27288 Number of extensions: 171406 Number of successful extensions: 439 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 439 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 525519208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB27L21.yg.ab1 (747 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g51130.1 putative protein / contains similarity to unknown... 321 2e-88 >At5g51130.1 putative protein / contains similarity to unknown protein (pir||T26512) Length = 318 Score = 321 bits (823), Expect = 2e-88 Identities = 155/265 (58%), Positives = 191/265 (71%), Gaps = 29/265 (10%) Frame = +2 Query: 5 KRKKQKEVAIFGNYRNYYTYRIDQGLEEDPRIKIMKKEWFEGKTCLDIGCNSGLITITIA 184 K+KK +EV FGNYRNYY YRI +EDPR+K++KKEWFEGK CLDIGCNSG++TI IA Sbjct: 54 KKKKNQEVYPFGNYRNYYGYRISNDTDEDPRLKVLKKEWFEGKDCLDIGCNSGIMTIHIA 113 Query: 185 KNFGCQKILGVDIDSARIEDAHWNLRKIVKMSESKKQHSGDSLSH--------------- 319 K FGC+ ILGVDID++RIEDAHW+LRK V+M S K S S Sbjct: 114 KKFGCRSILGVDIDTSRIEDAHWHLRKFVRMQNSTKPSEKKSSSEGADGVHGSKEPSVSL 173 Query: 320 --------------LFDIVSFKKDNFVQSWSTPGEKYDTILCLSVTKWVHLNWGDEGLIT 457 L IVSF+K+NFVQ+ + +YDTILCLSVTKWVHLNWGD+GLIT Sbjct: 174 SNGEAKADSAETKDLSQIVSFQKENFVQTRNLDDNRYDTILCLSVTKWVHLNWGDDGLIT 233 Query: 458 LFSKVWRLLQPGGVFILEPQPWTSYVSNRQVSEVAATNYKMLEIFPENFQEVLLDKIGFR 637 LFSK+WRLLQPGG+F++EPQPW SY +NR+VSE A NY+ + + P+ FQE+LLDKIGFR Sbjct: 234 LFSKIWRLLQPGGIFVMEPQPWKSYENNRRVSETTAMNYRTIVLRPDRFQEILLDKIGFR 293 Query: 638 EVENLSASLSGSKTGFNRPVLALWK 712 VE+L++SLSG+ GF+R +LA K Sbjct: 294 TVEDLTSSLSGASKGFDRQILAFQK 318 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,237,133 Number of Sequences: 27288 Number of extensions: 392499 Number of successful extensions: 1087 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1051 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1084 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB28D15.yg.ab1 (638 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g23570.1 putative protein / similar to unknown protein (em... 288 2e-78 At3g22435.1 Expressed protein / ; supported by cDNA: gi_15081... 56 2e-08 >At5g23570.1 putative protein / similar to unknown protein (emb|CAB62356.1) Length = 625 Score = 288 bits (736), Expect = 2e-78 Identities = 134/197 (68%), Positives = 164/197 (83%) Frame = +1 Query: 19 RGAAVVAAGESYGQWKGLNEVVKDKEIVWPPMVVIMNTQLEQDENEKWLGVGNQELLDYF 198 RGA+V+ GE YGQWKGL E KD EIVWPPMV+IMNT+L++D+N+KWLG+GNQELL+YF Sbjct: 275 RGASVIPCGEIYGQWKGLGEDEKDYEIVWPPMVIIMNTRLDKDDNDKWLGMGNQELLEYF 334 Query: 199 GSYEAVRARHSYGPKGHRGMSVLIFESSAVGYTEAERLSKHFEHQGTDRDAWDHRRILFY 378 YEA+RARHSYGP+GHRGMSVL+FESSA GY EAERL + G DR AW +R +F Sbjct: 335 DKYEALRARHSYGPQGHRGMSVLMFESSATGYLEAERLHRELAEMGLDRIAWGQKRSMF- 393 Query: 379 PGGKRQLYGYLATKRDLDFFNQHCQGKSKLKFELVSYQERVVNQLKQMNEDNQQLNYYKN 558 GG RQLYG+LATK+DLD FNQH QGK++LKFEL SYQE VV +L+Q++EDNQQLNY+KN Sbjct: 394 SGGVRQLYGFLATKQDLDIFNQHSQGKTRLKFELKSYQEMVVKELRQISEDNQQLNYFKN 453 Query: 559 KIAKEQKHSKALEESFD 609 K++K+ KH+K LEES + Sbjct: 454 KLSKQNKHAKVLEESLE 470 >At3g22435.1 Expressed protein / ; supported by cDNA: gi_15081712_gb_AY048249.1_ Length = 208 Score = 55.8 bits (133), Expect = 2e-08 Identities = 38/144 (26%), Positives = 66/144 (45%), Gaps = 19/144 (13%) Frame = +1 Query: 97 IVWPPMVVIMNTQLEQDENEKWLGVGNQELLDYFGSYEAV--RARHSYGPKGHRGMSVLI 270 I+WPP V++ NT + + + G GN+ + + +++ YG +GH G+++ Sbjct: 56 IIWPPHVIVQNTSTGKGKEGRMEGFGNKTMDNRIRELGLTGGKSKSLYGREGHLGITLFK 115 Query: 271 FESSAVGYTEAERLSKHFEHQGTDRDAWDHRRILF-------YPG----------GKRQL 399 F G +A R++++FE R +W + L PG KR Sbjct: 116 FAGDDSGLRDAMRMAEYFEKINRGRKSWGRVQPLTPSKDDEKNPGLVEVDGRTGEKKRIF 175 Query: 400 YGYLATKRDLDFFNQHCQGKSKLK 471 YGYLAT DLD + + K+ ++ Sbjct: 176 YGYLATVTDLDKVDVETKKKTTIE 199 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.134 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,466,822 Number of Sequences: 27288 Number of extensions: 325617 Number of successful extensions: 1086 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1044 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1081 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1044135612 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB28E17.yg.ab1 (737 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g65860.1 putative protein / contains similarity to protein... 369 e-103 At2g31800.1 putative protein kinase / contains a protein kina... 54 9e-08 At5g14230.1 ankyrin - like protein / 270 kDa ankyrin G isofor... 51 6e-07 At3g59830.1 putative protein / SERINE/THREONINE-PROTEIN KINAS... 47 8e-06 >At5g65860.1 putative protein / contains similarity to protein arginine methyltransferase Length = 326 Score = 369 bits (948), Expect = e-103 Identities = 179/244 (73%), Positives = 210/244 (85%), Gaps = 2/244 (0%) Frame = +3 Query: 3 ATNGDTEKVQTLIASGADVSYFDHDGFTPLMLAAKHGHADVVKTLLDAGAPWNALSPTNL 182 A +GD +KVQTLI SGADV++FD+DG TPLM AAK G+A++V LL++GAPWNALSP+NL Sbjct: 11 AKSGDLKKVQTLIYSGADVTHFDNDGLTPLMHAAKIGNAEIVTALLESGAPWNALSPSNL 70 Query: 183 SAGDFAMDSGHQDAFDILLNTGIQAELILGTIARKENKIGDLDGDYLGDRVSFSEDKLMD 362 SAGDFAM++GHQ+ FD+LL TGIQ+ELILGTIAR + K + +YL DRVSFSEDKLMD Sbjct: 71 SAGDFAMEAGHQETFDLLLKTGIQSELILGTIARNQTKNEYSNQEYLQDRVSFSEDKLMD 130 Query: 363 ANSKAVMMAWEKPLMEAHAKAICSRGGHILNIGFGMGLVDTAIQQYSPATHTIVEAHPEV 542 + SK VMMAWEKPLMEAHAKAIC GGHILN+GFGMGLVDTAIQ+Y+P HTI+EAHPEV Sbjct: 131 SESKGVMMAWEKPLMEAHAKAICLNGGHILNVGFGMGLVDTAIQRYNPVKHTIIEAHPEV 190 Query: 543 YERMRLSGWTEKENVKVVFGKWQDVVHQLD--SYDGIFFDTHGEYYEDLREFHQHLPSYL 716 Y+RM SGW EKENVK+VFG+WQDV+ +LD S+DGIFFDT+GEYYEDLREFHQHLP L Sbjct: 191 YKRMIESGWGEKENVKIVFGRWQDVLDKLDDNSFDGIFFDTYGEYYEDLREFHQHLPRLL 250 Query: 717 KLKG 728 K G Sbjct: 251 KPDG 254 >At2g31800.1 putative protein kinase / contains a protein kinase domain profile (PDOC00100) Length = 489 Score = 53.9 bits (128), Expect = 9e-08 Identities = 35/82 (42%), Positives = 42/82 (50%) Frame = +3 Query: 3 ATNGDTEKVQTLIASGADVSYFDHDGFTPLMLAAKHGHADVVKTLLDAGAPWNALSPTNL 182 A GD E VQ L+ G DV+ D DG T L +AA GH DVVK LL A +A Sbjct: 83 ACRGDVEGVQDLLDEGIDVNSIDLDGRTALHIAACEGHVDVVKLLLTRKANIDARDRWGS 142 Query: 183 SAGDFAMDSGHQDAFDILLNTG 248 +A A G+ D F+IL G Sbjct: 143 TAAADAKYYGNMDVFNILKARG 164 >At5g14230.1 ankyrin - like protein / 270 kDa ankyrin G isoform, Rattus norvegicus, EMBL:AF102552 Length = 591 Score = 51.2 bits (121), Expect = 6e-07 Identities = 33/100 (33%), Positives = 49/100 (49%) Frame = +3 Query: 3 ATNGDTEKVQTLIASGADVSYFDHDGFTPLMLAAKHGHADVVKTLLDAGAPWNALSPTNL 182 A GD + V+ L G + D DG+TPLMLAA+ GH + + L+ GA NA + Sbjct: 394 ARRGDVKAVKLLSGKGYSLDIPDGDGYTPLMLAAREGHGHMCEYLISCGANCNAKN---- 449 Query: 183 SAGDFAMDSGHQDAFDILLNTGIQAELILGTIARKENKIG 302 G+ +D DA ++ N + +I G+ K K G Sbjct: 450 GRGEKLLDLATGDAEKVIRNELSRRFVIEGSSVMKHTKGG 489 >At3g59830.1 putative protein / SERINE/THREONINE-PROTEIN KINASE CTR1 - Arabidopsis thaliana, EMBL:L08789 Length = 476 Score = 47.4 bits (111), Expect = 8e-06 Identities = 30/85 (35%), Positives = 44/85 (51%) Frame = +3 Query: 3 ATNGDTEKVQTLIASGADVSYFDHDGFTPLMLAAKHGHADVVKTLLDAGAPWNALSPTNL 182 A+ GD V+ L+ G DV+ D DG T L +A+ GH DVVK LL A +A Sbjct: 84 ASKGDVNGVEELLNEGIDVNSIDLDGRTALHIASCEGHYDVVKVLLSRRANIDARDRWGS 143 Query: 183 SAGDFAMDSGHQDAFDILLNTGIQA 257 +A A G+ + +++L G +A Sbjct: 144 TAAVDAKYYGNVEVYNLLKARGAKA 168 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,632,181 Number of Sequences: 27288 Number of extensions: 423807 Number of successful extensions: 1554 Number of sequences better than 1.0e-05: 8 Number of HSP's better than 0.0 without gapping: 1387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1541 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1312709680 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB28G04.yg.ab1 (758 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80940.1 expressed protein / ;supported by full-length cDN... 251 3e-67 >At1g80940.1 expressed protein / ;supported by full-length cDNA: Ceres:37300. Length = 213 Score = 251 bits (641), Expect = 3e-67 Identities = 131/216 (60%), Positives = 164/216 (75%), Gaps = 1/216 (0%) Frame = +3 Query: 33 EEGKKEVQSILVNGFSPVTSTPVFWKSRKRAASMKNLYKDNIKDSTEDKDKINEHNNDNN 212 E+ K V V GF PV++T + WKSRKR+A + N+ + E ++ N+ Sbjct: 8 EKDMKTVSDGFVGGFFPVSTTKIAWKSRKRSALL------NLDKAPEAVTEVTPEKNEIT 61 Query: 213 NNKDDSIDEKMEETSILSEKRKALFEPLEPIMDLNGRRPSA-ESLLPPPDFDSASYPRGW 389 + + E M T +LSEKRKALFEPLEPI +LNG+RP+A +SLLPPPDF++A+YP+GW Sbjct: 62 AMDTEKVGEPMTTTPLLSEKRKALFEPLEPITNLNGKRPTAADSLLPPPDFETANYPKGW 121 Query: 390 LIGKKRKLVNVDVVESMRRIAVQEMNRKDREIDGLNEQLEEDSRVLEHLQLQLLDERSKR 569 LIGKKRKLVNVDVVESMRRIAVQEMNRKDREIDGLNEQLEEDSR LEHLQLQLL ERSKR Sbjct: 122 LIGKKRKLVNVDVVESMRRIAVQEMNRKDREIDGLNEQLEEDSRCLEHLQLQLLQERSKR 181 Query: 570 SDVERQNAMLQNQVDMLMNMLQEHENLEDDEIPQDP 677 +++ER+N ML+ QVDML+NM+QE +D+E ++P Sbjct: 182 TEIERENTMLKEQVDMLVNMIQE----DDEEGAEEP 213 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,379,690 Number of Sequences: 27288 Number of extensions: 364154 Number of successful extensions: 2458 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2305 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1374797300 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB28G12.yg.ab1 (407 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g29070.1 plastid ribosomal protein L34 precursor, putative ... 115 8e-27 >At1g29070.1 plastid ribosomal protein L34 precursor, putative / similar to plastid ribosomal protein L34 precursor GB:AAF64157 GI:7578860 from [Spinacia oleracea]; supported by full-length cDNA: Ceres: 11466. Length = 157 Score = 115 bits (288), Expect = 8e-27 Identities = 59/75 (78%), Positives = 64/75 (84%) Frame = +3 Query: 3 SGMEAVKRRGLVVRAGKKFQLAQTKRNRSRKSLARTHGFRLRMRTTNGRAVLKRRRAKGR 182 SG+ +RRGLVVRAGK L QTKR+RSRKSLARTHGFR RMRTT+GRA +KRRRAKGR Sbjct: 84 SGLNGQRRRGLVVRAGKA-ALCQTKRSRSRKSLARTHGFRRRMRTTSGRATIKRRRAKGR 142 Query: 183 WILCTKSNPSSGKRA 227 W LC KSNPSSGKRA Sbjct: 143 WNLCPKSNPSSGKRA 157 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,154,170 Number of Sequences: 27288 Number of extensions: 207722 Number of successful extensions: 2151 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 984 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2043 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 418046344 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB2c07.yg.ab1 (719 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g22770.1 putative gigantea protein / strong similarity to ... 347 3e-96 >At1g22770.1 putative gigantea protein / strong similarity to GB:CAB56039 from [Arabidopsis thaliana]; supported by cDNA: gi_6002679_gb_AF105064.1_AF105064 Length = 1173 Score = 347 bits (891), Expect = 3e-96 Identities = 177/225 (78%), Positives = 193/225 (85%) Frame = +2 Query: 41 EGGIMSFPFNASELANILTMDRHIGFNCSARVLLRSVLTEKQELCFSVVSLLWHKMIASP 220 E GI F +AS+LAN LT DR GF C + LLRSVL EK EL FSVVSLLWHK+IA+P Sbjct: 865 EKGIKDFLLDASDLANFLTADRLAGFYCGTQKLLRSVLAEKPELSFSVVSLLWHKLIAAP 924 Query: 221 ETQLNAVSTSAQQGWRQVVDALCNVVAASPTTAATAVVLQAERELQPWIAKDDDVGQKMW 400 E Q A STSAQQGWRQVVDALCNVV+A+P AA AVVLQAERELQPWIAKDD+ GQKMW Sbjct: 925 EIQPTAESTSAQQGWRQVVDALCNVVSATPAKAAAAVVLQAERELQPWIAKDDEEGQKMW 984 Query: 401 RINQRIVKLIVELMRNHENLESLVILATALDLLLRATDGMLVDGEACTLPQLELLEATAR 580 +INQRIVK++VELMRNH+ ESLVILA+A DLLLRATDGMLVDGEACTLPQLELLEATAR Sbjct: 985 KINQRIVKVLVELMRNHDRPESLVILASASDLLLRATDGMLVDGEACTLPQLELLEATAR 1044 Query: 581 AVQPVLEWGESGLAVADGLSNLLKCRVPATVRCLSHASAHVRTLS 715 A+QPVL WG SGLAV DGLSNLLKCR+PAT+RCLSH SAHVR LS Sbjct: 1045 AIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHPSAHVRALS 1089 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,456,865 Number of Sequences: 27288 Number of extensions: 370298 Number of successful extensions: 1427 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1424 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1272263564 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB4g08.yg.ab1 (701 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g27385.1 Expressed protein / ; supported by full-length cD... 179 1e-45 >At1g27385.1 Expressed protein / ; supported by full-length cDNA: Ceres: 39286. Length = 202 Score = 179 bits (454), Expect = 1e-45 Identities = 103/184 (55%), Positives = 125/184 (66%) Frame = +2 Query: 140 MACRALFRTVMLTEPWRTSPNRTSFTLSLANQKSSKPTWNSRCGCRIVTQVGDISAERRI 319 MAC+ + R+V ++E RTS R F L + +S P + + G S R Sbjct: 1 MACKTILRSVFVSESRRTSGARRCFFLPPS--PASVPVHGLFPAPKSLCFNGFASVPERA 58 Query: 320 HHRVNCSHDENLPSSSTESDQEPPQEAVLKAISEVSKTEGRVGQTTNMVLGGTVTDDSTD 499 R+NCSH++ +SDQ PPQEAVLKAISEVSKT+GRVG+TTNM++GGTV DDS Sbjct: 59 T-RLNCSHND-------QSDQGPPQEAVLKAISEVSKTDGRVGKTTNMIIGGTVADDSAK 110 Query: 500 EWLTLDQKVNTYPTVRGFTAIGTGGDDFVQAMVVAVESVLQHPIPLXQVKQIMSSGGKYV 679 +WL LDQKVNTYPT RGFTAIGTGG+DFV AMVVAVESV+ IP VKQ +SS GKYV Sbjct: 111 DWLELDQKVNTYPTERGFTAIGTGGNDFVHAMVVAVESVIDRQIPEDCVKQTLSSKGKYV 170 Query: 680 SVTL 691 SV + Sbjct: 171 SVNI 174 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,190,600 Number of Sequences: 27288 Number of extensions: 360328 Number of successful extensions: 997 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 960 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 995 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1218881876 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB4g10.yg.ab1 (677 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g19880.1 expressed protein / ; supported by cDNA: gi_15983... 372 e-103 >At2g19880.1 expressed protein / ; supported by cDNA: gi_15983421_gb_AF424585.1_AF424585 Length = 519 Score = 372 bits (955), Expect = e-103 Identities = 175/225 (77%), Positives = 194/225 (85%) Frame = +3 Query: 3 IYEYHMPCSMGFATGGRTFFLWGGCMMMHADDFRTDKHGVVSQLSDGGYSDDMTLAAIAS 182 IYEYHMPCSMGFATGGRTFFLWGGCMMMHADDFR D++GVVS L DGGYSDDMTLA++A Sbjct: 224 IYEYHMPCSMGFATGGRTFFLWGGCMMMHADDFRQDRYGVVSGLRDGGYSDDMTLASLAG 283 Query: 183 AHKRLITSPPVAVFPHPLASDLTFSRYWNYLRKQTFVLESYTTYINWVMNRALFSVHCYL 362 AHKRLITSPPVAVFPHPLASDL+F RYWNYLRKQTFVLESY + +NW+MN+ALF+VHCYL Sbjct: 284 AHKRLITSPPVAVFPHPLASDLSFGRYWNYLRKQTFVLESYISKVNWIMNKALFAVHCYL 343 Query: 363 SWGFVAPYVMAFFHVIAALRFYMKEKVAEESPLNPKGLILVGCLVTCTAIELLSMWNLTR 542 SWGFVAPYVMA H+ +ALR Y+K E + G++LV L CT IELLSMWNLTR Sbjct: 344 SWGFVAPYVMAIIHITSALRIYIKGYHQLEDTTSASGMMLVITLAICTFIELLSMWNLTR 403 Query: 543 IEVRLCNMLSPEAPPLSLSAYNWCLVFVAMVVDNFLYPISAIRSH 677 EV+LCNMLSPEAP LSL+ YNW LVFVAM+VDNFLYPISA RSH Sbjct: 404 REVQLCNMLSPEAPRLSLATYNWGLVFVAMLVDNFLYPISAFRSH 448 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,130,225 Number of Sequences: 27288 Number of extensions: 364085 Number of successful extensions: 948 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 898 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 947 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1147706292 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB5A17.yg.ab1 (738 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27340.1 hypothetical protein / predicted by genemark.hmm 174 6e-44 >At3g27340.1 hypothetical protein / predicted by genemark.hmm Length = 141 Score = 174 bits (440), Expect = 6e-44 Identities = 79/115 (68%), Positives = 98/115 (84%) Frame = +1 Query: 169 PRLIRFTLKAPTNVEVEFANGSHYNLPAEFLRVFSPAVDSKIRSIGGEKVIYGRRYVGLM 348 P+L F++ +P VEVE+A+G+ +N +EFLR+ SPA D K+RSIGGEKVI GRRYVG+M Sbjct: 21 PKLSGFSIVSPKQVEVEYADGTKFNFSSEFLRIHSPAADGKVRSIGGEKVISGRRYVGIM 80 Query: 349 SAEPVGNYGVRLLFDDLHKTGIYTWDYFYHLGSNKFTLMRSYINTLRKYGLTRDP 513 SAEPVGNYGVRL+FDDLH+TGIY WDYFY LGSNKF LMR+YI TL+K+ L+R+P Sbjct: 81 SAEPVGNYGVRLVFDDLHRTGIYPWDYFYELGSNKFGLMRNYIKTLQKHNLSREP 135 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,919,094 Number of Sequences: 27288 Number of extensions: 350519 Number of successful extensions: 880 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 831 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 876 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1312709680 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB5B10.yg.ab1 (658 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04330.1 expressed protein / ; supported by cDNA: gi_1502... 220 6e-58 >At4g04330.1 expressed protein / ; supported by cDNA: gi_15027850_gb_AY045782.1_ Length = 174 Score = 220 bits (560), Expect = 6e-58 Identities = 109/168 (64%), Positives = 137/168 (80%) Frame = +3 Query: 60 SSTILPLSHFSFLSQKPHGTSIGSFPLNQWNPTSQKTRLNCQKMYVPGFGEASPEAKAAK 239 SS++L S+ S+L+ K + S+PL Q + ++TR+ KMYVPGFGEASPEAKAAK Sbjct: 4 SSSLLHHSYLSYLNPKFGKRPLVSYPLMQSSRKCKQTRICSNKMYVPGFGEASPEAKAAK 63 Query: 240 NLHNLFTYVAVRVVNAQLESYNTEAHKELTEFMEKHSLNDGDKFCAALMRESSRHKTLAM 419 +LH+ FTYVAVR+V+AQLESYN EA+ EL EF++ +S++DGDKFCA LMR SSRH LA+ Sbjct: 64 HLHDFFTYVAVRIVSAQLESYNPEAYMELREFLDTNSVSDGDKFCATLMRRSSRHMNLAL 123 Query: 420 RILEVRSAYCKKDFEWENLERLAKKMADESNTRLMRDYVLETSHVETE 563 RILEVRSAYCK DFEW+N++RLA K D+SNTRLMR+YVLETSHVET+ Sbjct: 124 RILEVRSAYCKNDFEWDNMKRLAFKNVDDSNTRLMREYVLETSHVETD 171 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,695,217 Number of Sequences: 27288 Number of extensions: 350958 Number of successful extensions: 1034 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1001 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1034 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1097681028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB5D22.yg.ab1 (708 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g35460.1 putative protein / similar to unknown protein (pi... 412 e-116 >At5g35460.1 putative protein / similar to unknown protein (pir||T40675); supported by cDNA: gi_14335067_gb_AY037213.1_ Length = 381 Score = 412 bits (1060), Expect = e-116 Identities = 191/232 (82%), Positives = 211/232 (90%) Frame = +1 Query: 1 VYCLIYVTFVPLRWIYYRYKKWHYYLLDFCYYANTIFLIMLLFYPKNEKLFMVCFSFAEG 180 VYC YV FVPLRWIYYR+KKWHYYLLDFCYYANTIFL+ LL YPKNEKLFMVCFSFAEG Sbjct: 94 VYCFFYVIFVPLRWIYYRFKKWHYYLLDFCYYANTIFLVDLLLYPKNEKLFMVCFSFAEG 153 Query: 181 PLAWALIVWRCSLVFSSVDKLVSVLIHLLPGVVFFTIRWWDPAFFEAMHPEGTAMRASWP 360 PLAWA+IVWRCSLVFSS DK+VSVLIHLLPG+VFFTIRWW+PA F AMHP GT R SWP Sbjct: 154 PLAWAIIVWRCSLVFSSPDKIVSVLIHLLPGLVFFTIRWWNPATFAAMHPVGTDRRVSWP 213 Query: 361 YVGNKSFLWTWLFTVPLIAYSLWQALYFLIVNVLRRQRLLRDPEVMTSYRELSKKAQKAN 540 YV +K++L+TWLF VPL+ Y+LWQ LYFLIVNVLRRQRLLRDPEVMTSYRELSKKA+KAN Sbjct: 214 YVEDKAYLFTWLFLVPLVVYTLWQVLYFLIVNVLRRQRLLRDPEVMTSYRELSKKAEKAN 273 Query: 541 NLWWRLSGLLGDQNRMFMYILLQALFTVATMALTVPIFLSYELHLAFQMLKV 696 N W+LSGLLGDQNR++MYIL QA+FTVATMALTVPIFLSY LH+ FQ+LK+ Sbjct: 274 NKLWQLSGLLGDQNRIWMYILFQAIFTVATMALTVPIFLSYRLHVIFQILKI 325 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,762,561 Number of Sequences: 27288 Number of extensions: 391531 Number of successful extensions: 997 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 957 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 996 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1236675772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB5H02.yg.ab1 (618 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g31770.1 RNA lariat debranching enzyme - like protein / RN... 295 1e-80 >At4g31770.1 RNA lariat debranching enzyme - like protein / RNA lariat debranching enzyme, Caenorhabditis elegans, PID:g1794215; supported by cDNA: gi_13877596_gb_AF370499.1_AF370499 Length = 418 Score = 295 bits (756), Expect = 1e-80 Identities = 137/199 (68%), Positives = 165/199 (82%) Frame = +1 Query: 1 GISGIYKSRDYRSGHFERAPYNNSDIKSIYHVREYDVHKLMQIEEPVDIFLSHDWPLGIT 180 G+SGIY R YRSGHFER PYN S I+S+YHVR+YDV KLMQ+EEP+DIFLSHDWP+GIT Sbjct: 122 GLSGIYNERHYRSGHFERPPYNESTIRSVYHVRDYDVQKLMQLEEPLDIFLSHDWPVGIT 181 Query: 181 DHGNWKKLVRDKPYFEKEIEERSLGSKAAAELLEKLKPPYWFSAHLHCKFAALVQHQDGG 360 D+G+ + L+R KPYF +EIEE++LGSK AA LLEKLKP YWFSAHLHCKFAA VQH + G Sbjct: 182 DYGDSESLMRQKPYFRQEIEEKTLGSKPAALLLEKLKPQYWFSAHLHCKFAAAVQHGNDG 241 Query: 361 QVTKFLALDKCIPRRKFLQIIEVESDPGPYEIEYDEEWLAITRRFNSIFPLTKMPMNFGG 540 VTKFLALDKC+P +KFLQIIE+ES+PGP+E+ YDEEWLAITR+FNSIFPLT+ N Sbjct: 242 SVTKFLALDKCLPGKKFLQIIEIESEPGPFEVLYDEEWLAITRKFNSIFPLTRRYTNV-S 300 Query: 541 VQFEMEECRKWVKSNLKSR 597 ++E R+WV+ L+ R Sbjct: 301 TAGTIQESREWVRKKLEER 319 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,729,119 Number of Sequences: 27288 Number of extensions: 297121 Number of successful extensions: 886 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 886 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 981665960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB5J06.yg.ab1 (655 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g21870.1 putative ATP synthase / ;supported by full-lengt... 257 4e-69 >At2g21870.1 putative ATP synthase / ;supported by full-length cDNA: Ceres:31766. Length = 240 Score = 257 bits (656), Expect = 4e-69 Identities = 131/191 (68%), Positives = 153/191 (79%) Frame = +1 Query: 61 SRILSRSTRQIYNQSILQPHHAVSARFYAKEAVPKGLKGDEMLKGIFFDVKKKFETAIGI 240 SR LSRS + ILQ HA+ R +AKEA KGDEMLKG+FFD+K KF+ A+ I Sbjct: 5 SRFLSRSKQLQGGLVILQQQHAIPVRAFAKEAARPTFKGDEMLKGVFFDIKNKFQAAVDI 64 Query: 241 LRKEKITIDPEDPAAVSQYAKVMKTIREKADLFSESQRIQYTIKTRTDGIQDARSYLLAL 420 LRKEKIT+DPEDPAAV QYA VMKTIR+KAD+FSESQRI++ I T T I DAR+YLL L Sbjct: 65 LRKEKITLDPEDPAAVKQYANVMKTIRQKADMFSESQRIKHDIDTETQDIPDARAYLLKL 124 Query: 421 KEIRLKRGLTDEIGAEGMMMEALEKVEKELKKPLMRNDKKGMALLMTEFEKVNQKLGIRK 600 +EIR +RGLTDE+GAE MM EALEKVEK++KKPL+R+DKKGM LL+ EFEK N+KLGIRK Sbjct: 125 QEIRTRRGLTDELGAEAMMFEALEKVEKDIKKPLLRSDKKGMDLLVAEFEKGNKKLGIRK 184 Query: 601 EKLPKYEEQLE 633 E LPKYEE LE Sbjct: 185 EDLPKYEENLE 195 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.134 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,954,288 Number of Sequences: 27288 Number of extensions: 299704 Number of successful extensions: 1005 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 968 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1004 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1088756792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB5K19.yg.ab1 (592 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g62640.1 3-ketoacyl-acyl carrier protein synthase III (KAS II... 301 2e-82 >At1g62640.1 3-ketoacyl-acyl carrier protein synthase III (KAS III) / identical to 3-ketoacyl-acyl carrier protein synthase III (KAS III) GB:CAA72385 GI:1888359 [Arabidopsis thaliana]; supported by cDNA: gi_598074_gb_L31891.1_ATHKASIII Length = 404 Score = 301 bits (770), Expect = 2e-82 Identities = 141/184 (76%), Positives = 162/184 (87%) Frame = +1 Query: 1 VDTNDEWISARTGIRNRRILTGNESMTGLAVEAAQKALEMAEVKPDDVDLILLCTSTPED 180 VDTNDEWI+ RTGIRNRR+++G +S+ GLAVEAA KALEMAEV P+D+DL+L+CTSTP+D Sbjct: 93 VDTNDEWIATRTGIRNRRVVSGKDSLVGLAVEAATKALEMAEVVPEDIDLVLMCTSTPDD 152 Query: 181 LFGGAPQIQKALGCKGNPLAFDITAACSGFVLGLVSTSCYIRGGGFKNVLVIGADSLSRY 360 LFG APQIQKALGC NPLA+DITAACSGFVLGLVS +C+IRGGGFKNVLVIGADSLSR+ Sbjct: 153 LFGAAPQIQKALGCTKNPLAYDITAACSGFVLGLVSAACHIRGGGFKNVLVIGADSLSRF 212 Query: 361 VDWTDRGTCILFGDGAGAVLVQACDSEEDGLFGFDFHRDGDGNRHLNAGIQESTTNDGLG 540 VDWTDRGTCILFGD AGAV+VQACD E+DGLF FD H DGDG RHLNA ++ES + Sbjct: 213 VDWTDRGTCILFGDAAGAVVVQACDIEDDGLFSFDVHSDGDGRRHLNASVKESQNDGESS 272 Query: 541 TNGS 552 +NGS Sbjct: 273 SNGS 276 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,129,930 Number of Sequences: 27288 Number of extensions: 341734 Number of successful extensions: 1186 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1175 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 913055448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB6D08.yg.ab1 (618 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54750.1 transport protein particle component Bet3p-like prot... 226 6e-60 >At5g54750.1 transport protein particle component Bet3p-like protein / ;supported by full-length cDNA: Ceres:122866. Length = 186 Score = 226 bits (577), Expect = 6e-60 Identities = 110/125 (88%), Positives = 121/125 (96%) Frame = +1 Query: 244 MAPAVPRSGDAIFANVERVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 423 MAP PRSGDAIF++++RVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL Sbjct: 1 MAPVGPRSGDAIFSSIDRVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRL 60 Query: 424 IDEFLAKSNVTRCVDFRETAEVIAKVGFKMFLGVTASVTNWDNEGTCCSLILEDNPLVGF 603 IDEFLAKS V+RCVDF+ETAE+IAKVGFKMFLGVTASVT+WD++GTCCS+ILEDNPLV F Sbjct: 61 IDEFLAKSGVSRCVDFKETAEMIAKVGFKMFLGVTASVTSWDSDGTCCSIILEDNPLVDF 120 Query: 604 VELPD 618 VELPD Sbjct: 121 VELPD 125 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,059,102 Number of Sequences: 27288 Number of extensions: 303694 Number of successful extensions: 1039 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1006 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1039 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 981665960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB6G12.yg.ab1 (195 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g16970.1 expressed protein / ; supported by cDNA: gi_12006... 82 4e-17 >At1g16970.1 expressed protein / ; supported by cDNA: gi_12006423_gb_AF283759.1_AF283759 Length = 621 Score = 82.4 bits (202), Expect = 4e-17 Identities = 36/64 (56%), Positives = 53/64 (82%) Frame = +3 Query: 3 EVTYGGGQIEPPGMHMIYLPYSDDIRPIEELHSDTSGMMPLANDEQIEKATALVKRVDLR 182 E+ GGQ+EPPG++MIYLPY++DIR I+ELHS P A+D+Q++KA+AL++R++L+ Sbjct: 426 EIESDGGQVEPPGINMIYLPYANDIRDIDELHSKPGVAAPRASDDQLKKASALMRRLELK 485 Query: 183 DFSV 194 DFSV Sbjct: 486 DFSV 489 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,484,615 Number of Sequences: 27288 Number of extensions: 77179 Number of successful extensions: 200 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 198 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 200 length of database: 11,516,596 effective HSP length: 40 effective length of database: 10,425,076 effective search space used: 250201824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB6H02.yg.ab1 (620 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26280.1 unknown protein / 247 3e-66 At5g58720.1 putative PRL1 associated protein / ;supported by... 54 5e-08 >At2g26280.1 unknown protein / Length = 567 Score = 247 bits (631), Expect = 3e-66 Identities = 123/165 (74%), Positives = 142/165 (85%) Frame = +2 Query: 5 LMARMRGEARDHARLRNAYFEQARQAYLIGQKALAKELSVKGQLHNIQMKAAHGKAQESI 184 + + +R EARD+ARLRN YFEQARQAYL+G KALAKELSVKGQLHN+QMKAAHGKAQE+I Sbjct: 407 MYSELREEARDYARLRNVYFEQARQAYLVGNKALAKELSVKGQLHNMQMKAAHGKAQEAI 466 Query: 185 YYQRNPVSPEMQGNGRGGQERIIDLHGLHVSEAIHVLKRDLMTWRNIARSADQRVQVYIC 364 Y QRNPV QGN RG ER+IDLHGLHVSEA+ VLK +L R+ AR+ +R+Q+YIC Sbjct: 467 YRQRNPVG---QGNSRGN-ERMIDLHGLHVSEALQVLKHELSVLRSTARATQERLQIYIC 522 Query: 365 VGTGHHTKGTRTPARLPVAVQRYLLEEEGLHYSEPQPGLLRVVLY 499 VGTGHHT+G+RTPARLPVAVQRYLLEEEGL YSEPQ GLLRV++Y Sbjct: 523 VGTGHHTRGSRTPARLPVAVQRYLLEEEGLDYSEPQAGLLRVIIY 567 >At5g58720.1 putative PRL1 associated protein / ;supported by full-length cDNA: Ceres:150336. Length = 519 Score = 54.3 bits (129), Expect = 5e-08 Identities = 49/162 (30%), Positives = 72/162 (44%), Gaps = 2/162 (1%) Frame = +2 Query: 17 MRGEARDHARLRNAYFEQARQAYLIGQKALAKELSVKGQLHNIQMKAAHGKAQESIYYQR 196 +R A D + +Y+++A +AY G +A A LS KG++ + Q + A +A + I+ R Sbjct: 359 LRKGANDQWNVTKSYYQKAAEAYSKGGRAHAAYLSDKGRVASKQAQRADERASQDIFVAR 418 Query: 197 NPVSPEMQGNGRGGQERI--IDLHGLHVSEAIHVLKRDLMTWRNIARSADQRVQVYICVG 370 N G E + IDLHG HV A+ +LK L+ + RV G Sbjct: 419 NK-----------GIENVVTIDLHGQHVKPAMKLLKLHLLFGSYVPSIQTLRV----ITG 463 Query: 371 TGHHTKGTRTPARLPVAVQRYLLEEEGLHYSEPQPGLLRVVL 496 G G + V LLE EG+ Y E G L + L Sbjct: 464 CGASGFGKSKVKQSVVK----LLEREGVRYCEENRGTLLIKL 501 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,702,877 Number of Sequences: 27288 Number of extensions: 335645 Number of successful extensions: 881 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 858 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 878 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 990590196 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB6N10.yg.ab1 (741 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59490.1 putative protein / 228 3e-60 >At3g59490.1 putative protein / Length = 281 Score = 228 bits (580), Expect = 3e-60 Identities = 129/277 (46%), Positives = 174/277 (62%), Gaps = 50/277 (18%) Frame = +2 Query: 5 MEVDISE-VLRVLDFSLSRTNWRLRASSKRRLET-------------------------- 103 MEV SE +L+ L LS+ WRL+++SKRRLE Sbjct: 1 MEVPSSEELLQFLSSCLSQIKWRLKSNSKRRLEIVYALNNSLRNEKLILKFDGALIALFK 60 Query: 104 ------------DILALCTGMRPVIMIDYGGKMPELRERLCSFLKLNKEESSIFENLRVM 247 +LALCTGMRPV+MIDYGGKMPEL+ RL S L+L +E +F++L+VM Sbjct: 61 NPKNKAISCIIKHVLALCTGMRPVVMIDYGGKMPELQNRLLSLLELIREGLPVFKDLKVM 120 Query: 248 VIEDMIYLIHVKAIADFMKSTINKDVKLHFVDLEHDPPKMIPEVETSSIGAQFISLQKLF 427 VIEDMIYLI+V+++ F+ S+++ + +L F+DLE DPPKM+ + + S++G Q S+QKLF Sbjct: 121 VIEDMIYLINVRSLPKFVSSSLDSEPELFFIDLEQDPPKMVTQSKESNLGMQLRSIQKLF 180 Query: 428 SSFF-----STDVIT------NNDVSDFIDLTHFMQDTLITLPTLNGWLLGYPVVYIFGK 574 SS F +TD T ++ S IDL+ +QDT +T+PTLNGWLL YPVVY+FG Sbjct: 181 SSTFPLDDSNTDTTTVLDEANSSQTSLCIDLSCCLQDTKVTIPTLNGWLLDYPVVYLFGT 240 Query: 575 DHIEDAVYNLSXKSLHLFNIFVQRNSSSSKKPSEEEL 685 DHIE+A+YNLS KSL LF + V RN ++ K EEL Sbjct: 241 DHIEEAIYNLSTKSLRLFKVLVCRNGTTEKDSHLEEL 277 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,383,439 Number of Sequences: 27288 Number of extensions: 321970 Number of successful extensions: 869 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1321579340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB7A05.yg.ab1 (684 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11330.1 2,6-dihydroxypyridine 3-hydroxylase (DHPH)-related ... 317 3e-87 >At5g11330.1 2,6-dihydroxypyridine 3-hydroxylase (DHPH)-related / low similarity to 2,6-dihydroxypyridine 3-hydroxylase (DHPH) [GI:14495302] [Arthrobacter nicotinovorans] Length = 408 Score = 317 bits (813), Expect = 3e-87 Identities = 152/221 (68%), Positives = 178/221 (79%) Frame = +2 Query: 20 AGLGLDPLARRIINSWLPQQQSDNLLNNHTLPLTIDQNQATDVEKKISRVLTRDESFNFR 199 AGLGLDP AR+II SWL Q LL+ TLPL+IDQNQ TD EKK++R+LTRDE F+FR Sbjct: 48 AGLGLDPQARQIIKSWLTTPQ---LLDEITLPLSIDQNQTTDSEKKVTRILTRDEDFDFR 104 Query: 200 AAYWSDLHGLLYKALPRDIFLWGHLFLSFHVSDDKKSVKVQCKHLQTGKMIEIVGDLLVA 379 AAYWSD+ LLY ALP+ +FLWGH FLSF +S D+ +VKV+ ++T + +EI GDLL+A Sbjct: 105 AAYWSDIQSLLYNALPQTMFLWGHKFLSFTMSQDESNVKVKTLVVETQETVEIEGDLLIA 164 Query: 380 ADGCMSSIRQTFLPDLKLRYSGYCAWRGVLDLSDDEKSEILVDLKKVYPDLGKCLYFDLG 559 ADGC+SSIR+TFLPD KLRYSGYCAWRGV D S +E SE + +KKVYPDLGKCLYFDLG Sbjct: 165 ADGCLSSIRKTFLPDFKLRYSGYCAWRGVFDFSGNENSETVSGIKKVYPDLGKCLYFDLG 224 Query: 560 NGTHSVFYELLNKGINWIWYVNQPEPQLKGNSVTMKVSNNM 682 THSVFYEL NK +NWIWYVNQPEP LK NSVT+KVS M Sbjct: 225 EQTHSVFYELFNKKLNWIWYVNQPEPDLKSNSVTLKVSQEM 265 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,503,445 Number of Sequences: 27288 Number of extensions: 344691 Number of successful extensions: 963 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 936 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 962 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1165500188 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB7F10.yg.ab1 (362 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56910.1 ribosomal protein, chloroplast / ribosomal protei... 88 9e-19 >At3g56910.1 ribosomal protein, chloroplast / ribosomal protein PsCL18 precursor, chloroplast - Pisum sativum, PIR:R5PM18; supported by cDNA: gi_14596188_gb_AY042882.1_ Length = 148 Score = 87.8 bits (216), Expect = 9e-19 Identities = 44/62 (70%), Positives = 53/62 (84%), Gaps = 3/62 (4%) Frame = +2 Query: 38 SLSVEKLPLESKVQAQ---VDQKLKMKLAKKIRMRRKRLVRKRHLRKKGRWPPSKMKKNK 208 ++ V+KLPLESK + ++ +LKMKLAKKIR+RRKRLVRKR +RKKGRWPPSKMKKNK Sbjct: 87 AVPVDKLPLESKEAKEKLLLELRLKMKLAKKIRLRRKRLVRKRKMRKKGRWPPSKMKKNK 146 Query: 209 NV 214 NV Sbjct: 147 NV 148 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,171,063 Number of Sequences: 27288 Number of extensions: 175189 Number of successful extensions: 1416 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 984 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1296 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 213526752 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB7H12.yg.ab1 (278 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g04039.1 unknown protein / ;supported by full-length cDNA:... 79 3e-16 >At2g04039.1 unknown protein / ;supported by full-length cDNA: Ceres:28779. Length = 199 Score = 79.3 bits (194), Expect = 3e-16 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = +1 Query: 1 GPKGFSISSYGSTASNVEPFLVDEKKVTSKLLVFWVEKRLAAQGIIPVW 147 G KGFSISS+GS S VEPFLVDE+K T+ +VFWVEKRLAAQGIIPVW Sbjct: 149 GAKGFSISSHGSGPSTVEPFLVDERKPTANHVVFWVEKRLAAQGIIPVW 197 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,959,788 Number of Sequences: 27288 Number of extensions: 104609 Number of successful extensions: 280 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 276 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 280 length of database: 11,516,596 effective HSP length: 68 effective length of database: 9,661,012 effective search space used: 231864288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB7L14.yg.ab1 (688 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g03090.1 NDX1 homeobox protein homolog / 102 2e-22 >At4g03090.1 NDX1 homeobox protein homolog / Length = 925 Score = 102 bits (254), Expect = 2e-22 Identities = 83/238 (34%), Positives = 116/238 (47%), Gaps = 30/238 (12%) Frame = +3 Query: 42 ESERDATNIEIIGSYLSNLQLKNRTNNVE----------------------EESFRSL-- 149 ES+ DA+N+E GS S+ + K E E+F Sbjct: 657 ESDADASNLETSGSDTSSNRGKGLVEEGELVQNMSKRFKGSASGEVKEDEKSETFLVFEK 716 Query: 150 QLKKRKRNIMNDVQISMIENALCDEPNMQRRTASVQLWADKLSRHGSEITYSQLKNWLNN 329 Q KKRKR+IMN Q+ MIE AL +EP++QR +AS QLWADK+S+ + LNN Sbjct: 717 QKKKRKRSIMNADQMGMIEKALAEEPDLQRNSASRQLWADKISQ--------KFIIRLNN 768 Query: 330 RKAKVARAAAKNTTTPVDVDGGSVTDHVSDSPESQSPGADEPSSYEGD------PQPQTQ 491 RKAK+ARA N T D S D + +SP ++ +PS+ D P+ Sbjct: 769 RKAKLARA---NKQTGPAHDNNSSGD-LPESPGDENTWQQKPSTPIKDQTVTETPKTGEN 824 Query: 492 QKDVTGGSCFMVQNGQHVVLFDGKGEEIGKGIIHLAKGDWFDTNLQKSGLCVVDVTYL 665 + S ++ GQ V L D +G+EIGKG + G+W +L+ +CVVDV L Sbjct: 825 LMRTSSSSEEGIKQGQQVRLMDERGDEIGKGTVLRTDGEWNGLSLETRQICVVDVMEL 882 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,658,862 Number of Sequences: 27288 Number of extensions: 399671 Number of successful extensions: 1352 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1285 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1346 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1174397136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB7O13.yg.ab1 (733 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47600.1 putative Na+/Ca2+ antiporter / ; supported by cD... 298 3e-82 >At2g47600.1 putative Na+/Ca2+ antiporter / ; supported by cDNA: gi_6492236_gb_AF109178.1_AF109178 Length = 539 Score = 298 bits (764), Expect(2) = 3e-82 Identities = 156/264 (59%), Positives = 183/264 (69%), Gaps = 30/264 (11%) Frame = +2 Query: 2 EVWSPNVITVWEALLTVLQFGMLLVHAYAQDKRWPLVSLPLDRSERPEEWVPAE------ 163 EVWSPNVIT+ EALLTVLQ+G+LLVHAYAQDKRWP +SLP+ R +RPEEWVP E Sbjct: 189 EVWSPNVITLVEALLTVLQYGLLLVHAYAQDKRWPYLSLPMSRGDRPEEWVPEEIDTSKD 248 Query: 164 ----------------------KGIADIFSIHQGNASDSTYQHLPLSDPSDK--HFDIYP 271 + I DIFSIH N H P D Sbjct: 249 DNDNDVHDVYSDAAQDAVESGSRNIVDIFSIHSANNDTGITYHTVADTPPDSATKKGKAK 308 Query: 272 ESDVASTWKHQFVNALMLDSTKLRDTNNRGRVGVGWAKVFWNVIVAPWKLVFAFVPPYQI 451 S V WKHQFV+A+ L++++ + ++ + + AK FW++++APWKL+FAFVPP I Sbjct: 309 NSTVFDIWKHQFVDAITLETSESKKVDS---IYLRIAKSFWHLLLAPWKLLFAFVPPCNI 365 Query: 452 AHGWIAFICSLIFISGIAYIVTRLTDLISCVTGINSYVIAFTALAGGTSWPDLVASKIAA 631 AHGWIAFICSL+FISG+A++VTR TDLISCVTGIN YVIAFTALA GTSWPDLVASKIAA Sbjct: 366 AHGWIAFICSLLFISGVAFVVTRFTDLISCVTGINPYVIAFTALASGTSWPDLVASKIAA 425 Query: 632 ERQTTADSAIANITCSNSVNIYVG 703 ERQ TADSAIANITCSNSVNIYVG Sbjct: 426 ERQLTADSAIANITCSNSVNIYVG 449 Score = 24.6 bits (52), Expect(2) = 3e-82 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +3 Query: 702 GIGVPWLIDT 731 GIGVPWLI+T Sbjct: 449 GIGVPWLINT 458 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,402,501 Number of Sequences: 27288 Number of extensions: 448334 Number of successful extensions: 1506 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1501 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1294970360 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB7O19.yg.ab1 (731 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g35790.1 expressed protein / ; supported by cDNA: gi_14596... 273 5e-74 >At2g35790.1 expressed protein / ; supported by cDNA: gi_14596214_gb_AY042895.1_ Length = 238 Score = 273 bits (699), Expect = 5e-74 Identities = 141/223 (63%), Positives = 169/223 (75%) Frame = +3 Query: 63 MARSILLQLVRSQTRHHLSSSKIHTGFHPHRLATWQIQKSQTTTPHFNPMNHLPFTQTRF 242 M RS L+ L+RSQ+R LSSS +G+H HR S F + + F Sbjct: 1 MGRSALIHLLRSQSRR-LSSSTFTSGYH-HRSIAGSWSSSVNPKVRFQVPSLSQRSWASF 58 Query: 243 ASQSTTIEDNNKITIGPKKGIESEKQEKDSGVIYYGPISSTIKKVKLLSLSTCCLSVSLG 422 +++ +D +KI+IGP++ +K+EKD GV+YYGPISSTIKKVKLLSLSTCCLSVSLG Sbjct: 59 GAKTREDDDEHKISIGPQE----KKEEKDGGVVYYGPISSTIKKVKLLSLSTCCLSVSLG 114 Query: 423 PVITFMTSPDMNVIIKGAVASSVIFLSASTTLALHWFVSPYIHKLRWQPGSDTFEVDMMT 602 PVITFMTSP +NVI+KGAVAS+VIFLSASTT ALHWFVSPY+HKLRWQPGSDTFEV+MMT Sbjct: 115 PVITFMTSPGLNVIMKGAVASTVIFLSASTTAALHWFVSPYVHKLRWQPGSDTFEVEMMT 174 Query: 603 WLASFVTXTIKFSDIRIAETNRPYVTFKANGEFYFVDADHCHN 731 WL +F T+KFSDIR +T RPYV+FKA+G FYFVDADHC N Sbjct: 175 WLGTFSAKTLKFSDIRYPDTQRPYVSFKADGNFYFVDADHCPN 217 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,504,735 Number of Sequences: 27288 Number of extensions: 371133 Number of successful extensions: 1237 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1175 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1234 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1294970360 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB8A04.yg.ab1 (604 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13750.1 hypothetical protein / 125 1e-29 >At4g13750.1 hypothetical protein / Length = 2137 Score = 125 bits (315), Expect = 1e-29 Identities = 61/120 (50%), Positives = 87/120 (71%), Gaps = 1/120 (0%) Frame = +1 Query: 10 SGRTGEDVAYKYFSGKFG-EKNVRWVNEVNESGLPYDILVVGEDNKKKEYIEVKSTSSVR 186 +GR GE++AY+YF K+G E V+WVN+ +E+GLPYD+++ KK EY+EVK+T S R Sbjct: 2012 TGRKGEEIAYRYFVAKYGNEALVKWVNDQSETGLPYDLMIENRGGKK-EYVEVKATVSTR 2070 Query: 187 KDWFEITVREWQFGVEKGDDFSIARVVLSDGKLVQITIYKNPVKLCQERQLKLALLSGRQ 366 KD+F +TVREWQF EKG+ + IA V+L + + +T ++NPVKLCQE L+L +L Q Sbjct: 2071 KDYFNLTVREWQFANEKGESYIIAHVLLGNSNAI-LTQHRNPVKLCQEGHLRLLVLMPNQ 2129 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,557,847 Number of Sequences: 27288 Number of extensions: 298294 Number of successful extensions: 709 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 705 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 948861544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB8A18.yg.ab1 (728 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g16790.1 putative gluconokinase / ;supported by full-leng... 124 5e-29 >At2g16790.1 putative gluconokinase / ;supported by full-length cDNA: Ceres:19417. Length = 189 Score = 124 bits (311), Expect = 5e-29 Identities = 61/121 (50%), Positives = 86/121 (70%) Frame = +1 Query: 250 AKKFKPGMAVVLMGVSGVGKSTIGELLAKTLNYSFIDADNFHPQSNKEKMKNRIPLSDED 429 AK G + +MGVSG GKSTIG++L K L+ F+DAD+FH SN++KM+ I LSDED Sbjct: 3 AKNDVTGKVIAIMGVSGAGKSTIGKMLGKALSCDFLDADDFHSLSNRDKMRQGIALSDED 62 Query: 430 RIPWLEVLRDLLNASLVSGKIVILGCSALQKKYRDILRYADPNFKSDYSCEKCVVKFGLL 609 R+PWLE +++ L L+ G+ V+L CS+L+K+YR+ILR +DP++K S C V F LL Sbjct: 63 RMPWLEKIQESLRKRLLDGETVVLACSSLRKQYREILRGSDPDYKPG-SYTSCKVTFVLL 121 Query: 610 D 612 + Sbjct: 122 E 122 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,685,684 Number of Sequences: 27288 Number of extensions: 386011 Number of successful extensions: 1421 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1421 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1286100700 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB8E01.yg.ab1 (433 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02410.1 hypothetical protein / contains similarity to cyt... 174 2e-44 >At1g02410.1 hypothetical protein / contains similarity to cytochrome c oxidase assembly protein cox11 GI:1244782 from [Saccharomyces cerevisiae] Length = 287 Score = 174 bits (440), Expect = 2e-44 Identities = 81/89 (91%), Positives = 86/89 (96%) Frame = +2 Query: 2 ESALAFYTAENCSSTPITGMSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFY 181 ESALAFYTAEN SS PITG+STYNVTPMKA VYFNKIQCFCFEEQRLLPGEQIDMPVFFY Sbjct: 181 ESALAFYTAENKSSAPITGVSTYNVTPMKAGVYFNKIQCFCFEEQRLLPGEQIDMPVFFY 240 Query: 182 IDPEFETDPRMDGINNIILSYTFFKIAED 268 IDPEFETDPRMDGINN+ILSYTFFK++E+ Sbjct: 241 IDPEFETDPRMDGINNLILSYTFFKVSEE 269 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,006,669 Number of Sequences: 27288 Number of extensions: 184259 Number of successful extensions: 501 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 501 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 480215828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB8J08.yg.ab1 (736 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63000.1 putative protein / contains similarity to unknown... 166 9e-42 >At5g63000.1 putative protein / contains similarity to unknown protein (dbj|BAA89593.1) Length = 201 Score = 166 bits (421), Expect = 9e-42 Identities = 80/111 (72%), Positives = 96/111 (86%) Frame = +1 Query: 403 MEVHEEPQESVHRKTPKLPGTVNWGTATIVGVFAGMLYGGSKEASASVSKDAEVTLKLGS 582 ME E+P+E++ + +L G NWGTAT+VGVFAG+LYGGSKEASASVSKDAEV LK+GS Sbjct: 1 MEAVEKPEETIPGNSSRLAGNPNWGTATVVGVFAGLLYGGSKEASASVSKDAEVMLKMGS 60 Query: 583 TSDKREQYRLMRDAMEKRFIRITRGSIVGGVRLGMVTAAFYGLQNLLAEKR 735 T DKREQ+RLMRDAMEKRFIR+TRGS++GG+RLGM TA+F+ LQN LAE R Sbjct: 61 TQDKREQHRLMRDAMEKRFIRVTRGSLIGGMRLGMFTASFFSLQNFLAETR 111 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,827,947 Number of Sequences: 27288 Number of extensions: 431419 Number of successful extensions: 1406 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1405 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB9B16.yg.ab1 (436 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g44820.1 hypothetical protein / predicted by genefinder; s... 67 3e-12 >At2g44820.1 hypothetical protein / predicted by genefinder; supported by cDNA: gi_19310390 Length = 194 Score = 67.4 bits (163), Expect = 3e-12 Identities = 48/98 (48%), Positives = 62/98 (62%), Gaps = 9/98 (9%) Frame = +2 Query: 20 GKRGSRSKRESE-SRKPEDRVLMSTAGRFMNGILDVKDLLKTG-APSRDRGF---SGSRG 184 G GS S++ +E R PE+RVL ST G F G+LDVK LL++G + S DR F SR Sbjct: 96 GGGGSSSRKPAERKRTPEERVLKSTGGIFKGGVLDVKHLLRSGPSSSSDRDFKTKKPSRV 155 Query: 185 TGSL-GLGDGGGNNNKGGGGGGKKKH-GKK--GGRRKG 286 +L G GDGGG +KG GGK K+ GKK GG+++G Sbjct: 156 EKNLGGGGDGGGIKSKGKKKGGKNKNKGKKKGGGKKRG 193 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,865,457 Number of Sequences: 27288 Number of extensions: 319928 Number of successful extensions: 12101 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6887 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 489276504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB9J06.yg.ab1 (310 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g47650.1 putative protein / bundle sheath defective protei... 104 1e-23 >At3g47650.1 putative protein / bundle sheath defective protein 2 - Zea mays, EMBL:AF126742; supported by cDNA: gi_13877966_gb_AF370246.1_AF370246 Length = 136 Score = 104 bits (259), Expect = 1e-23 Identities = 42/58 (72%), Positives = 48/58 (82%) Frame = +1 Query: 4 GCIQCKQCKGNGVNSEDHFGGRFKAGGLCWLCRGKKEILCGGCNGAGFRGGFMSSSDD 177 GC+ C QCKG GVN DHF G+FKAG LCWLCRGKKE+LCG CNGAGF GGF+S+ D+ Sbjct: 79 GCVACSQCKGGGVNLIDHFNGQFKAGALCWLCRGKKEVLCGDCNGAGFIGGFLSTFDE 136 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,952,392 Number of Sequences: 27288 Number of extensions: 194759 Number of successful extensions: 988 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 773 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 962 length of database: 11,516,596 effective HSP length: 78 effective length of database: 9,388,132 effective search space used: 225315168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGB9M13.yg.ab1 (649 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13570.1 unknown protein / 240 4e-64 >At5g13570.1 unknown protein / Length = 359 Score = 240 bits (613), Expect = 4e-64 Identities = 113/177 (63%), Positives = 137/177 (76%) Frame = +2 Query: 20 GQLXLDQTYERCVLVKGWKGTSWSFPRGKKNKDEEDDACAIREVLEETGFNVSKLINKDE 199 G + LD+TYERC+LVKGWKG+SWSFPRGKK+KDEED ACAIREVLEETGF+VSKL+ ++E Sbjct: 98 GAIILDETYERCLLVKGWKGSSWSFPRGKKSKDEEDHACAIREVLEETGFDVSKLLKREE 157 Query: 200 FIEMTFGPQRVRLYIVGGVKDDTTFAPQTKKEISEIAWQRLDELQPANRDVISRSVAGLK 379 +IE F QRVRLYIV GV +DT FAP TKKEISEI W RLD LQPA+ +VI+ V+GLK Sbjct: 158 YIEFVFRQQRVRLYIVAGVTEDTVFAPLTKKEISEITWHRLDHLQPASNEVITHGVSGLK 217 Query: 380 LYMVAPFLKSLRSWISSHQPPIAPKPDTPARAMSVWKARGSSSGANLVMTETPSNNN 550 LYMVAPFL SL+SWI H P+A +P+ P +A+ VW AR S G E+ + + Sbjct: 218 LYMVAPFLSSLKSWILKHPSPVARRPNKPLKALCVWNARTSVGGNGTATVESQNRKS 274 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,582,611 Number of Sequences: 27288 Number of extensions: 369661 Number of successful extensions: 1198 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1191 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1070908320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC10A22.yg.ab1 (300 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48440.1 putative protein / similar to unknown protein (sp... 77 1e-15 >At5g48440.1 putative protein / similar to unknown protein (sp|P33642) Length = 459 Score = 77.4 bits (189), Expect = 1e-15 Identities = 35/53 (66%), Positives = 44/53 (82%) Frame = +2 Query: 2 GKPMIGPVPGLSNVFLAAGHEGEGLTLALGTAEMVADMVLGNPSKVDNAPYAL 160 GKP+IG VPGL N++LAAGHEG GL++AL TAEMV DMVLG PS+VD + + + Sbjct: 401 GKPVIGSVPGLQNMYLAAGHEGGGLSMALATAEMVTDMVLGKPSQVDTSTFGV 453 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,253,451 Number of Sequences: 27288 Number of extensions: 116860 Number of successful extensions: 277 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 277 length of database: 11,516,596 effective HSP length: 75 effective length of database: 9,469,996 effective search space used: 227279904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC10B14.yg.ab1 (735 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15530.1 pyruvate,orthophosphate dikinase / 404 e-113 >At4g15530.1 pyruvate,orthophosphate dikinase / Length = 960 Score = 404 bits (1037), Expect = e-113 Identities = 200/261 (76%), Positives = 222/261 (84%), Gaps = 16/261 (6%) Frame = +1 Query: 1 GQVVFSAEDAETWHAQGKNAILVRTETSPEDVGGMHAAAGILTARGGMTSHAAVVARGWG 180 GQVVF+AE+AE WH+QGK ILVRTETSP+DVGGMHAA GILTARGGMTSHAAVVARGWG Sbjct: 476 GQVVFTAEEAEAWHSQGKTVILVRTETSPDDVGGMHAAEGILTARGGMTSHAAVVARGWG 535 Query: 181 KCCVSGCADIRVNDDMKVLLIGDKVIKEGEWISLNGSTGEVIMGKQPLAPPAMSSDLETF 360 KCC++GC++IRV+++ KVLLIGD I EGEWIS+NGSTGEVI+GKQ LAPPA+S DLETF Sbjct: 536 KCCIAGCSEIRVDENHKVLLIGDLTINEGEWISMNGSTGEVILGKQALAPPALSPDLETF 595 Query: 361 MAWADQVRRLKVMANADTPNDALTARNNGAQGIGLCRTEHM----------------FFA 492 M+WAD +RRLKVMANADTP DA+ AR NGAQGIGLCRTEHM FF Sbjct: 596 MSWADAIRRLKVMANADTPEDAIAARKNGAQGIGLCRTEHMIVCIQMFNVVFGLVFKFFG 655 Query: 493 SDERIKAVRKMIMAVTVEQRKTALDLLLPYQRSDFEGIFRAMDGLPVTIRLLDPPLHEFL 672 +D RIKAVRKMIMAVT EQRK +LD+LLPYQRSDFEGIFRAMDGLPVTIRLLDPPLHEFL Sbjct: 656 AD-RIKAVRKMIMAVTTEQRKASLDILLPYQRSDFEGIFRAMDGLPVTIRLLDPPLHEFL 714 Query: 673 PEGDLQQIVSELTEDTGMTED 735 PEGDL IV EL E+TG+ ED Sbjct: 715 PEGDLDNIVHELAEETGVKED 735 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,770,305 Number of Sequences: 27288 Number of extensions: 430289 Number of successful extensions: 1402 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1397 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC10E09.yg.ab1 (773 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g29960.1 expressed protein / ;supported by full-length cD... 209 1e-54 >At4g29960.1 expressed protein / ;supported by full-length cDNA: Ceres:117732. Length = 291 Score = 209 bits (532), Expect = 1e-54 Identities = 125/224 (55%), Positives = 144/224 (63%), Gaps = 9/224 (4%) Frame = -3 Query: 663 MAEETETPTITTASGSEKHLNPSSNSSQSDP--KQLPPYPFYGFTA-PNGEHPMFPIMYP 493 M EE E S S H PS + D K P GF A PNG+ PM+P+ YP Sbjct: 1 MTEEPEK-----VSSSVLH-QPSGDKKPEDVGIKPQDPASSSGFRAYPNGDSPMYPVFYP 54 Query: 492 MLVP---PQQGQDQMDHGAGIYAVPTFPNSFMGPVAGIPTNTLIPFTYNIPTGQSPTEGG 322 LVP P Q ++QM+ GAGIYAVP + F G VAG+P+N LIP TYN+PT + E Sbjct: 55 GLVPGSNPVQYEEQMNRGAGIYAVPV--HQFGGHVAGLPSNYLIPLTYNVPTTRPNNEAE 112 Query: 321 TGGEEVGQVGQ--QQQGAGQQRQVVVRRFQIAIHLDLMLILKLAAVIFLFNQDGSRKRLV 148 TGGE Q GQ QQQ QR VV RRFQIA LDL LILKLAAVIFLFNQDGSR+RL Sbjct: 113 TGGENQAQAGQGQQQQLPANQRHVVERRFQIAFQLDLFLILKLAAVIFLFNQDGSRQRLA 172 Query: 147 LLIFFASLIYLYQTGALAPLIRWLSQGMQRAGAPP-QQGRPGYR 19 +L+ FA++IYLYQTGALAP +RWLSQGM RA PP + RP R Sbjct: 173 VLVIFATIIYLYQTGALAPFVRWLSQGMHRAAVPPARPHRPAVR 216 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,721,073 Number of Sequences: 27288 Number of extensions: 489431 Number of successful extensions: 2417 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2375 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1419145600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC10F03.yg.ab1 (746 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g24706.1 F5A9.21 / unknown protein; similar to ESTs gb R64... 162 2e-40 At1g20920.1 DEAD/DEAH box RNA helicase, putative / Contains D... 58 6e-09 At1g44910.1 hypothetical protein / predicted by genemark.hmm 56 2e-08 At2g18540.1 putative vicilin storage protein (globulin-like) / 54 1e-07 At5g57370.1 expressed protein / ; supported by full-length c... 48 6e-06 >At1g24706.1 F5A9.21 / unknown protein; similar to ESTs gb R64797.1, dbj|AV539937.1 Length = 1705 Score = 162 bits (409), Expect = 2e-40 Identities = 107/255 (41%), Positives = 149/255 (57%), Gaps = 39/255 (15%) Frame = +2 Query: 83 ERFVDREYHSRERERERERERFDRSE----DAIEKSRDRSMERYSRERSV---------- 220 +R D+ Y ++R+ RER DRS+ D +EK+RD+S+ER+ RERSV Sbjct: 1388 DRSKDKGYERQDRDH---RERVDRSDKPRGDDVEKARDKSLERHGRERSVEKGLDKGTTR 1444 Query: 221 ------DRSNKDERSKLRYNDI*V---HADDRVRGTSLPPPPPFPPQHHVLLQSVTTTNK 373 D NKD+RSKLR+++ + H DD LPPPPP PP +++ S+ Sbjct: 1445 SYDRNKDERNKDDRSKLRHSEASLEKSHPDDHFHSQGLPPPPPLPP--NIIPHSMAAK-- 1500 Query: 374 KDEDGDRRFGTTPRHSHSHSQRLSPKHDDRERRRSEENVFVSQDD-KRRREEDIRDKKRD 550 ED +RR G HSQRLSP+H++RE+RRSEEN+ VS DD KRRR++DIRD+KRD Sbjct: 1501 --EDLERRAGGA-----RHSQRLSPRHEEREKRRSEENLSVSVDDAKRRRDDDIRDRKRD 1553 Query: 551 EREKI------------EDGDREKGNVMKEEVDPNASKRRKLKRDHQ---SEGSEYSPVS 685 +RE I + +REK +KE+ + ASKRRKLKR+ Q +E EYSP+ Sbjct: 1554 DRETITVKGEEREREREREREREKSLPLKEDFE--ASKRRKLKREQQVPSAEPGEYSPMP 1611 Query: 686 AAPXLNMNMAPAPYD 730 L+ +M P+ Y+ Sbjct: 1612 HHSSLSTSMGPSSYE 1626 >At1g20920.1 DEAD/DEAH box RNA helicase, putative / Contains DEAD-box subfamily ATP-dependent helicases protein motif Length = 1166 Score = 57.8 bits (138), Expect = 6e-09 Identities = 47/221 (21%), Positives = 103/221 (46%), Gaps = 9/221 (4%) Frame = +2 Query: 2 RALEKEKHHPLPPLDYDKVTGKPLAKDERFVDREYHSRERERERERERFDRSEDAIEKSR 181 R EKE+ H ++++ GK +D +R+ RERE++RER +R E E+ + Sbjct: 115 RVNEKERGH----REHERDRGKDRKRDREREERKDKEREREKDRERREREREEREKERVK 170 Query: 182 DRSM------ERYSRERSVDRSNKDERSKLRYNDI-*VHADDRVRGTSLPPPPPFPPQHH 340 +R ER RER +R ++ R + R ++ +DD V+ Sbjct: 171 ERERREREDGERDRREREKERGSRRNRERERSREVGNEESDDDVK-------------RD 217 Query: 341 VLLQSVTTTNKKDEDGDRRFGTTPRHSHSHSQRLSPKHDDRERRRSEENVFVSQDDKRRR 520 + + +K+++ ++ G + RH S ++ + +++ +++ E +D++++ Sbjct: 218 LKRRRKEGGERKEKEREKSVGRSSRHEDSPKRKSVEDNGEKKEKKTREEEL--EDEQKKL 275 Query: 521 EEDIRDKKR--DEREKIEDGDREKGNVMKEEVDPNASKRRK 637 +E++ ++R E ++++ E + K + D N K K Sbjct: 276 DEEVEKRRRRVQEWQELKRKKEEAESESKGDADGNEPKAGK 316 Score = 54.7 bits (130), Expect = 5e-08 Identities = 53/217 (24%), Positives = 91/217 (41%), Gaps = 5/217 (2%) Frame = +2 Query: 41 LDYDKVTGKPLAKDERFVDREYHSRERERERERERFDRSEDAIEKSRDRSMERYS-RERS 217 ++ K + L E D + R+R+R ER++ SE EK R + + S E Sbjct: 3 VEKSKYRSEDLDVVEEEADLKKSRRDRDRSNERKKDKGSEKRREKDRRKKRVKSSDSEDD 62 Query: 218 VDRSNKDERSKLRYNDI*VHA--DDRVRGTSLPPPPPFPPQHHVLLQSVTTTNKKDEDGD 391 DR + +ER K + + DRV+ S + S ++DE Sbjct: 63 YDRDDDEEREKRKEKERERRRRDKDRVKRRS---------ERRKSSDSEDDVEEEDERDK 113 Query: 392 RRFGTTPRHSHSHSQ-RLSPKHDDRERRRSEENVFVSQDDKRRREEDIRDKKRDEREKIE 568 RR R H + R + DRER ++ + D+ RRE + +++++ ++ E Sbjct: 114 RRVNEKERGHREHERDRGKDRKRDREREERKDKEREREKDRERREREREEREKERVKERE 173 Query: 569 DGDREKGNVMKEEVDPNASKRRKLKRDHQSE-GSEYS 676 +RE G + E + RR +R+ E G+E S Sbjct: 174 RREREDGERDRREREKERGSRRNRERERSREVGNEES 210 >At1g44910.1 hypothetical protein / predicted by genemark.hmm Length = 946 Score = 56.2 bits (134), Expect = 2e-08 Identities = 42/163 (25%), Positives = 74/163 (44%), Gaps = 8/163 (4%) Frame = +2 Query: 113 RERERERERERFDRSEDAIEKSRDRSMERYSRERSVDRSNKDERSKLRYNDI*V------ 274 +ER+R+ E+ R ++ D EK +D+ ER +ER ++ ERSK +D Sbjct: 797 KERKRDEEKVRKEKERDEKEKRKDKDKERREKEREREKEKGKERSKREESDGETAMDVSE 856 Query: 275 -HADDRVRGTSLPPPPPFPPQHHVLLQSVTTTNKKDEDGDRRFGTTPRHSHSHSQRLSPK 451 H D++ +G +HH N DED ++ R S++ S K Sbjct: 857 GHKDEKRKGKD--RDRKHRRRHH---------NNSDED-----VSSDRDDRDESKKSSRK 900 Query: 452 H-DDRERRRSEENVFVSQDDKRRREEDIRDKKRDEREKIEDGD 577 H +DR++ R N S+ + R + + +R +++EDG+ Sbjct: 901 HGNDRKKSRKHANSPESESENRHKRQKKESSRRSGNDELEDGE 943 >At2g18540.1 putative vicilin storage protein (globulin-like) / Length = 699 Score = 53.5 bits (127), Expect = 1e-07 Identities = 47/208 (22%), Positives = 91/208 (43%), Gaps = 8/208 (3%) Frame = +2 Query: 95 DREYHSRERERERERERFDRSEDAIEKSRDRSMERYSRERS-VDRSNKDERS-KLRYNDI 268 + E RE E E+ R+R + E E ++ R ER +ER V+R ++E+ K R + Sbjct: 495 EEERKKREEEAEQARKREEEREKEEEMAKKREEERQRKEREEVERKRREEQERKRREEEA 554 Query: 269 *VHADDRVRGTSLPPPPPFPPQHHVL------LQSVTTTNKKDEDGDRRFGTTPRHSHSH 430 ++R R + Q ++ +++E RR + Sbjct: 555 RKREEERKREEEMAKRREQERQRKEREEVERKIREEQERKREEEMAKRREQERQKKEREE 614 Query: 431 SQRLSPKHDDRERRRSEENVFVSQDDKRRREEDIRDKKRDEREKIEDGDREKGNVMKEEV 610 +R K ++ R+R EE + +++++R+E + ++KR E E + RE+ +EE Sbjct: 615 MER--KKREEEARKREEEMAKIREEERQRKEREDVERKRREEEAMR---REEERKREEEA 669 Query: 611 DPNASKRRKLKRDHQSEGSEYSPVSAAP 694 A + R+ K++ + E + P P Sbjct: 670 AKRAEEERR-KKEEEEEKRRWPPQPKPP 696 >At5g57370.1 expressed protein / ; supported by full-length cDNA: Ceres: 31894. Length = 219 Score = 47.8 bits (112), Expect = 6e-06 Identities = 50/193 (25%), Positives = 81/193 (41%), Gaps = 1/193 (0%) Frame = +2 Query: 95 DREYHSRERERERERER-FDRSEDAIEKSRDRSMERYSRERSVDRSNKDERSKLRYNDI* 271 +R+ RER+++RE +R R D ++ RDR ER RER DR ++++S+ R Sbjct: 3 ERDRRERERDKDREPDRDRRRGRDDRDRDRDRDRER-DRERDRDRGLRNKKSRSR----- 56 Query: 272 VHADDRVRGTSLPPPPPFPPQHHVLLQSVTTTNKKDEDGDRRFGTTPRHSHSHSQRLSPK 451 D R + P + +S + + +D D DR+ H +R SP Sbjct: 57 -TPDHHARARHVRSPERY--------RSRSRSIDRDRDRDRQ---------RHHRRRSPS 98 Query: 452 HDDRERRRSEENVFVSQDDKRRREEDIRDKKRDEREKIEDGDREKGNVMKEEVDPNASKR 631 D R KR R+ + D+K +R + V+ + VD NAS Sbjct: 99 PDAPSR-------------KRPRQGSVDDEK----------ERNRKRVVTDSVDENASTI 135 Query: 632 RKLKRDHQSEGSE 670 K K S+ ++ Sbjct: 136 TKKKDKQPSDAAD 148 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,946,155 Number of Sequences: 27288 Number of extensions: 458840 Number of successful extensions: 5819 Number of sequences better than 1.0e-05: 10 Number of HSP's better than 0.0 without gapping: 3125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4712 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1339318660 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC10H01.yg.ab1 (703 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g38240.1 glycosyltransferase like protein / alpha-1,3-mann... 295 2e-80 >At4g38240.1 glycosyltransferase like protein / alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (EC 2.4.1.101) I - rat,PIR2:JC2076 Length = 457 Score = 295 bits (755), Expect = 2e-80 Identities = 153/271 (56%), Positives = 190/271 (69%), Gaps = 41/271 (15%) Frame = +3 Query: 9 AGALETAVEAENHCRNQMRLLIDQISMNQENIVVLEEKVKRQEQECEHLRAVVQDLEKKG 188 A L +A+E+ENHC +QMR LID++S+ Q IV LE+ RQ++E L+ ++Q E Sbjct: 34 ADRLSSAIESENHCTSQMRGLIDEVSIKQSRIVALEDMKNRQDEELVQLKDLIQTFESAL 93 Query: 189 VRSLTREEQAPVAAVVIMACNRADYLERTIKSILKYHSLVASKFPIFVSQDGSNSDVRAK 368 + + PVAAVV+MAC+RADYLERT+KS+L Y + VASK+P+F+SQDGS+ V++K Sbjct: 94 LSPM------PVAAVVVMACSRADYLERTVKSVLTYQTPVASKYPLFISQDGSDQAVKSK 147 Query: 369 ALSYDQLTYMQ------------HLDYEPVRTERPGELIAYYKIAR-------------- 470 +LSY+QLTYMQ HLD+EPV TERPGEL AYYKIAR Sbjct: 148 SLSYNQLTYMQINEDEGSFSPFQHLDFEPVVTERPGELTAYYKIARKDWFLFSLRPSSSI 207 Query: 471 --------HYKWAMDQLFYKHKFNRVIILE-------DDMEIAPDFFDYFEAGAGLLDKD 605 HYKWA+DQLFYKHKF+RVIILE DDMEIAPDFFDYFEA A L+D+D Sbjct: 208 TETLFNTGHYKWALDQLFYKHKFSRVIILEGYLVSLTDDMEIAPDFFDYFEAAASLMDRD 267 Query: 606 KSIMAISSWNDNGQRQFVHDPYMVYRADFFP 698 K+IMA SSWNDNGQ+QFVHDPY +YR+DFFP Sbjct: 268 KTIMAASSWNDNGQKQFVHDPYALYRSDFFP 298 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,232,040 Number of Sequences: 27288 Number of extensions: 327525 Number of successful extensions: 950 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 945 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1218881876 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC11C02.yg.ab1 (463 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79150.1 unknown protein / 177 2e-45 >At1g79150.1 unknown protein / Length = 495 Score = 177 bits (450), Expect = 2e-45 Identities = 89/146 (60%), Positives = 112/146 (75%) Frame = +2 Query: 26 DPEGNIKSLTEMLQLCKDGDPAISILGLKSLLAVFKDIIPGNRIRLPTDKELAMVVSKDV 205 DPE NIK+L +ML +CKD + I L L SLLAVFKDIIPG RIRLPT+KEL M +SK+V Sbjct: 204 DPEANIKTLKDMLDICKDQNTKIVKLALLSLLAVFKDIIPGYRIRLPTEKELEMKISKEV 263 Query: 206 KKTRFYESTLLTVYKAYLQKLMGLEKVAGFKRVAIRCICTLLEANPRFNFCESSLGIVMN 385 KKTRFYESTLL YK+YLQKL+ EK + + ++A RC+CTLLEA P FN+ ++ L V+ Sbjct: 264 KKTRFYESTLLKAYKSYLQKLIIFEKQSVYNQIANRCLCTLLEAVPHFNYRDNLLIAVVR 323 Query: 386 NISSTDDVIRKLCCHIIKSLFTTRGK 463 NISS D+V+R+LCC I+ LF+ GK Sbjct: 324 NISSPDEVVRRLCCSTIRYLFSNEGK 349 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,290,176 Number of Sequences: 27288 Number of extensions: 210339 Number of successful extensions: 513 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 560070056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC11C09.yg.ab1 (544 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27400.1 putative protein / hypothetical proteins - differ... 128 2e-30 >At5g27400.1 putative protein / hypothetical proteins - different species Length = 369 Score = 128 bits (321), Expect = 2e-30 Identities = 64/142 (45%), Positives = 93/142 (65%), Gaps = 1/142 (0%) Frame = +3 Query: 120 WLYLLSAFLSMEPSDSIISISRDCGGGAITESVQNFVWEHCISRVDKKAHAPYIRSFLKK 299 +L +LSAFL++EP DS+I+++R C GG+ITE+ Q F WE C+ + Y + LKK Sbjct: 11 YLNVLSAFLAIEPVDSVITLARGCTGGSITENAQRFFWEICVEAA-ANGNGSYAKKLLKK 69 Query: 300 LILEIESDGAVAVDELYQELAFYMASLKGDNF-KGDSRIVRKISFLYPSDHAEARICQNP 476 LI E+E + +DE+Y+E A YM + K D K + RI + ISFL+P + C Sbjct: 70 LINEVELENGEVLDEVYEEYALYMLTSKEDILVKENIRITKFISFLFPEGSYKHPSCPRS 129 Query: 477 KKVIVPLNCSLNMLERDTGCSL 542 +K+++PL+CSLNMLE DTGCS+ Sbjct: 130 RKLVIPLHCSLNMLEGDTGCSI 151 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,752,583 Number of Sequences: 27288 Number of extensions: 246138 Number of successful extensions: 692 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 781156644 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC11D07.yg.ab1 (554 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27530.1 expressed protein / similar to hypothetical prote... 215 1e-56 >At3g27530.1 expressed protein / similar to hypothetical protein GB:CAA07228 from [Cicer arietinum]; supported by cDNA: gi_15810206_gb_AY056118.1_ Length = 914 Score = 215 bits (548), Expect = 1e-56 Identities = 109/184 (59%), Positives = 141/184 (76%), Gaps = 1/184 (0%) Frame = +3 Query: 6 VLGECAIYNKSNEPGKDAFAIVDAIGQKVGLTSYFLKLDEMQKSFLFS-SAKPAQQRKPL 182 +LGEC IYNKS E GKDAF++VDA+GQK+GLTSYF K +EMQ SF+FS S KP Q KPL Sbjct: 574 LLGECVIYNKSIENGKDAFSVVDAVGQKMGLTSYFSKFEEMQNSFIFSPSKKPPQGYKPL 633 Query: 183 TRSNANSMAEMEDIEENETNDINRNDDHPMLSSMFDSQFVDFIKKLEGEIRDNIVKIYSH 362 TR+ S AE+ +++E + + N+DHPML S+FD+ F+ +K LEG IR+ IV +YS Sbjct: 634 TRTPTPSEAEINEVDEVDEM-VKGNEDHPMLLSLFDASFIGLVKSLEGNIRERIVDVYSR 692 Query: 363 PKSNVSVVPAELEQKKDEKDGDYIKRLKAFVEKQCSEIQDLLNRNSTLAEELASTGGGGE 542 PKS V+VVPA+LEQK E + DYI RLKAF+EKQCSEIQ+LL RN+ LAE++AS+G + Sbjct: 693 PKSEVAVVPADLEQKSGENEKDYINRLKAFIEKQCSEIQNLLARNAALAEDVASSGRNEQ 752 Query: 543 SRCS 554 S+ S Sbjct: 753 SQGS 756 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,059,846 Number of Sequences: 27288 Number of extensions: 258636 Number of successful extensions: 1082 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1011 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1079 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 817071892 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC11D19.yg.ab1 (508 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g19560.1 unknown protein / 116 6e-27 >At2g19560.1 unknown protein / Length = 244 Score = 116 bits (291), Expect = 6e-27 Identities = 54/84 (64%), Positives = 73/84 (86%) Frame = +2 Query: 257 SYMSMGDAHRRITEYLNRFADVVSYQDGTSLKQLLSLSSESPSFLALADALNLFQDANRL 436 +Y+SMG+AHRRITEYLNRF D VSYQD ++L +LLS SS SP L+LADALN+FQD++ L Sbjct: 2 AYVSMGEAHRRITEYLNRFCDAVSYQDSSTLCRLLSFSSNSPPLLSLADALNVFQDSSSL 61 Query: 437 IRQADKYSQYAEIVSPLFRAMQSY 508 IRQ+D++S+Y EI++ +FR++QSY Sbjct: 62 IRQSDRFSEYGEILAHVFRSLQSY 85 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,640,756 Number of Sequences: 27288 Number of extensions: 259254 Number of successful extensions: 938 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 854 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 927 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 684463600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC11J15.yg.ab1 (445 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54410.1 water stress-induced protein, putative / similar ... 97 3e-21 >At1g54410.1 water stress-induced protein, putative / similar to water stress-induced protein, GI:454880 from [Oryza sativa]; supported by full-length cDNA: Ceres: 108142. Length = 98 Score = 97.1 bits (240), Expect = 3e-21 Identities = 62/106 (58%), Positives = 71/106 (66%), Gaps = 4/106 (3%) Frame = +2 Query: 44 MAGIMGKIGDALHIGGDKKD-ENKKHEGEYSSDHKKQEGDYKSDHKPEKKEGIVDKIKDK 220 MAG++ KIGDALHIGG K+ E+KK E +HKK ++KS E KEGIVDKIKDK Sbjct: 1 MAGLINKIGDALHIGGGNKEGEHKKEE-----EHKKHVDEHKSG---EHKEGIVDKIKDK 52 Query: 221 ITGDGGSKVD-SGEGH--EKKKKKDKKKKKEGDHHDGGSSSSSDSD 349 I G G D G+ H EKKKKKDKK+KK H DG SSSSDSD Sbjct: 53 IHGGEGKSHDGEGKSHDGEKKKKKDKKEKKH--HDDGHHSSSSDSD 96 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,997,637 Number of Sequences: 27288 Number of extensions: 285228 Number of successful extensions: 4480 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3612 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 516458532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC11J17.yg.ab1 (652 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g07910.1 translation elongation factor EF-1 alpha / identi... 264 5e-80 >At1g07910.1 translation elongation factor EF-1 alpha / identical to GB:AAB07881 from [Arabidopsis thaliana] (Mol. Gen. Genet. 219 (1-2), 106-112 (1989)) Length = 1081 Score = 264 bits (675), Expect(2) = 5e-80 Identities = 134/192 (69%), Positives = 154/192 (79%), Gaps = 3/192 (1%) Frame = +2 Query: 5 FSRRPAAYKTYYLRQMEIWNTSPGKQRQLSKMLDEWAVYIRRKYGNKQLSSSIYLSEAEP 184 F AAYKTYYLRQM+IW TS GKQ++L KMLDEWA YIRRK GN QLSSS YLSEAEP Sbjct: 539 FKDGAAAYKTYYLRQMKIWGTSDGKQKELCKMLDEWAAYIRRKCGNDQLSSSTYLSEAEP 598 Query: 185 FLEQYAKRSEENQALIGCAGDLVRTEGFLAIVDGGRDAEEGDLESEKVLEASSPKP---D 355 FLEQYAKRS +N LIG AG+LVRTE FLAIVDG D EEGDL ++ + ++P+P + Sbjct: 599 FLEQYAKRSPKNHILIGSAGNLVRTEDFLAIVDGDLD-EEGDLVKKQGVTPATPEPAVKE 657 Query: 356 AVHKKEGLIIFFPGIPGCAKSALCKEILSGSESLEDDRPIHSLMGDLIKGKYWQRVADER 535 AV K EGLI+FFPGIPG AKSALCKE+L+ DDRP+H+LMGDL+KGKYW +VADER Sbjct: 658 AVQKDEGLIVFFPGIPGSAKSALCKELLNAPGGFGDDRPVHTLMGDLVKGKYWPKVADER 717 Query: 536 RKKPYSILLADK 571 RKKP SI+LADK Sbjct: 718 RKKPQSIMLADK 729 Score = 51.2 bits (121), Expect(2) = 5e-80 Identities = 21/27 (77%), Positives = 26/27 (95%) Frame = +1 Query: 568 QNAPNEEVWRQIENMCRTTKASAVPII 648 +NAPNE+VWRQIE+MCR T+ASAVPI+ Sbjct: 729 KNAPNEDVWRQIEDMCRRTRASAVPIV 755 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,493,202 Number of Sequences: 27288 Number of extensions: 318437 Number of successful extensions: 1121 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1030 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1120 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1079832556 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC11O10.yg.ab1 (751 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g19820.1 cell elongation protein, Dwarf1 / identical to GB... 459 e-130 >At3g19820.1 cell elongation protein, Dwarf1 / identical to GB:S71189 from [Arabidopsis thaliana]; supported by cDNA: gi_516042_gb_U12400.1_ATU12400 Length = 561 Score = 459 bits (1180), Expect = e-130 Identities = 208/250 (83%), Positives = 221/250 (88%) Frame = +2 Query: 2 VCMTGVYASKEEAKMKGNKINSVGWWFKPWFYQHAQTALKKGEFVEYIPTREYYHRHTRC 181 V M G YASKEEAK KGNKIN+VGWWFKPWFYQHAQTALKKG+FVEYIPTREYYHRHTRC Sbjct: 283 VMMVGTYASKEEAKKKGNKINNVGWWFKPWFYQHAQTALKKGQFVEYIPTREYYHRHTRC 342 Query: 182 LYWEGKLILPFADQWWFRYSLGWLMPPKVSLLKATQGEAIRNYYHEMHVIQDMLVPLYKV 361 LYWEGKLILPF DQ+WFRY LGWLMPPKVSLLKATQGEAIRNYYH+MHVIQDMLVPLYKV Sbjct: 343 LYWEGKLILPFGDQFWFRYLLGWLMPPKVSLLKATQGEAIRNYYHDMHVIQDMLVPLYKV 402 Query: 362 PDALEWVDREMEVYPLWLCPHRLYKLPCKTMIYPEPGFEQERRQGDTPYAQMYTDIGVYY 541 DALEWV REMEVYP+WLCPH+L+K P K IYPEPGFE E RQGDT AQMYTD+GVYY Sbjct: 403 GDALEWVHREMEVYPIWLCPHKLFKQPIKGQIYPEPGFEYENRQGDTEDAQMYTDVGVYY 462 Query: 542 TPASVFRGEVFDGVDAVSRLESWLIENHGFQPQYAVSELDEKKFWRMFDAGLYEQCRNKY 721 P V RGE FDG +AV R+E WLIENHGFQPQYAVSELDEK FWRMF+ LYE+CR KY Sbjct: 463 APGCVLRGEEFDGSEAVRRMEKWLIENHGFQPQYAVSELDEKSFWRMFNGELYEECRKKY 522 Query: 722 GAVGTFMSVY 751 A+GTFMSVY Sbjct: 523 RAIGTFMSVY 532 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,936,625 Number of Sequences: 27288 Number of extensions: 465259 Number of successful extensions: 1292 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1290 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1348188320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC11O17.yg.ab1 (717 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63420.1 putative protein / similar to unknown protein (sp... 399 e-111 >At5g63420.1 putative protein / similar to unknown protein (sp|P54122) Length = 528 Score = 399 bits (1024), Expect = e-111 Identities = 198/236 (83%), Positives = 222/236 (93%) Frame = +1 Query: 1 DWKIDESPLDGQVFDREGLEQLSKEGVTLMMSDSTNVLSPGRTLSETVVANSLLRNISAA 180 DWKIDE+PLDG+VFDRE LE+LSKEGVTLMMSDSTNVLSPGRT+SE VVA++L+RN+ AA Sbjct: 267 DWKIDEAPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISEKVVADALVRNVMAA 326 Query: 181 KGRVITTQFSSNIHRLGSVKAAADATGRKLVFVGMSLRTYLDAAWKDGKAPIDPSTLVKV 360 KGRVITTQF+SNIHRLGS+KAAAD TGRKLVFVGMSLRTYL+AAW+DGKAPIDPS+L+KV Sbjct: 327 KGRVITTQFASNIHRLGSIKAAADITGRKLVFVGMSLRTYLEAAWRDGKAPIDPSSLIKV 386 Query: 361 EDIDGYAPKDLLIVTTGSQAEPRAALNLASFGSSHFFKLSKEDLILYSAKVIPGNESRVM 540 EDI+ YAPKDLLIVTTGSQAEPRAALNLAS+GSSH FKL+KED+ILYSAKVIPGNESRVM Sbjct: 387 EDIEAYAPKDLLIVTTGSQAEPRAALNLASYGSSHAFKLTKEDIILYSAKVIPGNESRVM 446 Query: 541 KMMNRLSEIGPTIVMGXNEQLHTSGHAYREELEEVLRIVKTTHFLPIHGELLFLKD 708 KMMNR+++IGP I+MG NE LHTSGHAYR EL VL+IVK HFLPIHGELLFLK+ Sbjct: 447 KMMNRIADIGPNIIMGKNEMLHTSGHAYRGEL--VLKIVKPQHFLPIHGELLFLKE 500 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,759,585 Number of Sequences: 27288 Number of extensions: 336523 Number of successful extensions: 791 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 790 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1263366616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC11P05.yg.ab1 (333 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03370.1 putative protein / ; supported by full-length cD... 96 3e-21 >At5g03370.1 putative protein / ; supported by full-length cDNA: Ceres: 39035. Length = 171 Score = 95.9 bits (237), Expect = 3e-21 Identities = 41/67 (61%), Positives = 52/67 (77%) Frame = +3 Query: 3 WTVQNATELGLKGWVKNRGDGSVEILLSGEADKVDEMQERCRTGPPLCVVTKFQSFPSTE 182 WTV+NA +LG+KGWV+NR DGSVE L SG + VDEM +RCR GPP +VT ++FPSTE Sbjct: 100 WTVENAEQLGIKGWVRNRRDGSVEALFSGPPEAVDEMHQRCRRGPPAAMVTGLEAFPSTE 159 Query: 183 DPGIGFQ 203 +PG F+ Sbjct: 160 EPGSSFE 166 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,176,515 Number of Sequences: 27288 Number of extensions: 172432 Number of successful extensions: 532 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 11,516,596 effective HSP length: 86 effective length of database: 9,169,828 effective search space used: 220075872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC11P09.yg.ab1 (734 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g20410.1 hypothetical protein / 75 4e-14 >At1g20410.1 hypothetical protein / Length = 432 Score = 75.1 bits (183), Expect = 4e-14 Identities = 40/96 (41%), Positives = 57/96 (58%) Frame = +1 Query: 376 FSYLDERDTLLGKDHAEDFAMAVAESVKEKGHEIPSFTLEVSLPTLITENEQVILLYLKK 555 F + D + L+ D + D+ + + VK+ HE SF LEVS+P+ I ENE+ +L YLK Sbjct: 91 FVFSDVKKELVKSDSSSDYVARITDLVKQDRHEFDSFGLEVSVPSTIMENERALLSYLKG 150 Query: 556 KYASEVWFQEKFSSEHISVKDALKLSMTHPLVKLFG 663 KY++EVW Q + ISVKDALK+ + L G Sbjct: 151 KYSTEVWLQR----DKISVKDALKVLLLDQLKASLG 182 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,465,323 Number of Sequences: 27288 Number of extensions: 322392 Number of successful extensions: 993 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 950 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 993 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1303840020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC12E04.yg.ab1 (625 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g16570.1 unknown protein / contains similarity to beta-1,4... 249 6e-67 >At1g16570.1 unknown protein / contains similarity to beta-1,4 mannosyltransferase GI:6970470 from [Homo sapiens] Length = 465 Score = 249 bits (637), Expect = 6e-67 Identities = 123/172 (71%), Positives = 140/172 (80%) Frame = +3 Query: 108 GKRNRAAVVVLGDIGRSPRMQYHALSLARQANLEVDIVAYGGSDPHSALLEHQSIHIHTM 287 GKR RA VVVLGD+GRSPRMQYHALSLARQA+ +VDIVAYGGS PH A+L H SIHIHTM Sbjct: 2 GKRGRACVVVLGDLGRSPRMQYHALSLARQASFQVDIVAYGGSIPHEAVLNHPSIHIHTM 61 Query: 288 RQWGSRDGILPKIFRPLMLLLKPLIQFIMLLWFLCVKIKAPDVFLVQNPPSVPTLVAVKW 467 Q PKI P+ LLLK IQF MLLWFL VK+ APD+FLVQNPPSVPTL+AVKW Sbjct: 62 AQPRFIQ-YFPKILYPVTLLLKAFIQFTMLLWFLFVKVPAPDIFLVQNPPSVPTLIAVKW 120 Query: 468 ASWIRRSSFIIDWHNFGYTLLALSLGRSSRFVSVYHWVELHFGKMANGALCV 623 AS RR++F++DWHNFGYTLLALSLGR++ VS+Y W E H+GKMA G+LCV Sbjct: 121 ASSWRRAAFVVDWHNFGYTLLALSLGRNNLLVSLYRWSENHYGKMATGSLCV 172 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,381,905 Number of Sequences: 27288 Number of extensions: 367720 Number of successful extensions: 934 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 914 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 999514432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC12H24.yg.ab1 (738 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56940.1 leucine zipper-containing protein AT103 / ; suppo... 471 e-133 >At3g56940.1 leucine zipper-containing protein AT103 / ; supported by cDNA: gi_1033194_gb_U38232.1_ATU38232 Length = 409 Score = 471 bits (1212), Expect = e-133 Identities = 225/241 (93%), Positives = 234/241 (96%) Frame = +1 Query: 16 KKGIKETLLAPRFYTTDFDEMEQLFNTEMNKNLNEAEFEALLQEFKTDYNQTHFVRNKEF 195 KK I+E+LL PRFYTTDF+EMEQLFNTE+NKNLNEAEFEALLQEFKTDYNQTHFVRNKEF Sbjct: 58 KKEIQESLLTPRFYTTDFEEMEQLFNTEINKNLNEAEFEALLQEFKTDYNQTHFVRNKEF 117 Query: 196 KEAADEIQGPMRQIFVEF*ERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEAR 375 KEAAD++QGP+RQIFVEF ERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEAR Sbjct: 118 KEAADKLQGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDEAR 177 Query: 376 HAGFLNKGLSDFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLKTN 555 HAGFLNKGLSDFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLK N Sbjct: 178 HAGFLNKGLSDFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLKEN 237 Query: 556 PEYQVYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDWKAKLWSRFFCLSGYGTMYLN 735 PE+Q YPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDW+AKLWSRFFCLS Y TMYLN Sbjct: 238 PEFQCYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDWQAKLWSRFFCLSVYVTMYLN 297 Query: 736 D 738 D Sbjct: 298 D 298 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,576,739 Number of Sequences: 27288 Number of extensions: 370636 Number of successful extensions: 1182 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1182 length of database: 11,516,596 effective HSP length: 97 effective length of database: 8,869,660 effective search space used: 1312709680 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC12I20.yg.ab1 (632 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g25460.1 hypothetical protein / 178 2e-45 >At4g25460.1 hypothetical protein / Length = 250 Score = 178 bits (451), Expect = 2e-45 Identities = 99/172 (57%), Positives = 117/172 (67%), Gaps = 10/172 (5%) Frame = +1 Query: 1 DPKVEESDSSPEPVQRFNAISLGLLLRLLSRHKLRVAASIVSLVCCTTCTLSMPILSGRF 180 DPK+EES S E + IS GLL L+S+HKLR++ + + LS GRF Sbjct: 77 DPKIEESKSEAESK---DLISWGLLWSLMSKHKLRLSFKFGCFIMVSVIVLS----KGRF 129 Query: 181 FEVLIGARSEPLWQLLSKVGVLYTLEPIFTVIFVVNMNTIWEKVMSSLRAQIFGSVLIHK 360 FEVLIG R EPLW+LLSK+ VLY+LEPIFT+ FV NM IWE VM+ LRAQIF VLI K Sbjct: 130 FEVLIGVRPEPLWRLLSKIAVLYSLEPIFTIAFVTNMTAIWENVMAILRAQIFRRVLIQK 189 Query: 361 VEFFDRYK----------VGELTALLTSDLGSFKNIVSENISRDRGFRALTE 486 EFFD+YK VGELT LLTSDLG+ +IV++NISRDRGFRA TE Sbjct: 190 AEFFDKYKVCSFYSWFAQVGELTGLLTSDLGALNSIVNDNISRDRGFRAFTE 241 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,581,404 Number of Sequences: 27288 Number of extensions: 295330 Number of successful extensions: 796 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 792 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1026287140 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC12M01.yg.ab1 (285 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g43690.1 unknown protein / ; supported by cDNA: gi_17978984 67 2e-12 >At1g43690.1 unknown protein / ; supported by cDNA: gi_17978984 Length = 599 Score = 66.6 bits (161), Expect = 2e-12 Identities = 26/36 (72%), Positives = 31/36 (85%) Frame = +1 Query: 34 EVEKPERTQHAPLVDCVRTRWARAVCNWEGDPPSIV 141 EV +P+ QHAPLVDC+RTRW+RA C+W GDPPSIV Sbjct: 564 EVNQPKPVQHAPLVDCIRTRWSRAACSWSGDPPSIV 599 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,354,454 Number of Sequences: 27288 Number of extensions: 240038 Number of successful extensions: 5028 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3659 length of database: 11,516,596 effective HSP length: 70 effective length of database: 9,606,436 effective search space used: 230554464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC12N17.yg.ab1 (674 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66070.1 expressed protein / ;supported by full-length cDN... 270 7e-73 >At1g66070.1 expressed protein / ;supported by full-length cDNA: Ceres:20812. Length = 226 Score = 270 bits (689), Expect = 7e-73 Identities = 144/210 (68%), Positives = 170/210 (80%), Gaps = 4/210 (1%) Frame = +3 Query: 3 DDEDADENDVKDSWEDDD-EPAPPPVTAAPPPVEKAPKKSTAKATQEKGKAAVQPPKEEP 179 DDED DEN++KDSWEDDD EPA PPV P EKAPKK+ K ++KGKA V+ PKE P Sbjct: 23 DDEDVDENEIKDSWEDDDDEPAQPPVINPAP--EKAPKKAAPKTVEKKGKA-VEVPKEAP 79 Query: 180 ---PLDPVAEKLRQQRLVEEADYKNTAELFASKKADDRTIDNFIPKSESDFTEYAELISS 350 PLDP+AEKLRQQRLVEEADY+ TAELF K DD+ +D FIPKSESDF EYAE+IS Sbjct: 80 KEKPLDPIAEKLRQQRLVEEADYRATAELFGVKD-DDKNLDMFIPKSESDFLEYAEMISH 138 Query: 351 KLRPFEKSFHYIGLLKHVMRLSMTSLKASDAKEVASSVTAIANEKLKAEKEAAAGKKKTG 530 +++P+EKS+HYI LLK +MRLS+T++KA+D K+VASS+T IANEKLKAEKEAAAGKKK G Sbjct: 139 RIKPYEKSYHYIALLKTIMRLSLTNMKAADVKDVASSITTIANEKLKAEKEAAAGKKK-G 197 Query: 531 GKKKQLLVDKPDDDSVVNAGYDGYDDFDFM 620 GKKKQL+VDK +DD +V YD DDFDFM Sbjct: 198 GKKKQLIVDKANDD-LVAGPYDAMDDFDFM 226 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,312,499 Number of Sequences: 27288 Number of extensions: 369772 Number of successful extensions: 5323 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2597 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4494 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1138809344 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= QGC13B22.yg.ab1 (742 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g07590.1 WD-repeat protein-like / 367 e-102 >At5g07590.1 WD-repeat protein-like / Length = 443 Score = 367 bits (941), Expect = e-102 Identities = 175/236 (74%), Positives = 196/236 (82%) Frame = +2 Query: 29 AGWSPDSRHILTTSEFQLRLTVWSLLNTACIHVQWPKHASKGVSFTKDGSFAAISTRRDC 208 A WSPDSRHILTTSEFQLRLTVWSLLNTAC+HVQWPKH SKGVSF +DG FAAI TRRDC Sbjct: 96 ARWSPDSRHILTTSEFQLRLTVWSLLNTACVHVQWPKHGSKGVSFNQDGKFAAICTRRDC 155 Query: 209 KDYVNLISCQTWEIMGVFAVDTLDLADVEWSPDDTAIVIWDSPLEYKVLIYSLDGRCLAK 388 KDYVNL+SCQ+WEIMG FAVDTLDLAD+EWSPDD++IV+WDSPLEYK Sbjct: 156 KDYVNLLSCQSWEIMGSFAVDTLDLADLEWSPDDSSIVVWDSPLEYK------------- 202 Query: 389 YQAYESGLGVKSVSWSPNGQSLAVGSYDQMLRVLNHLTWKVFAEFTHLSTVRAPCSAAVF 568 AYE GLGVK+VSWSP GQ LA+GSYDQMLRVLNHLTWK FAEF HLSTVRAPCSAA+F Sbjct: 203 --AYECGLGVKTVSWSPCGQFLAIGSYDQMLRVLNHLTWKTFAEFLHLSTVRAPC