BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208500|gb|BQ134589.1|BQ134589 1091015E05.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (452 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g56345.1 RNA pseudouridylate synthase, putative / contains... 65 1e-11 >At1g56345.1 RNA pseudouridylate synthase, putative / contains Pfam profile: PF00849: RNA pseudouridylate synthase Length = 254 Score = 65.5 bits (158), Expect = 1e-11 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -3 Query: 447 RRDVKYGGVIEWDGVECEGHALHAESLSFVHPITGLPITLRSPLPPWA 304 R DVKY GV EW+G EGH LHAE LS HP+TG I +R+PLP WA Sbjct: 204 RGDVKYHGVYEWNGRTFEGHELHAECLSLDHPVTGDSIVIRAPLPYWA 251 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,471,715 Number of Sequences: 27288 Number of extensions: 192143 Number of successful extensions: 517 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 543640560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208494|gb|BQ134583.1|BQ134583 1091015D05.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (508 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11800.1 expressed protein / EST gb|F14156 comes from this... 147 4e-36 >At1g11800.1 expressed protein / EST gb|F14156 comes from this gene;supported by full-length cDNA: Ceres:16491. Length = 426 Score = 147 bits (370), Expect = 4e-36 Identities = 66/101 (65%), Positives = 83/101 (81%) Frame = -2 Query: 507 GPFPLQDGWTDAWVELKPGEDGWTYDTKANGMLSGNRKLQKRLDRFVCKLADFKMDSIEM 328 G FPL D W D W LKPG+ G+TYDTKAN MLSGNR LQKRLDR +C+L D+K+ IEM Sbjct: 324 GKFPLPDKWVDVWEVLKPGDLGFTYDTKANPMLSGNRALQKRLDRILCRLDDYKLGGIEM 383 Query: 327 IGKEAIPGVSYFKEKKIRKENQRIELPVFPSDHFGLVLTIT 205 +GKEAIPG+SY KEKK+R + +++ELPV PSDHFGL++T++ Sbjct: 384 VGKEAIPGLSYVKEKKVRGDIKKLELPVLPSDHFGLLVTLS 424 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,122,611 Number of Sequences: 27288 Number of extensions: 258463 Number of successful extensions: 706 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 706 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 684463600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208471|gb|BQ134560.1|BQ134560 1091015A04.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (443 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20320.1 expressed protein / ;supported by full-length cD... 114 3e-26 >At3g20320.1 expressed protein / ;supported by full-length cDNA: Ceres:17362. Length = 381 Score = 114 bits (284), Expect = 3e-26 Identities = 54/83 (65%), Positives = 70/83 (84%) Frame = -3 Query: 441 AEEMQPLLSEVNDSDLLKDVETIAKGLADASGDLRRLKSSMLTPENTDLIKQSIFTLIFT 262 AE+ QPLLSE DS LLK+VE + + L AS DLR++ SS++TPENT+LI++SI+TL++T Sbjct: 287 AEDAQPLLSEFRDSGLLKEVECLTRSLTQASDDLRKVNSSIMTPENTELIQKSIYTLVYT 346 Query: 261 LKNIESISSDISGFTGDETTRRN 193 LKN+ESISSDI GFTGDE TR+N Sbjct: 347 LKNVESISSDILGFTGDEATRKN 369 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,465,496 Number of Sequences: 27288 Number of extensions: 160849 Number of successful extensions: 416 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 416 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 516458532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208415|gb|BQ134504.1|BQ134504 1091014C01.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (391 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44620.1 protein-tyrosine-phosphatase-like protein / prote... 106 4e-24 At3g44420.1 putative protein / predicted protein, Arabidopsis... 55 1e-08 >At3g44620.1 protein-tyrosine-phosphatase-like protein / protein-tyrosine-phosphatase - Schizosaccharomyces pombe, PIR:A55446 Length = 177 Score = 106 bits (264), Expect = 4e-24 Identities = 49/76 (64%), Positives = 56/76 (73%) Frame = -3 Query: 350 EQYAEDILNSFERWRRKEPLPDSAPNKVKLMCSYCKHHTESEVPDPYYGGPQGFEKVLDL 171 +Q EDIL ++ W+ + P A KVKLMCSYCK H + VPDPYYGG QGFEKVLDL Sbjct: 102 DQNKEDILKAYNVWKARGNFPPDADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKVLDL 161 Query: 170 LEDACESLLDSIVANN 123 LEDACESLLDSI A + Sbjct: 162 LEDACESLLDSITAQS 177 >At3g44420.1 putative protein / predicted protein, Arabidopsis thaliana Length = 235 Score = 55.1 bits (131), Expect = 1e-08 Identities = 27/58 (46%), Positives = 33/58 (56%) Frame = -3 Query: 344 YAEDILNSFERWRRKEPLPDSAPNKVKLMCSYCKHHTESEVPDPYYGGPQGFEKVLDL 171 +AEDIL ++ VKLMCSYCK H + V DPYYGG Q FEKV+ + Sbjct: 14 FAEDILKAYN---------------VKLMCSYCKKHNDKFVHDPYYGGAQSFEKVISI 56 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,452,140 Number of Sequences: 27288 Number of extensions: 173139 Number of successful extensions: 534 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 534 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 373725332 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208391|gb|BQ134480.1|BQ134480 1091020H03.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (503 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48720.1 putative protein / similar to unknown protein (gb... 76 1e-14 >At5g48720.1 putative protein / similar to unknown protein (gb|AAD20092.1) Length = 286 Score = 75.9 bits (185), Expect = 1e-14 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 6/56 (10%) Frame = -1 Query: 503 QDINQRIRAPPKKA------PEILGTSAFSGKPVIGKTRIRTEGGKGSITILRTKG 354 +DINQ+IR PP K P ++ TSAFSGKPV+GKT+IRTEGGKGSITI+RT+G Sbjct: 231 KDINQKIRNPPAKPKAHIEEPAVIQTSAFSGKPVVGKTKIRTEGGKGSITIMRTRG 286 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,513,667 Number of Sequences: 27288 Number of extensions: 211837 Number of successful extensions: 570 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 566 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 675457500 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208320|gb|BQ134409.1|BQ134409 1091016H05.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (383 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g10050.1 lipase-like protein / monoglyceride lipase - Mus ... 153 2e-39 >At4g10050.1 lipase-like protein / monoglyceride lipase - Mus musculus, PID:e1184892;supported by full-length cDNA: Ceres:6822. Length = 350 Score = 153 bits (387), Expect(2) = 2e-39 Identities = 68/105 (64%), Positives = 92/105 (86%) Frame = +3 Query: 69 EERRVAIPDTDNVFNAYTTGSEGPVVFCLHGGGYSGFSFALAASQMKDKARVVAMDLRGH 248 +E ++I +D+VF+ Y G+EGPVVFCLHGGGYSG SF++ AS++K+KARVVAMDLRGH Sbjct: 56 KEDDISITGSDDVFHVYMAGNEGPVVFCLHGGGYSGLSFSIVASKIKEKARVVAMDLRGH 115 Query: 249 GKSTTNDDLDLSIETLTNDIIAVIRTMYGDLPPAIILVGHSMGGS 383 GKS + ++L+LS+ET++ND++AVI+ +YGD PPAI+LVGHSMGGS Sbjct: 116 GKSVSENELELSLETMSNDVLAVIKELYGDSPPAIVLVGHSMGGS 160 Score = 24.6 bits (52), Expect(2) = 2e-39 Identities = 7/16 (43%), Positives = 13/16 (80%) Frame = +2 Query: 17 SHSLHKYAPLDWSAYF 64 ++S KY+P++W +YF Sbjct: 39 TNSSEKYSPVEWKSYF 54 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,145,024 Number of Sequences: 27288 Number of extensions: 197900 Number of successful extensions: 586 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 582 length of database: 11,516,596 effective HSP length: 87 effective length of database: 9,142,540 effective search space used: 365701600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208269|gb|BQ134358.1|BQ134358 1091016B02.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (523 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g25120.1 putative protein / ATP-dependent DNA helicase Rep... 167 2e-42 >At4g25120.1 putative protein / ATP-dependent DNA helicase Rep, Escherichia coli, PIR1:HJECDR Length = 938 Score = 167 bits (424), Expect = 2e-42 Identities = 90/164 (54%), Positives = 109/164 (65%) Frame = +3 Query: 30 EGIPPPNILAMTFTTAAASEMRERIGTVAGNAVA*DIAISTFHSFCLQLCRTHAEKLGRT 209 +G+ P NILAMTFT AA SEMRERIG AG A DI ISTFHSF LQLCR HA+KL RT Sbjct: 273 KGLLPSNILAMTFTKAATSEMRERIGKSAGKKAAKDITISTFHSFSLQLCRMHADKLQRT 332 Query: 210 SEFIIYGHGQQRRALIETERLLENDKNNGVGDTTNQYDGDIKNSFKDKAKKWQKFITQAK 389 SEF +YGHGQQRRA+IE RL E +K NG + G+ N A K Sbjct: 333 SEFSVYGHGQQRRAIIEAVRLYEEEKKNGSKTSVPCESGEGLNGAGAGA---------GK 383 Query: 390 ASGRTPEDYEKKGDLTGASVLRHYNEILRSCNALDYHDFINSSI 521 ASG++PE K G+ GA +L +YN+IL++C+ALDYHD I+ S+ Sbjct: 384 ASGKSPEQCRKMGNEIGAKILGNYNDILKACDALDYHDLISCSV 427 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,247,776 Number of Sequences: 27288 Number of extensions: 240480 Number of successful extensions: 718 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 717 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 729494100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208255|gb|BQ134344.1|BQ134344 1091015H06.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (483 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g37290.1 putative protein / CG14881, Drosophila melanogast... 137 4e-33 >At5g37290.1 putative protein / CG14881, Drosophila melanogaster, EMBL:AE003713;supported by full-length cDNA: Ceres:9887. Length = 180 Score = 137 bits (344), Expect = 4e-33 Identities = 64/82 (78%), Positives = 75/82 (91%) Frame = +3 Query: 237 MSTNAQRQVERTGRSGTPRDQYLQDLVTQFQNATNEESKEKIVANLANFAYDPFNYAFMR 416 M TN QRQ ERTG+ GTPR QYLQ+LV+QFQNAT+EE+KE+IVANLANFAYDP+NY +R Sbjct: 1 MFTNNQRQEERTGKHGTPRLQYLQELVSQFQNATDEETKERIVANLANFAYDPYNYTILR 60 Query: 417 QLNVLELFLDCITEPNERLIEF 482 QLNVLELF+DCITEPNE+L+EF Sbjct: 61 QLNVLELFVDCITEPNEKLVEF 82 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,644,457 Number of Sequences: 27288 Number of extensions: 214376 Number of successful extensions: 620 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 603 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 620 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 623303772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208228|gb|BQ134317.1|BQ134317 1091015D06.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (554 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g22800.1 unknown protein / ESTs gb|Z34075, gb|Z34835 and g... 173 5e-44 >At1g22800.1 unknown protein / ESTs gb|Z34075, gb|Z34835 and gb|AA404888 come from this gene Length = 355 Score = 173 bits (439), Expect = 5e-44 Identities = 93/171 (54%), Positives = 114/171 (66%), Gaps = 5/171 (2%) Frame = +3 Query: 57 FSSSSAPDG---LDDGGGRVKIFDRDLKRRHRDRAAWAMFEIY-GLVDAVAENLLDRLED 224 FS+ A G +VKIFDRDLKR HRDRAAW + VDAVA+NLLDRLED Sbjct: 34 FSTEGAYGGDGEFQQNSSKVKIFDRDLKRIHRDRAAWLSRQKNDSFVDAVADNLLDRLED 93 Query: 225 CRKAFPSALCXXXXXXXXXXXXXXXXXXXXXIMMDMSADMVKKWRESENATGDGP-ETHF 401 C+K+FP+A C IMMD S DM+K R++++ + D ET + Sbjct: 94 CKKSFPTAFCLGGSLGAVKRLLRGRGGIEKLIMMDTSYDMIKSCRDAQDDSLDNSIETSY 153 Query: 402 VIGDEEFLPIKESSQDLIMSCLGLHWTNDLPGAMIQCRLALQPDGLFLSAI 554 +GDEEFLP+KESS DLI+S LGLHWTNDLPG+MIQC+LAL+PDGLFL+AI Sbjct: 154 FVGDEEFLPVKESSVDLIISSLGLHWTNDLPGSMIQCKLALKPDGLFLAAI 204 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,054,367 Number of Sequences: 27288 Number of extensions: 195473 Number of successful extensions: 763 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 760 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 817071892 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208215|gb|BQ134304.1|BQ134304 1091015B04.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (329 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32050.1 putative protein / norbin, Rattus norvegicus, PIR... 104 7e-24 >At4g32050.1 putative protein / norbin, Rattus norvegicus, PIR2:JC5812; supported by cDNA: gi_18086356 Length = 618 Score = 104 bits (260), Expect = 7e-24 Identities = 55/105 (52%), Positives = 75/105 (71%) Frame = +3 Query: 9 SQKESALHDFLRSIPASIWESHIRVGITAILQNRVVSSEKLHALLLAECMMSILGEDWLS 188 S+ LH+ LRS+P + W ++R G+ AILQNRV SEKLHAL+LAE MMSILGE WL Sbjct: 225 SEYSELLHEPLRSMPDNNWADYMRTGVVAILQNRVAPSEKLHALILAENMMSILGEKWLL 284 Query: 189 EDFEVQDNQNVLSVDKFVLLVLESARVEVAVLLNELAYLKYESSR 323 ++ + + D+ +LLVLES+ VE++VLLN+LAY KYE+ + Sbjct: 285 GGVKLPNVD--IPADRCLLLVLESSHVEISVLLNDLAYKKYEAPK 327 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,325,781 Number of Sequences: 27288 Number of extensions: 148714 Number of successful extensions: 402 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 401 length of database: 11,516,596 effective HSP length: 85 effective length of database: 9,197,116 effective search space used: 220730784 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208173|gb|BQ134262.1|BQ134262 1091014F01.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (636 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49810.1 methionine S-methyltransferase (gb|AAD49574.1) / ... 257 3e-69 >At5g49810.1 methionine S-methyltransferase (gb|AAD49574.1) / ; supported by cDNA: gi_5733428_gb_AF137380.1_AF137380 Length = 1071 Score = 257 bits (657), Expect(2) = 3e-69 Identities = 131/197 (66%), Positives = 158/197 (79%) Frame = +1 Query: 37 MFSPALAIVDEHLTRHLPKQWLTSLAIEGRADCNHADGTVTVIEAPLLSDLLIELIRKLQ 216 +FSP LAIVDEHLTR LP+ WLTSLAIE + + +D +TVIE+P SDL+IELI+KL+ Sbjct: 464 LFSPRLAIVDEHLTRQLPRSWLTSLAIEDTS-MDKSDDQITVIESPHQSDLMIELIKKLK 522 Query: 217 PQVVVTGMAQFEAITSAAFENLLNVTKDVGSRLFLDIXXXXXXXXXXXXNGVLKYLAGKT 396 PQVVVTGMA FE ITS++F +LL VTK++G RLFLDI NGVLKYLA Sbjct: 523 PQVVVTGMAPFEVITSSSFLHLLEVTKEIGCRLFLDISDHFELSSLPASNGVLKYLAENQ 582 Query: 397 LPSHAAILCGLVKNQVYSDLEVAFAISEDAAVYKALSQTIELLEGHTSLISQHYYGCLFH 576 LPSHAAI+CGLVKN+VYSDLEVAF I+E A+ KALS+T+E+LEGHT++ISQ+YYGCLFH Sbjct: 583 LPSHAAIICGLVKNKVYSDLEVAFVITEVDAIAKALSKTVEVLEGHTAIISQYYYGCLFH 642 Query: 577 ELLAFQIADRHPQQERQ 627 ELLAFQ+ADRH ER+ Sbjct: 643 ELLAFQLADRHAPAERE 659 Score = 21.9 bits (45), Expect(2) = 3e-69 Identities = 10/21 (47%), Positives = 15/21 (70%) Frame = +2 Query: 2 PSRSVAIENALQCSHRRLQLL 64 PSR+VAIE+A + RL ++ Sbjct: 452 PSRAVAIESAFRLFSPRLAIV 472 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,424,449 Number of Sequences: 27288 Number of extensions: 269927 Number of successful extensions: 718 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 717 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208162|gb|BQ134251.1|BQ134251 1091014D12.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (624 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58110.1 putative protein / predicted proteins, Homo sapie... 199 1e-51 >At5g58110.1 putative protein / predicted proteins, Homo sapiens and Drosophila melanogaster; supported by cDNA: gi_18087564 Length = 196 Score = 199 bits (506), Expect = 1e-51 Identities = 95/160 (59%), Positives = 122/160 (75%), Gaps = 1/160 (0%) Frame = +1 Query: 145 SSYRYWVREASGDAAPLPVPRKL-DTAANGNGNPPPVGSVWNQAGTWEEKNLNSWANSRI 321 SSYRYWVREA+ DAAP P+P+KL + + N P +GS+WN+AGTWEEK+L WA R+ Sbjct: 12 SSYRYWVREATSDAAPPPLPQKLSNNDVSLNTAPASLGSLWNRAGTWEEKSLTKWATDRL 71 Query: 322 KDLMGSLGSLAFPTGKASIDEVSKCSGDAFQVIVRNKKRVGYNYELSLRFSGEWLIKEEN 501 K+L+GS+GSL F +GKA I +V++C GDAF V VRNKKRVGY YELSL+ GEW +E Sbjct: 72 KELLGSVGSLQFSSGKAEIIDVNRCVGDAFLVTVRNKKRVGYTYELSLKVEGEWSFEENM 131 Query: 502 KKIKGHLDIPEFSFGKIDDLEVQVRFGDDKGLASDDRTRI 621 KK+KG L+IPEFSFG++DDLEV V+ +DK L+ + RI Sbjct: 132 KKVKGSLEIPEFSFGELDDLEVDVKLSEDKELSQQLKQRI 171 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.137 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,995,568 Number of Sequences: 27288 Number of extensions: 224500 Number of successful extensions: 692 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 999514432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208139|gb|BQ134228.1|BQ134228 1091014B10.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (598 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g23860.1 putative protein / gene T22C1.1, Caenorhabditis e... 120 4e-28 >At4g23860.1 putative protein / gene T22C1.1, Caenorhabditis elegans, Z75550; supported by cDNA: gi_17064723 Length = 222 Score = 120 bits (302), Expect = 4e-28 Identities = 53/112 (47%), Positives = 76/112 (67%) Frame = +2 Query: 188 QYKSEPFFMSKGWRETLCRCETCFNFYAQRGIAYLIDKEDSIEEYEKIAKQKREMKLEQQ 367 +++ +P F++K WR LCRCE C Y QR ++YL+D ED+I EYEK AK+KR KLE+Q Sbjct: 100 EFEKKPLFLTKNWRNILCRCEKCLEMYKQRKVSYLLDAEDTIVEYEKKAKEKRTEKLEKQ 159 Query: 368 QGAETNFLNSLNHVQKIEMISGINDMKNEFQSFLESFDASKPVTSDDIHSFF 523 +G + LN+L+HV K+E++ GI D ++ Q +ES SK +TS DI F Sbjct: 160 EGEALDLLNNLDHVSKVELLHGIKDFQDGLQGLMESAGPSKAITSADIEQMF 211 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,955,770 Number of Sequences: 27288 Number of extensions: 201555 Number of successful extensions: 698 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 681 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 698 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 930958496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208102|gb|BQ134191.1|BQ134191 1091013F09.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (524 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61040.1 unknown protein / ; supported by cDNA: gi_20147192 226 5e-60 >At1g61040.1 unknown protein / ; supported by cDNA: gi_20147192 Length = 643 Score = 226 bits (576), Expect = 5e-60 Identities = 108/172 (62%), Positives = 139/172 (80%), Gaps = 1/172 (0%) Frame = +1 Query: 10 FDDVKSITLRRSKLVKWFMEPFFDDLISGCFVRLGIGKTKNGTPSYRLCIVRNVDAFDPY 189 F+DVK +T+RRSKL KW MEPFF++LI GCFVR+GIG++K+G P YRLC V+NVDA DP Sbjct: 264 FEDVKEVTIRRSKLAKWLMEPFFEELIVGCFVRVGIGRSKSG-PIYRLCWVKNVDATDPD 322 Query: 190 RNYKLENYSTCKYLNVVWDSEANAARWQMTQVSDSPPNEEEFKEWLQAAEKNGARIPTRQ 369 + YKLEN +T KYLNVVW +E +AARWQM +SD P EEE+++W++ E+ R+PT+Q Sbjct: 323 KTYKLENKTTHKYLNVVWGNETSAARWQMAMISDGHPLEEEYRQWIREVERTNGRMPTKQ 382 Query: 370 EVLDKKEAIQNAYNFVYSAATVQQMLQE-KSAVRRPINIAAEKDRLRSELEM 522 ++ +KKEAIQ +FVYSA TV+QMLQE KSA RP+N+AAEKDRLR ELE+ Sbjct: 383 DISEKKEAIQRTNSFVYSAETVKQMLQEKKSASVRPMNVAAEKDRLRKELEI 434 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,992,297 Number of Sequences: 27288 Number of extensions: 266422 Number of successful extensions: 756 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 754 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 727283772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208097|gb|BQ134186.1|BQ134186 1091013E08.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (244 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39680.1 hypothetical protein / 99 4e-22 >At4g39680.1 hypothetical protein / Length = 633 Score = 99.0 bits (245), Expect = 4e-22 Identities = 50/78 (64%), Positives = 56/78 (71%) Frame = +3 Query: 9 SQTGPETPKDIFQPAFKRSFGRSDSTASVDSPKERIVPPAEKPATTSLRIDRFVRPFTLK 188 S T TP+ KR F RSDS+ S D PKER+VPP+ K T SLRIDRF+RPFTLK Sbjct: 415 SATPTTTPRST---GLKRDFSRSDSSVSEDGPKERVVPPSPKEPTNSLRIDRFLRPFTLK 471 Query: 189 AVQELLGKTGSVQDFWMD 242 AVQELLGKTG+V FWMD Sbjct: 472 AVQELLGKTGNVTSFWMD 489 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,207,027 Number of Sequences: 27288 Number of extensions: 94938 Number of successful extensions: 317 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 315 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 317 length of database: 11,516,596 effective HSP length: 56 effective length of database: 9,988,468 effective search space used: 239723232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822717|gb|BQ048741.1|BQ048741 952023F05.x4 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (596 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g70570.1 expressed protein / ; supported by cDNA: gi_15293... 167 3e-72 >At1g70570.1 expressed protein / ; supported by cDNA: gi_15293216_gb_AY051042.1_ Length = 595 Score = 167 bits (423), Expect(2) = 3e-72 Identities = 80/97 (82%), Positives = 86/97 (88%) Frame = -3 Query: 300 GPPPVADVNSLTHYGEPYDGNTRFFKSTLFVAAVRACYGESCLLHGVEWMPPKGGITEGQ 121 G PPVADV SLTHYGEPYDGNTRFF+STLFVAAVR+C GES LLHGVEWMPPKGG+TE Q Sbjct: 291 GAPPVADVKSLTHYGEPYDGNTRFFRSTLFVAAVRSCCGESSLLHGVEWMPPKGGVTEEQ 350 Query: 120 MLKFMGANIHLSPTQAKILLEDETAGFAYLNLQEACP 10 MLKFMGAN HLS QAK L+EDE AGFAYL+L+EA P Sbjct: 351 MLKFMGANTHLSVQQAKELIEDEKAGFAYLSLREARP 387 Score = 122 bits (305), Expect(2) = 3e-72 Identities = 62/92 (67%), Positives = 75/92 (81%), Gaps = 1/92 (1%) Frame = -1 Query: 596 ILGANGLAEPRYVGQGTGEMRLVGALREVLAGGHLGYEEVQCVLKDILPIGS-SSDSTVV 420 +LG P +VG T EMRLVGALRE+LAGGHLGYEEV+ VL+D+LP+ + S ++ V Sbjct: 198 LLGTGNSVGPTFVGNETREMRLVGALREILAGGHLGYEEVKGVLRDVLPLETEGSLNSGV 257 Query: 419 SQALLAAFLIGQRMNRETDRELKAYCLTFDDE 324 S++LL+AFLIGQRMNRETDRELKAYCL FDDE Sbjct: 258 SESLLSAFLIGQRMNRETDRELKAYCLAFDDE 289 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,739,113 Number of Sequences: 27288 Number of extensions: 303675 Number of successful extensions: 844 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 842 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 930958496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822478|gb|BQ048502.1|BQ048502 952021D02.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (532 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g56090.1 putative protein / contains similarity to cytochr... 280 3e-76 >At5g56090.1 putative protein / contains similarity to cytochrome oxidase assembly factor Length = 457 Score = 280 bits (716), Expect = 3e-76 Identities = 125/173 (72%), Positives = 152/173 (87%) Frame = -3 Query: 530 GIRLSALFALGGAQGLIGWWMVKSGLEEPTSEYVQPRVSPYRLATHLTSAFIIYCGILWT 351 G++LS LFALG QG IGWWMVKSGLEEP SEY QPRVSPYRLA HLTSAF IYCG+ WT Sbjct: 210 GVQLSGLFALGAGQGFIGWWMVKSGLEEPPSEYSQPRVSPYRLAAHLTSAFAIYCGLFWT 269 Query: 350 ALSVVMPDPPTGSMSWVNGAAKIRKLAIPVSAVVGITAISGAFVAGNDAGHAYNSFPKMG 171 ALSVVMP+PP S++WV GAAK++KLA+PVS +VGITAISGAFVAGNDAG A+N+FPKMG Sbjct: 270 ALSVVMPEPPAESLAWVRGAAKVKKLALPVSLIVGITAISGAFVAGNDAGRAFNTFPKMG 329 Query: 170 DSWIPEDVFSMEPFVRNFFENTSTVQLNHRILAATTLLSVGGLWLAARKIDMH 12 D+WIP+++F M+P +RNFFENT+TVQL+HR+LA TTL+++G +W RK+D+H Sbjct: 330 DTWIPDNIFEMKPLLRNFFENTATVQLDHRLLATTTLIAIGTMWWFTRKLDIH 382 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,515,819 Number of Sequences: 27288 Number of extensions: 267620 Number of successful extensions: 784 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 745241396 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822463|gb|BQ048487.1|BQ048487 952021B02.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (462 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g12550.1 hypothetical protein / predicted by genscan 83 7e-17 >At2g12550.1 hypothetical protein / predicted by genscan Length = 538 Score = 82.8 bits (203), Expect = 7e-17 Identities = 53/126 (42%), Positives = 72/126 (57%), Gaps = 2/126 (1%) Frame = -2 Query: 383 MLRAEVARRVGDGVEPECVGLIFGGRVLKDDPPASLR--EAGLKANAKVLSSLTSPDRXX 210 MLR EVA+R G++PE + LIF G++LKDD A+L + G+K N+K+LS + Sbjct: 1 MLRDEVAKR--SGLDPESIKLIFAGKILKDDGDATLTLSQLGIKENSKILSCRQAAPEEG 58 Query: 209 XXXXXXXXXXXXXXXXXKLVRLWEAAKALSQRHTDGSYLAEEDYNLDLEDQSGQKVMFGS 30 L R+ AA ALS+RH DGS L +DYN++LEDQ G KV FG+ Sbjct: 59 KSIMAEEERARR------LSRVKAAATALSKRHADGS-LPIQDYNIELEDQGGHKVQFGT 111 Query: 29 VDDKKA 12 D+ A Sbjct: 112 ETDQSA 117 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,420,932 Number of Sequences: 27288 Number of extensions: 149271 Number of successful extensions: 711 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 702 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 560070056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822413|gb|BQ048437.1|BQ048437 1091008B10.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (576 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g34640.1 expressed protein / ; supported by full-length cD... 82 3e-16 >At1g34640.1 expressed protein / ; supported by full-length cDNA: Ceres: 10855. Length = 110 Score = 81.6 bits (200), Expect = 3e-16 Identities = 33/84 (39%), Positives = 53/84 (62%) Frame = +1 Query: 286 RKAAATYGFGILAIAGVLLPDWEFFDRDYSQWLTPMPASRRTXXXXXXDREHDVWKFKPY 465 +K TY GI I G+LLPDW+FFDR +S+W P+ A R+ R+ +F+ Y Sbjct: 29 KKTVVTYAVGISLIGGILLPDWDFFDRSFSRWGYPVTAEERSAALA---RKSHPSRFRVY 85 Query: 466 PLRVAMLTTIYGFGLHKWWTYVSS 537 P+R+ + T+YG+ +++WW +VS+ Sbjct: 86 PMRMVLYGTVYGYAVYRWWMFVSN 109 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,964,932 Number of Sequences: 27288 Number of extensions: 150511 Number of successful extensions: 404 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 386 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 403 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 868297828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822319|gb|BQ048343.1|BQ048343 1091006G06.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (628 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21150.1 putative protein / ribophorin II precursor, Homo ... 282 1e-77 >At4g21150.1 putative protein / ribophorin II precursor, Homo sapiens, PIR2:B26168; supported by cDNA: gi_16604453 Length = 691 Score = 282 bits (722), Expect(2) = 1e-77 Identities = 133/193 (68%), Positives = 162/193 (83%) Frame = +1 Query: 49 KLCLSFQLTTPLGHTFKPHQVFLKLRHESKVEHLFVVPGSARQFKIVLDFLGLVEKFYYL 228 KL LSFQLTTPLG+ FKPHQ F KL+HES+VEH+F+V S ++ ++VLDFLGLVEK YYL Sbjct: 463 KLRLSFQLTTPLGNAFKPHQAFFKLKHESQVEHIFLVKTSGKKSELVLDFLGLVEKLYYL 522 Query: 229 SGRYDLELTVGDAVMENSFLRPLGHLELDLPDAPEKAPRPPAQAVDPFSKFGPKAEISHI 408 SG+Y+++LT+GDA MENS L +GH+ELDLP+ PEKA RPP Q+ +P+S++GPKAEISHI Sbjct: 523 SGKYEIQLTIGDASMENSLLSNIGHIELDLPERPEKATRPPLQSTEPYSRYGPKAEISHI 582 Query: 409 FRAPEKRPPKELSLAFTGLTLLPFIGFLIGLVRLGVNLKNFPSLPGPAAFASLFHAGIGA 588 FR PEK P K+LSL F G+ +LPFIGFLIGL RLGVN+K+FPS G A A LFH GIGA Sbjct: 583 FRIPEKLPAKQLSLVFLGVIVLPFIGFLIGLTRLGVNIKSFPSSTGSAISALLFHCGIGA 642 Query: 589 VLMLYVLFWIKLD 627 VL+LYVLFW+KLD Sbjct: 643 VLLLYVLFWLKLD 655 Score = 25.4 bits (54), Expect(2) = 1e-77 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 3 LLKDTKVSLSANHLQ 47 L KD VSLSANHLQ Sbjct: 448 LTKDGAVSLSANHLQ 462 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,274,209 Number of Sequences: 27288 Number of extensions: 317338 Number of successful extensions: 1028 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 995 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1027 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1008438668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822297|gb|BQ048321.1|BQ048321 1091006D01.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (617 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39580.1 unknown protein / 110 6e-25 >At2g39580.1 unknown protein / Length = 1567 Score = 110 bits (275), Expect = 6e-25 Identities = 67/184 (36%), Positives = 106/184 (57%), Gaps = 4/184 (2%) Frame = +1 Query: 58 EWYEHCIREHAAIHAL-ELEKSSS-STDAQTRATFSLIIGYLADHCNLPTRELLSRRFCQ 231 E + HC+REHA + EL+ + S + Q R L+ YL +LP +E LS +F Sbjct: 1334 EHFMHCLREHAVFQLINELQATGEFSINLQMR----LLNSYLDRASSLPVKEPLSWKFIS 1389 Query: 232 N-IKKHRLRQLIDDTIGSVPADSSLINSVLEVCFGPSLLPKSISDVKYLVDFVETVMEAL 408 N +K R+R+L+ + + V ++ ++N VLE GPSL+P+ +S K LVDFVET++ + Sbjct: 1390 NSAEKPRVRKLVTNLLAPVSSELFVVNVVLEAWHGPSLVPEKLSKQKELVDFVETILGLV 1449 Query: 409 PANYRLGLAVGGFVAK-HFTGYGAASTGTRFWASSVLINAIFRAVPVAPESVWLEGAGLL 585 P+NY L L+V + K +S+G FWA L + I A+PVAPE +W+E ++ Sbjct: 1450 PSNYPLALSVSKLLRKEEKQSDSGSSSGIHFWAGLNLASTISCAIPVAPEYIWVEAGEIV 1509 Query: 586 EKLH 597 ++ Sbjct: 1510 SDIN 1513 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,167,687 Number of Sequences: 27288 Number of extensions: 305127 Number of successful extensions: 827 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 825 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 981665960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822280|gb|BQ048304.1|BQ048304 1091005H05.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (559 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02310.1 eceriferum3 (CER3) / 231 2e-61 >At5g02310.1 eceriferum3 (CER3) / Length = 795 Score = 231 bits (588), Expect = 2e-61 Identities = 109/182 (59%), Positives = 134/182 (72%) Frame = +1 Query: 4 LDLILQDESVHMLALKWSQHFCEEYNPRKYRGTLFSTPAVPFRLMQLPDVYQVLLERYIK 183 +D+IL DE + W QHF EY + + +L TP VPF+LM+LP++YQ LL+R IK Sbjct: 610 IDIILNDELLRSSTQIWLQHFQREYRVNRVKRSLCITPVVPFQLMKLPNLYQDLLQRCIK 669 Query: 184 MQCPDCGSVPDEPALCLLCGKLCSPSWKPCCRTGKCQNHALQCGAGIGIFLLVRKTTILL 363 +C +C V +EP LCLLCG LCSP W PCCR C NHA+ CGAG G+FLL+R+TTILL Sbjct: 670 KRCVNCTKVIEEPVLCLLCGSLCSPIWSPCCRESGCPNHAITCGAGTGVFLLIRRTTILL 729 Query: 364 QRSARLTFWPSLYLDAFGEEDNEMHRGKPLYLSQERYTSLTYLVASHSLDRTSEVLRQTT 543 QR AR + WPS YLD FGEED +M RGK LYL++ERY +LTYLV SH LDR+S+VL QTT Sbjct: 730 QRFARQSPWPSPYLDTFGEEDIDMIRGKRLYLNEERYAALTYLVGSHGLDRSSKVLGQTT 789 Query: 544 IG 549 IG Sbjct: 790 IG 791 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,996,066 Number of Sequences: 27288 Number of extensions: 295016 Number of successful extensions: 765 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 765 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 826050704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822270|gb|BQ048294.1|BQ048294 1091005G06.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (596 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g47570.1 expressed protein / ;supported by full-length cD... 129 1e-30 >At5g47570.1 expressed protein / ;supported by full-length cDNA: Ceres:12344. Length = 125 Score = 129 bits (323), Expect = 1e-30 Identities = 58/93 (62%), Positives = 66/93 (70%) Frame = +2 Query: 116 MGLPVGRHIVPDKPLPVNDELVWDNGTPFPEPCIDRLAPHIGKYEXXXXXXXXXXXXXXX 295 MGLPVG+HIVPDKPL VNDEL+WDNGT FPEPCIDR+A +GKYE Sbjct: 33 MGLPVGKHIVPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALAWLSGGLGFFVGL 92 Query: 296 XXXXVVNDKASNIPYTPKVYPYDNLRAELGDRP 394 V+NDKAS +P+TP+VYPYDNLR ELG P Sbjct: 93 GLLAVLNDKASKVPFTPRVYPYDNLRVELGGEP 125 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,423,261 Number of Sequences: 27288 Number of extensions: 225293 Number of successful extensions: 720 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 930958496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822251|gb|BQ048275.1|BQ048275 1091005E09.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (557 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63440.1 expressed protein / ; supported by cDNA: gi_1622... 300 3e-82 >At5g63440.1 expressed protein / ; supported by cDNA: gi_16226477_gb_AF428410.1_AF428410 Length = 205 Score = 300 bits (769), Expect = 3e-82 Identities = 139/168 (82%), Positives = 159/168 (93%) Frame = +3 Query: 54 MPKRTTHTYSSEDALPEGPESDLFVYYCKHCASHVLITDTQLQKMPKRKTDRAHVLDKAK 233 MPKRTTHTYSSEDA P+GP+SDLFVYYCKHC SHVLITDTQLQKMPKRKTDR++VLDK Sbjct: 1 MPKRTTHTYSSEDAAPDGPDSDLFVYYCKHCGSHVLITDTQLQKMPKRKTDRSNVLDKKT 60 Query: 234 HLSRLNVKEAGKVMLKRGEGKLEKQFRMSCVGCDLFVCYRSEEDLEVAPFIYVIDGALSS 413 HL+RLNV E GKV+LKRGEGK+E+QFRM+C+GC+LFVCYR+EE+LE A FIY++DGALS+ Sbjct: 61 HLARLNVSEGGKVLLKRGEGKMERQFRMNCIGCELFVCYRAEENLETASFIYIVDGALSA 120 Query: 414 VAAETNPHDAPVPPCITQLEGGVVQVAIEVEDRAQRSAVTRVNADDVR 557 VAAETNP DAPVPPCI+QL+GG+VQVAIEVEDRAQRSA+TRVNADDVR Sbjct: 121 VAAETNPQDAPVPPCISQLDGGLVQVAIEVEDRAQRSAITRVNADDVR 168 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,016,676 Number of Sequences: 27288 Number of extensions: 221326 Number of successful extensions: 862 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 826050704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822138|gb|BQ048162.1|BQ048162 1091003G01.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (522 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02100.1 hypothetical protein / predicted by genscan; supp... 196 8e-51 >At1g02100.1 hypothetical protein / predicted by genscan; supported by cDNA: gi_18377693 Length = 332 Score = 196 bits (497), Expect = 8e-51 Identities = 95/141 (67%), Positives = 117/141 (82%) Frame = +1 Query: 100 VQATNDDAAVSKLSCVNKGYMKDDYVRXFVRRPTRRAPIINRGYYARWSVLRTLLHQFLN 279 VQATNDDA+ SKLSCV KGYMKDDYV FV+RP RR+PIINRGY++RW+ R L+ QFL Sbjct: 11 VQATNDDASASKLSCVKKGYMKDDYVHLFVKRPVRRSPIINRGYFSRWAAFRKLMSQFLL 70 Query: 280 AGKNSNNDKPKQILSLGAGFDTTFFQLQDEGMAPHCYVELDFKEVTSKKAAIINHYSEMK 459 +G +S KQILSLGAGFDTT+FQL DEG P+ YVELDFKEVTSKKAA+I + S+++ Sbjct: 71 SGTSSK----KQILSLGAGFDTTYFQLLDEGNGPNLYVELDFKEVTSKKAAVIQNSSQLR 126 Query: 460 EKLGSEASISIEKGEVISTHY 522 +KLG+ ASISI++G+V+S HY Sbjct: 127 DKLGANASISIDEGQVLSDHY 147 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,311,988 Number of Sequences: 27288 Number of extensions: 174958 Number of successful extensions: 437 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 436 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 729494100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822099|gb|BQ048123.1|BQ048123 1091003B11.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (501 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g45360.1 F-box protein family / ;supported by full-length... 219 6e-58 >At5g45360.1 F-box protein family / ;supported by full-length cDNA: Ceres:36901. Length = 316 Score = 219 bits (558), Expect = 6e-58 Identities = 101/155 (65%), Positives = 124/155 (79%), Gaps = 1/155 (0%) Frame = +3 Query: 39 GLFSNVPPELFLQIFKFLSSEDLISCALVCRFMNAAASDETLWRRLYCMRWGLA-SNAKF 215 G+F+NVP ELF I KFLSSEDL+SC+LVC+F+N AA+DE+LWRRLYC+RWGL + K Sbjct: 69 GVFTNVPTELFRHILKFLSSEDLVSCSLVCKFLNFAAADESLWRRLYCIRWGLTLPSRKL 128 Query: 216 RECAWKNLYIQRDREDMVEFVRNTPTEFKEYYIQMQAAKRSQAPRPSEVNDDKVMLDKTV 395 RE AWK LYI RD +DM+E VR P++FKEYY+ MQAAKRSQAP PS++ DD+++LD TV Sbjct: 129 RESAWKKLYIDRDEQDMIELVRTCPSDFKEYYVHMQAAKRSQAPLPSQMVDDRIILDNTV 188 Query: 396 ADQVSSWKNSRGLTDEAVKGHSCSGNTCSYTQIGD 500 +QVS WK S+GLTD+AV GH C G CSY QI D Sbjct: 189 LEQVSLWKKSKGLTDKAVTGHICLGTKCSYHQIDD 223 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,605,477 Number of Sequences: 27288 Number of extensions: 218298 Number of successful extensions: 779 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 778 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 666451400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822033|gb|BQ048057.1|BQ048057 1091002A11.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (582 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g17370.1 putative protein / 292 7e-80 >At4g17370.1 putative protein / Length = 364 Score = 292 bits (748), Expect = 7e-80 Identities = 145/194 (74%), Positives = 164/194 (83%) Frame = +1 Query: 1 LCDAIIVSSPNMTHYEILMDIICHREPQHILVEKPLCTTVQDCKKVIEAAKQRPEIVVQV 180 LCD I+VSSPNMTH++ILMDII + +P H+LVEKPLCTTV DCK+V+EAAK+R ++VVQV Sbjct: 77 LCDVIVVSSPNMTHHQILMDIINYSKPHHVLVEKPLCTTVADCKQVLEAAKKRSDMVVQV 136 Query: 181 GLEYRYMPPVAKLIDIVKSGTLGQVRMVAIREHRFPFLVKVNNWNRFNCNSGGTLVEKCC 360 GLEYRYMPPVAKLI+ VK G V+MVAIREHRFPFLVKV N TLVEKCC Sbjct: 137 GLEYRYMPPVAKLIEQVKGRDFGNVKMVAIREHRFPFLVKVG----LNKMGLWTLVEKCC 192 Query: 361 HFFDLMILFAAANPVRVMASGAIDVNHKNEVYDGQVPDIIDNAYVIVEFDNGSRGMLDLC 540 HFFDLM LFA ANPV VMASG +DVNHK+EVY G+VPDIIDNAYVI+EFDNG RGMLDLC Sbjct: 193 HFFDLMRLFAGANPVCVMASGGMDVNHKDEVYGGKVPDIIDNAYVIIEFDNGCRGMLDLC 252 Query: 541 MFAEGSRNKQEICV 582 MFAEGS+N+QEI V Sbjct: 253 MFAEGSKNEQEISV 266 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,936,220 Number of Sequences: 27288 Number of extensions: 272882 Number of successful extensions: 846 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 845 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 886200876 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19821883|gb|BQ047907.1|BQ047907 952045H02.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (678 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30990.1 putative protein / probable membrane protein YBL0... 96 2e-20 >At4g30990.1 putative protein / probable membrane protein YBL004w, yeast, PIR2:S45734 Length = 2138 Score = 95.9 bits (237), Expect = 2e-20 Identities = 67/180 (37%), Positives = 104/180 (57%), Gaps = 11/180 (6%) Frame = +3 Query: 12 NLVPAIFSILTVKTASGSITTYALEFIENXXXXXXXXXXXXEHLVKKVVLQHMDVLIHSL 191 +LVP IFSILTV TAS +I + AL+FIEN E++++ V +++ LI+SL Sbjct: 1159 SLVPDIFSILTVTTASEAIKSSALKFIENLLCLDNVLGED-ENMIRGFVDPYIEALINSL 1217 Query: 192 HD-FVNHRKELNRRSGTWLGQRELRLFKLLLNYITDPSTADKFIDLILPFFSK--KD--- 353 H F+ L R+S + G+RE+++ KLL + D S K++D++L F +K KD Sbjct: 1218 HSLFIGDI--LKRKSVKYHGEREIKILKLLSKRMQDRSHVMKYLDVLLSFLNKSVKDPGM 1275 Query: 354 -----LNSDDCLEALCVVRGIIQNLRCKVSEKVLNALNPLLAIVGLEPRLCICDIYAGLS 518 L +D EAL ++ II L + + K++N ++PLL L+ RLCICD+ L+ Sbjct: 1276 VSLLLLLNDIRREALLAIQDIIAYLGMESTSKIINTVSPLLVDAELDVRLCICDLLESLA 1335 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,907,667 Number of Sequences: 27288 Number of extensions: 243280 Number of successful extensions: 548 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1147706292 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19821870|gb|BQ047894.1|BQ047894 952045F11.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (531 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27930.1 expressed protein / ;supported by full-length cDN... 220 4e-58 >At3g27930.1 expressed protein / ;supported by full-length cDNA: Ceres:103959. Length = 425 Score = 220 bits (560), Expect = 4e-58 Identities = 102/169 (60%), Positives = 134/169 (78%), Gaps = 2/169 (1%) Frame = -2 Query: 530 HLVVQRRVKNPFEDDQVVGITNYIDFGLELAAKVDKDKV--SGDGNSFQLAASWQANKNF 357 H+VVQRRV+NPFE++QVVGITNYIDFG EL ++VD K + + Q+AASWQANKNF Sbjct: 256 HVVVQRRVQNPFEENQVVGITNYIDFGFELQSRVDDSKTPPNAPDSLLQVAASWQANKNF 315 Query: 356 LLKGKLGPSTSSVALAFKSWWRPSFTFSVTAVNDHSKGTTSYGFGLRVEDLRRASYQRAD 177 LLKGK+G +S+++LAFKSWW+PSF F+++A +H G GFGLRV++LR ASYQRAD Sbjct: 316 LLKGKVGAHSSTLSLAFKSWWKPSFAFNISATTNHRTGNVQCGFGLRVDNLREASYQRAD 375 Query: 176 PNYVMLTPSKEHLAPGVLREYGKRPMFQTQIDSGNYDHLPTELKPLGRI 30 PN+VMLTP+KEHLA G++ + GKRPM+Q +D+ N+ LP EL+P +I Sbjct: 376 PNFVMLTPNKEHLAEGIVWKMGKRPMYQADVDAENFSELPKELRPSQKI 424 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,098,610 Number of Sequences: 27288 Number of extensions: 259313 Number of successful extensions: 644 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 631 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 643 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 745241396 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19821832|gb|BQ047856.1|BQ047856 952045B09.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (621 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g08960.1 hypothetical protein / similar to hypothetical pr... 228 3e-60 >At3g08960.1 hypothetical protein / similar to hypothetical proteins: GB:S61997, [Saccharomyces cerevisiae], GB:CAA22859 [Schizosaccharomyces pombe] Length = 754 Score = 228 bits (580), Expect = 3e-60 Identities = 106/198 (53%), Positives = 139/198 (69%) Frame = +3 Query: 27 SLEQRKKNFAAVASDMLKVILSGDRVVLLCNILVRRYFIFTAKDLEEWSENPESFHHEQN 206 + EQRKKN + ++ +L +R+VLLCN+LVRRYF+ TA DLEEW +NPESFHHEQ+ Sbjct: 297 TFEQRKKNASNTVGGIVSSLLPNERIVLLCNVLVRRYFVLTASDLEEWYQNPESFHHEQD 356 Query: 207 LVQWTEKKRPCAEALFIVIFEKYREV*TFKFSLWL*VYSML*CSHDHVSLQLLAPVVVSV 386 ++QWTEK RPCAEAL++V+FE Y QLL P+VVS+ Sbjct: 357 MIQWTEKLRPCAEALYMVLFENYS--------------------------QLLGPIVVSI 390 Query: 387 LREAMAISPPQETEVTAGMLLKDASYTAAGHVYYELSNYLSFNEWLHGSLSIEISNHHPN 566 L+EAM PP TE+T +LLKDA+Y A +VYYELSNYL+F +W +G+LS+E+SN HPN Sbjct: 391 LQEAMNNCPPSVTEITPALLLKDAAYAATAYVYYELSNYLNFRDWFNGALSLELSNDHPN 450 Query: 567 MRIIRRKIALLLGHWISE 620 RII RK+A++LGHW+SE Sbjct: 451 RRIIHRKVAMILGHWVSE 468 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,648,969 Number of Sequences: 27288 Number of extensions: 248039 Number of successful extensions: 705 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 704 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 990590196 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19821810|gb|BQ047834.1|BQ047834 952016H01.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (441 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g68900.1 hypothetical protein / predicted by genscan 155 6e-39 >At1g68900.1 hypothetical protein / predicted by genscan Length = 656 Score = 155 bits (393), Expect = 6e-39 Identities = 79/146 (54%), Positives = 106/146 (72%) Frame = +3 Query: 3 DANQKWTYEQAVEFGSRVQSLHLEYIEEPVSSVYDLIKFCEKNVLPVALDETIDNLRGDV 182 DAN +WT+E+A EFG V S +L+YIEEPV + DLI+F E+ LPVALDET+D+ Sbjct: 151 DANCRWTFEEAREFGLLVNSCNLKYIEEPVQNKDDLIRFHEETGLPVALDETLDDFEECP 210 Query: 183 ICKLHQFVHPGIIALVIKPSVVGGFENAAHIAKWAQLHDKMAVISSTYESSIGLASYIQX 362 + L ++ HPGI+A+VIKPSVVGGFENAA IA+WAQ H KMAVIS+ YES +GL++YI Sbjct: 211 LRMLTKYTHPGIVAVVIKPSVVGGFENAALIARWAQQHGKMAVISAAYESGLGLSAYILF 270 Query: 363 AHYVDQQSSIVSRIRNKDTCRATAHG 440 A Y++ ++ S + + T + AHG Sbjct: 271 ASYLEMENVKASTEQKQGTPPSVAHG 296 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,947,269 Number of Sequences: 27288 Number of extensions: 167824 Number of successful extensions: 496 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 494 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 507397856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770567|gb|BQ035288.1|BQ035288 952078H09.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (588 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60640.1 hypothetical protein / predicted by genemark.hmm 70 6e-13 >At1g60640.1 hypothetical protein / predicted by genemark.hmm Length = 325 Score = 70.5 bits (171), Expect = 6e-13 Identities = 48/179 (26%), Positives = 82/179 (44%), Gaps = 35/179 (19%) Frame = +2 Query: 41 EDNSWNDVDGASIDDDEHSSPRDEERHEISLPIMKSSGANADSAKS--------ADNTDD 196 + +S +D S D D + ++ E S+ + G ++ +S D+ DD Sbjct: 13 DKDSGSDSSCFSSDSDPETEESEQSEEEDSVAEVSEDGDDSGDDESPAAGEDADVDDGDD 72 Query: 197 AVDAD--------------------------FPNCILKCKSVFKCKLCPRIMCLNVEMVK 298 DAD C+++ KSV+KC+ CP ++CLN ++ Sbjct: 73 NSDADDYGGTLEKMSMNRFLEEPPEEEEENYILGCMIQSKSVYKCRYCPTVVCLNENTMQ 132 Query: 299 IHLKSKRHARSEKLLGEGRLKLMLNSDGELE-EEQETHAERHARTIALSQQVQKQKKDS 472 H+ SK+HAR EKL+ EG+++ +LE QE + + R+ ++ QKQ+KDS Sbjct: 133 AHVSSKKHARMEKLVKEGKIRTDDEEVDDLETASQEKEKKGNRRSQRQGKRSQKQEKDS 191 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,419,062 Number of Sequences: 27288 Number of extensions: 188586 Number of successful extensions: 779 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 769 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 904103924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770516|gb|BQ035237.1|BQ035237 952078C09.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (620 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22590.1 unknown protein / ; supported by cDNA: gi_17529301 252 1e-67 >At3g22590.1 unknown protein / ; supported by cDNA: gi_17529301 Length = 415 Score = 252 bits (644), Expect = 1e-67 Identities = 123/172 (71%), Positives = 148/172 (85%), Gaps = 1/172 (0%) Frame = +3 Query: 75 LGDGVVPIILVPSASQTLITIYNVKEFLEDGVFVPSEERMRATKGGKPESVTVQKKLIRT 254 +G+GV PIILVPSA QTLITIYNVKEFLEDGV++P++ + + KG KP+ +TVQKK R Sbjct: 248 IGEGV-PIILVPSAFQTLITIYNVKEFLEDGVYIPNDVKAKEMKGLKPDCITVQKKFSRD 306 Query: 255 -ERAGGAGGAVSFEVRDKPASLKSDDWGRVVAVFVLGKEWQFKDWPFKDHVEIFNRVIGF 431 ER ++EVRDKP++LK DDW RVVAVFVLGK+WQFKDWPFKDHVEIFN++IGF Sbjct: 307 RERV-----VTAYEVRDKPSALKPDDWDRVVAVFVLGKDWQFKDWPFKDHVEIFNKIIGF 361 Query: 432 YVRFEDDSVEAAKVVKQWNVKIISISKNKRHQDRTAALEVWERLEEFMRART 587 ++RFEDDS+E+AK VKQWNVKIISISKNKRHQDR AALEVWE+LEEF+R+R+ Sbjct: 362 FLRFEDDSIESAKTVKQWNVKIISISKNKRHQDRAAALEVWEKLEEFVRSRS 413 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,831,025 Number of Sequences: 27288 Number of extensions: 318345 Number of successful extensions: 1398 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1230 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1369 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 990590196 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770512|gb|BQ035233.1|BQ035233 952078C01.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (514 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g45150.1 hypothetical protein / predicted by genemark.hmm 198 2e-51 >At1g45150.1 hypothetical protein / predicted by genemark.hmm Length = 687 Score = 198 bits (503), Expect = 2e-51 Identities = 88/113 (77%), Positives = 102/113 (89%) Frame = -2 Query: 513 TGFLYWGSNCYEKAMIPSAEICFRRGLPPGDGVLFYPGEVFSSSHEPVASTRLERILSGM 334 TGFLYWG+NCYEKA +PSAE+ FRRGLPPGDGVL+YPGEVFSSS EPVAS RLER+LSG+ Sbjct: 573 TGFLYWGANCYEKATVPSAEVKFRRGLPPGDGVLYYPGEVFSSSSEPVASLRLERLLSGL 632 Query: 333 QDIEYLKLYSSRYGREEGLALIEKTGMYLGPDRYTLDHGPVDVMRGEVYRTCR 175 QD EYLKLY S+YGREE + L+EKTG+Y GP+RYTL+H P+DV+RGEVY TCR Sbjct: 633 QDYEYLKLYESKYGREEAMGLLEKTGVYTGPERYTLEHRPIDVLRGEVYNTCR 685 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,254,415 Number of Sequences: 27288 Number of extensions: 283462 Number of successful extensions: 701 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 702475800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770508|gb|BQ035229.1|BQ035229 952078B08.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (525 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g15352.1 Expressed protein / ; supported by cDNA: gi_14794... 83 1e-16 At1g53030.1 cytochrome C oxidase assembly protein, putative / ... 79 1e-15 >At3g15352.1 Expressed protein / ; supported by cDNA: gi_14794881_gb_AF349684.1_AF349684 Length = 74 Score = 82.8 bits (203), Expect = 1e-16 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 294 ICCACPDTKRLRDECVVEHGEPACTKWIEAHKRCLRAE 181 ICCACPDTK+LRDEC+VEHGE ACTKWIEAHK CLRAE Sbjct: 33 ICCACPDTKKLRDECIVEHGESACTKWIEAHKICLRAE 70 >At1g53030.1 cytochrome C oxidase assembly protein, putative / similar to GB:5851903 from [Rattus norvegicus];supported by full-length cDNA: Ceres:11496. Length = 72 Score = 79.0 bits (193), Expect = 1e-15 Identities = 32/38 (84%), Positives = 35/38 (91%) Frame = -1 Query: 294 ICCACPDTKRLRDECVVEHGEPACTKWIEAHKRCLRAE 181 ICCACPDTK+LRDEC+VEHGE ACTKWIEAH CLR+E Sbjct: 31 ICCACPDTKKLRDECIVEHGESACTKWIEAHILCLRSE 68 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,703,127 Number of Sequences: 27288 Number of extensions: 162809 Number of successful extensions: 512 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 727283772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770494|gb|BQ035215.1|BQ035215 952078A05.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (556 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g12530.1 unknown protein / 213 5e-56 >At3g12530.1 unknown protein / Length = 191 Score = 213 bits (542), Expect = 5e-56 Identities = 104/146 (71%), Positives = 120/146 (81%) Frame = +3 Query: 117 VAEDEIVEIVPNIRMDALNMICGDFGPFFPQIPTKVPLWLAVALKKRSKCTIRTPDWMTV 296 +AEDE+VEIVPN+ M+ LN I GDFG F PQIPTKVPLWLAVALK+R KCT R P WM+V Sbjct: 1 MAEDELVEIVPNMNMEQLNFISGDFGRFIPQIPTKVPLWLAVALKRRGKCTFRPPGWMSV 60 Query: 297 DRLTQVLEAERESPREFQPLPFHYIEISKLLFDHARDDISDAYLVRSLIEDIRDVRFHKV 476 D LTQ+LEAERES FQ LPF Y+EI++LLFDHARDDI D Y+VRSL+EDIRDVR HK+ Sbjct: 61 DNLTQILEAERESQSTFQALPFSYVEIARLLFDHARDDIPDMYMVRSLVEDIRDVRLHKL 120 Query: 477 ETGLETISGRTHAVKLKNLSAMEVNI 554 ET L + G T AVK+ N+SAMEVNI Sbjct: 121 ETNLGSFQG-TSAVKISNVSAMEVNI 145 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,329,152 Number of Sequences: 27288 Number of extensions: 235621 Number of successful extensions: 762 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 817071892 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770448|gb|BQ035169.1|BQ035169 952077C05.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (669 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g04690.1 unknown protein / ; supported by cDNA: gi_19715625 228 3e-60 >At2g04690.1 unknown protein / ; supported by cDNA: gi_19715625 Length = 210 Score = 228 bits (580), Expect = 3e-60 Identities = 106/165 (64%), Positives = 133/165 (80%) Frame = +1 Query: 64 KPSPSEATATARWLAAQNTWGVLSTISSDLSGAPFGNVVSYSDGVPGEGRGIPYFYLTTL 243 KP + A+ARWL +QN+WGVLST+S D GAPFGNVVS+SDG+P +G GIPYFYLTTL Sbjct: 36 KPDRHDYAASARWLVSQNSWGVLSTLSVDHKGAPFGNVVSFSDGLPEKGNGIPYFYLTTL 95 Query: 244 DPSARDALEDERTSFTLSEFPLGTCGEIDPENPTCAKLTLNGKLKMVDLQSSEADLAKSA 423 DP+AR+AL+D+R S +SE PLGTC DP NPTC+KLTL GKL +++ S EA++AK A Sbjct: 96 DPTARNALKDQRASLAISESPLGTCTR-DPMNPTCSKLTLTGKLLILEGGSEEAEVAKKA 154 Query: 424 LFTKHPEMKDWPKNHHFKIFKMEIENIFLIDWFGGPKPISPSQYL 558 LFTKHPEM DWPK+H F+ FK+EI +IFLI+W+GG KPI+ +YL Sbjct: 155 LFTKHPEMMDWPKDHDFRFFKLEIIDIFLINWYGGAKPITVDEYL 199 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,486,965 Number of Sequences: 27288 Number of extensions: 365133 Number of successful extensions: 886 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 858 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 884 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770364|gb|BQ035085.1|BQ035085 1091012C12.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (602 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77550.1 hypothetical protein / similar to GB:CAB55886 [Ho... 191 2e-49 >At1g77550.1 hypothetical protein / similar to GB:CAB55886 [Homo sapiens], GB:BAA09774 [Homo sapiens], GB:CAA87778 [Caenorhabditis elegans] Length = 883 Score = 191 bits (485), Expect = 2e-49 Identities = 105/204 (51%), Positives = 133/204 (64%), Gaps = 4/204 (1%) Frame = +3 Query: 3 LNLWGNKLRDPEKVMQEIRKCTKLKALWLNENPVLGKS---IDKAVLDGLSGLEIYNSHF 173 L+L GNK+ + V+QEI K LKALWLN+NPVL KS + +L G LEIYNS F Sbjct: 186 LSLIGNKIESADVVIQEIVKFKNLKALWLNDNPVLQKSERQMADEILQGCPSLEIYNSCF 245 Query: 174 TSKAGEWALGFCADIVGADNPCSSVESTLFGSIGTIDLSDRCIHKLP-EVFXXXXXXXXX 350 T G WALGFC DI G DNP + ++ ++DLS+R IH L + F Sbjct: 246 TPNYGLWALGFCGDIFGKDNPGCVQQDQPLCNVTSLDLSNRSIHNLVNKAFSVHEMPLLS 305 Query: 351 XXNVRGNPLDQISGDDLLKLFGGFTQLQELEVDIPGPLGNSAISILESLPNLSLLNGVDS 530 N+RGN LDQ S +LL++ F L LEVDIPGPLG +A+ ILESL NLSLLNGVD+ Sbjct: 306 HLNIRGNSLDQNSVGELLEVLKLFPSLSSLEVDIPGPLGINALEILESLSNLSLLNGVDT 365 Query: 531 SSIIESGKHIVDSALEPRLPEWSP 602 + I+E+GKH+VDS L+PR+PE +P Sbjct: 366 AKILETGKHVVDSMLQPRIPELNP 389 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,067,799 Number of Sequences: 27288 Number of extensions: 304032 Number of successful extensions: 926 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 886 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 923 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 948861544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770263|gb|BQ034984.1|BQ034984 1091011C12.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (533 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20835.1 hypothetical protein / 92 1e-19 >At2g20835.1 hypothetical protein / Length = 68 Score = 92.4 bits (228), Expect = 1e-19 Identities = 42/68 (61%), Positives = 52/68 (75%) Frame = -3 Query: 486 MVFFCFLVEQRRTVRSSKPAAGICSRCGGCASVADMETATRVCYLLTVHRRTWRAIICTF 307 M FCFLV+QR+ VR KPAAG+CSRCGG A VADM T+TR C + +R+ W+AI+C Sbjct: 1 MAIFCFLVDQRKKVRGRKPAAGLCSRCGGGAVVADMRTSTRFCG-VPFYRKAWKAIVCHI 59 Query: 306 CGAMLKSY 283 CGA+LKSY Sbjct: 60 CGAVLKSY 67 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,023,255 Number of Sequences: 27288 Number of extensions: 130775 Number of successful extensions: 528 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 527 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 754220208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770156|gb|BQ034877.1|BQ034877 1091010B08.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (580 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g45830.1 DNA-binding protein - like / DNA-binding protein... 264 3e-71 >At3g45830.1 DNA-binding protein - like / DNA-binding protein R kappa B, Homo sapiens, PIR:S52863 Length = 1298 Score = 264 bits (674), Expect = 3e-71 Identities = 126/187 (67%), Positives = 155/187 (82%) Frame = +1 Query: 10 KVQELKAQKSLNTISPSSDEARTYFQREEFLRYSIPDRAFCYTAADGEKSIVAPLRRGGG 189 + ++L+AQKSL+TI+ SS+EAR YF++EEFLRYSIPDRAF YTAADG+KSIVAPLRRGGG Sbjct: 1016 RFKDLRAQKSLSTITQSSEEARAYFRKEEFLRYSIPDRAFVYTAADGKKSIVAPLRRGGG 1075 Query: 190 KPTANARGHPMLLPDRPPHVTILCLVRDAASRLPARTGTRADVCTLLRDSQYLNHEEANK 369 KPT+ AR H ML +RPPHVTILCLVRDAA+RLP GTRADVCTL+RDSQY+ + ++ Sbjct: 1076 KPTSKARDHFMLKRERPPHVTILCLVRDAAARLPGSIGTRADVCTLIRDSQYIVEDVSDS 1135 Query: 370 EAAINQVVSGALDRLHYERDPCVLYDNDKKLWTYLHRGRXXXXXXXXGTSSTKKWKRPRR 549 + +NQVVSGALDRLHYERDPCV +D+++KLW YLHR R GTSSTKKWKRP++ Sbjct: 1136 Q--VNQVVSGALDRLHYERDPCVQFDSERKLWVYLHRDREQEDFEDDGTSSTKKWKRPKK 1193 Query: 550 DVSDAAE 570 + ++ E Sbjct: 1194 EAAEQTE 1200 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,684,280 Number of Sequences: 27288 Number of extensions: 237074 Number of successful extensions: 600 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 599 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 877249352 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770131|gb|BQ034852.1|BQ034852 1091009H04.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (568 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g15200.1 expressed protein / EST gb|H77143 comes from this... 182 8e-47 >At1g15200.1 expressed protein / EST gb|H77143 comes from this gene; supported by cDNA: gi_15293206_gb_AY051037.1_ Length = 423 Score = 182 bits (463), Expect = 8e-47 Identities = 88/136 (64%), Positives = 112/136 (81%), Gaps = 2/136 (1%) Frame = +3 Query: 3 ARVAAKAEEKRLELLYIQWTEHHKRLSNFLRTKAEPPIYYMPTKPIIDDPAIVEQNKEKV 182 ARVAAKAE+K+LELL++QW+EH K+LSNF+RTKAEP IYY P KP+ +D + VEQ KE+ Sbjct: 231 ARVAAKAEQKKLELLFLQWSEHQKKLSNFIRTKAEPRIYYAPVKPLEEDTSEVEQQKERT 290 Query: 183 FEEWKSMRRAELTQFQKQVEEQYLSNVERQLERIQNARNARKANGPG-NMQE-MDKELDT 356 F EWK+ RR E++++QK++EEQ L NVE++LER QNAR ARKAN G N+QE MDKEL+T Sbjct: 291 FLEWKAARRQEVSEYQKEIEEQCLGNVEKELERWQNARKARKANNEGMNLQETMDKELET 350 Query: 357 HRAEHGPKPRRVPEEG 404 HR EHGPK R++P G Sbjct: 351 HRMEHGPKKRKIPGGG 366 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,663,325 Number of Sequences: 27288 Number of extensions: 200261 Number of successful extensions: 722 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 721 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 841443256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770114|gb|BQ034835.1|BQ034835 1091009F04.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (622 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49970.1 putative protein / contains similarity to pyridox... 177 5e-45 >At5g49970.1 putative protein / contains similarity to pyridoxamine 5-phosphate oxidase;supported by full-length cDNA: Ceres:6244. Length = 466 Score = 177 bits (448), Expect = 5e-45 Identities = 77/119 (64%), Positives = 100/119 (83%) Frame = +1 Query: 1 WNEMNRQVRVEGSAEKVPEAESDKYFHSRPRGSQLGAIVSKQSTVIAGREVLQQDYKKLE 180 W +NRQVR+EG E++PE+ES+ YFHSRPRGSQ+GAIVSKQS+V+ GR VL +Y++L Sbjct: 348 WEILNRQVRIEGPVERIPESESENYFHSRPRGSQIGAIVSKQSSVVPGRHVLYDEYEELT 407 Query: 181 QKYSDGSLIPKPEYWGGYKLTPTLFEFWQGQQSRLHDRLQYSQREVDGSTVWHIERLSP 357 ++YSDGS+IPKP+ WGG++L P LFEFWQGQ SRLHDRLQYS ++V+G+ W I RL+P Sbjct: 408 KQYSDGSVIPKPKNWGGFRLKPNLFEFWQGQPSRLHDRLQYSLQDVNGNPAWKIHRLAP 466 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,333,754 Number of Sequences: 27288 Number of extensions: 315048 Number of successful extensions: 940 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 940 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 990590196 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19769779|gb|BQ034500.1|BQ034500 1091003A07.x2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (573 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g23090.1 Expressed protein / ; supported by full-length cD... 135 2e-32 >At2g23090.1 Expressed protein / ; supported by full-length cDNA: Ceres: 14468. Length = 78 Score = 135 bits (339), Expect = 2e-32 Identities = 65/78 (83%), Positives = 68/78 (86%), Gaps = 1/78 (1%) Frame = -3 Query: 445 MGGGNGQKSKMARERNLEKNKGA-KGSQLETNKKAMSIQCKVCMQTFMCTTTEVKCREHA 269 MGGGN QKS MAR +NLEK K A KGSQLE NKKAMSIQCKVCMQTF+CTT+EVKCREHA Sbjct: 1 MGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHA 60 Query: 268 EAKHPKTDVYQCFPHLKK 215 EAKHPK DV CFPHLKK Sbjct: 61 EAKHPKADVVACFPHLKK 78 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,619,154 Number of Sequences: 27288 Number of extensions: 264568 Number of successful extensions: 733 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 707 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 731 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 859346304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19769502|gb|BQ034223.1|BQ034223 1091006G07.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (431 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30820.1 Expressed protein / ; supported by full-length cD... 109 5e-25 >At4g30820.1 Expressed protein / ; supported by full-length cDNA: Ceres: 14193. Length = 178 Score = 109 bits (273), Expect = 5e-25 Identities = 52/87 (59%), Positives = 70/87 (79%) Frame = -2 Query: 430 LRRRIASIFNKTQEHFPTLKDYNDYLEEVEDMTFNLIEGIDVEEIEAKIARYQQENAEQI 251 +RRRI+ I+N+ +E FP+LKDYNDYLEEVE M F+LI+GI+VE IE KI RY +ENAEQI Sbjct: 16 VRRRISEIYNRREEEFPSLKDYNDYLEEVECMVFDLIDGINVEAIEQKIKRYSKENAEQI 75 Query: 250 YLSRAKRAEDLAAALKASRMNPVKAEA 170 ++RA++AE+L AAL A + P + +A Sbjct: 76 MINRARKAEELTAALAACKAKPPQTDA 102 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,779,324 Number of Sequences: 27288 Number of extensions: 169636 Number of successful extensions: 460 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 480215828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19437282|gb|BM953692.1|BM953692 952064H07.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (425 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g15140.1 expressed protein / ; supported by cDNA: gi_16930... 220 2e-58 >At3g15140.1 expressed protein / ; supported by cDNA: gi_16930516_gb_AF419612.1_AF419612 Length = 337 Score = 220 bits (560), Expect = 2e-58 Identities = 97/141 (68%), Positives = 116/141 (81%) Frame = +2 Query: 2 EQRTTEYIEGKYGKFGVDRVWHDTATPFKQVLQEFEDWLGNHNLWKKEQGGSLNRGAFVT 181 EQ +YIEGKYG+ GVDRVWHDTA PFKQV++EFE WL H+LW K+ LN AFVT Sbjct: 170 EQAINKYIEGKYGELGVDRVWHDTAIPFKQVVEEFEVWLAEHDLWDKDTDWGLNDAAFVT 229 Query: 182 CGNWDLKTKVPEQCKVSKINLPTYFMEWINLKDIYLNFYNRRATGMMTMMRELQLPIVGN 361 CGNWD+KTK+PEQC VS INLP YFMEWINLKD+YLNFY R A GM++MMR+ + ++G+ Sbjct: 230 CGNWDIKTKIPEQCVVSNINLPPYFMEWINLKDVYLNFYGREARGMVSMMRQCGIKLMGS 289 Query: 362 HHLGIDDSKNIARVVQRMLAD 424 HHLGIDD+KNI RVVQRML++ Sbjct: 290 HHLGIDDTKNITRVVQRMLSE 310 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,762,970 Number of Sequences: 27288 Number of extensions: 203981 Number of successful extensions: 601 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 600 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 472574128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19437058|gb|BM953468.1|BM953468 952062H09.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (487 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g29660.1 putative protein / predicted proteins, Arabidopsi... 128 2e-30 >At4g29660.1 putative protein / predicted proteins, Arabidopsis thaliana; supported by full-length cDNA: Ceres: 13465. Length = 103 Score = 128 bits (321), Expect = 2e-30 Identities = 53/83 (63%), Positives = 69/83 (82%) Frame = +3 Query: 27 YADRQFHKWEKTVLWDMVEPYRPPRSFAPLVGTYVAAFYTGVVGAAVTEQLYKEKYWEDH 206 YAD +++K+E+ +W+M+EPYR P++F L+ YVAAFYTGV+GAAVTEQLYKEK+WE+H Sbjct: 12 YADYKYNKFERFAVWEMIEPYRRPKTFTTLITIYVAAFYTGVIGAAVTEQLYKEKFWEEH 71 Query: 207 PGEAVPIMPPKFYWGPWRVMNGE 275 PG+ VP+M P FY GPWRV GE Sbjct: 72 PGKTVPLMKPVFYRGPWRVYRGE 94 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,494,443 Number of Sequences: 27288 Number of extensions: 190444 Number of successful extensions: 673 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 673 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 632337160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19437030|gb|BM953440.1|BM953440 952062E02.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (385 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g53710.1 cell division control protein, putative / similar... 65 8e-12 >At1g53710.1 cell division control protein, putative / similar to SP:P40986 from [Saccharomyces cerevisiae] Length = 393 Score = 65.5 bits (158), Expect = 8e-12 Identities = 36/84 (42%), Positives = 53/84 (62%), Gaps = 3/84 (3%) Frame = +2 Query: 35 RGSVVARATAGRHRLEPDSSIRVDMGSEMTSEDGGK---LARAGKSGARKVLQRLFRVIQ 205 +G+ V R+ A ++ E I + M S++ + GG + A KS + V+QR+ R I Sbjct: 312 KGNAVMRSAARKNASE---QIELVMDSDVNASAGGSDPLMRSASKSRTKLVIQRVIRTIM 368 Query: 206 SVLVIAALNAPLYMMLLFKDWIDR 277 V+VIAALN P+YMMLLFKDWI++ Sbjct: 369 MVIVIAALNVPIYMMLLFKDWIEQ 392 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,367,247 Number of Sequences: 27288 Number of extensions: 150729 Number of successful extensions: 477 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 11,516,596 effective HSP length: 87 effective length of database: 9,142,540 effective search space used: 365701600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19436955|gb|BM953365.1|BM953365 952061C12.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (499 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g04900.1 expressed protein / ;supported by full-length cDN... 223 5e-59 >At1g04900.1 expressed protein / ;supported by full-length cDNA: Ceres:98874. Length = 442 Score = 223 bits (567), Expect = 5e-59 Identities = 106/158 (67%), Positives = 132/158 (83%) Frame = +2 Query: 26 ALFSSGILAGNKPILVRDFVRSALYDPNHGYFSKRAGPVGVLDASIRFNQLEGRSAYIQH 205 A FS+ L G++P+LVRDF+ +ALYDP GYFS+R+ VGVL+ SI+FNQLEGR AY++ Sbjct: 29 AFFSTQKLIGDEPVLVRDFIHTALYDPIQGYFSQRSKSVGVLERSIKFNQLEGRKAYMKL 88 Query: 206 LDKLYKKHDIAWFTPVELFKPWYAYAIAASILRTANLSVPLKIYEIGGGSGTCAKCILDY 385 L+K+YK+ DI+WFTPVELFKPWYA+ IA +ILRT NLSVPLKIYEIGGGSGTCAK +LDY Sbjct: 89 LEKVYKQSDISWFTPVELFKPWYAHGIAEAILRTTNLSVPLKIYEIGGGSGTCAKGVLDY 148 Query: 386 MMLNAPPKVYNDMKYISVEISSSLAEKQLETVGEVQSH 499 +MLNAP ++Y +M Y S+EIS SLA+ Q ETV +V SH Sbjct: 149 IMLNAPERIYKNMSYTSIEISPSLAKIQKETVAQVGSH 186 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,794,768 Number of Sequences: 27288 Number of extensions: 261324 Number of successful extensions: 803 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 803 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 657445300 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19436953|gb|BM953363.1|BM953363 952061C10.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (563 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21820.1 putative protein / calmodulin-binding protein SHA... 103 6e-23 >At4g21820.1 putative protein / calmodulin-binding protein SHA1, Mus musculus,AF062378 Length = 1088 Score = 103 bits (257), Expect = 6e-23 Identities = 65/156 (41%), Positives = 90/156 (57%), Gaps = 15/156 (9%) Frame = -3 Query: 561 LVAAGAVDILLKQIYLLXRGIADQEVLMQVFLTLRNIARYSNLRQVLASTAESVEIIFHE 382 LVAAGA++ LL I R I DQ+V TL ++ARY + L +T S++ IF E Sbjct: 933 LVAAGAIEKLLTLIRSASRSIPDQQVSKHALSTLGHLARYPQMADELINTKGSIQTIFWE 992 Query: 381 LLR-------------NKADGFFIASDILKSLCESKEGRETVQALSHLIKRLRNLVHDLE 241 LLR NK + +FIASD+LK +C S +G E V+ L L+KRL LV +L Sbjct: 993 LLRSSFSSQVFFLSFKNKEEAYFIASDVLKKICSSHKGVEAVRKLPALVKRLHVLVEELT 1052 Query: 240 KKVELDKRN--GRTGAMKATNLRRLREAATLYHILT 139 +K ++KRN G+TG K+ RRL+EA L ++T Sbjct: 1053 RKANIEKRNVKGQTGKEKSE--RRLKEAIELVKLIT 1086 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,382,760 Number of Sequences: 27288 Number of extensions: 232133 Number of successful extensions: 665 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 664 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 832491732 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19436444|gb|BM952854.1|BM952854 952059F11.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (593 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14240.1 putative protein / various predicted proteins fro... 175 1e-44 >At5g14240.1 putative protein / various predicted proteins from D. melanogaster, H. sapiens and S. pombe;supported by full-length cDNA: Ceres:37589. Length = 256 Score = 175 bits (444), Expect = 1e-44 Identities = 83/121 (68%), Positives = 103/121 (84%), Gaps = 1/121 (0%) Frame = +1 Query: 88 GIPECGLLQNCLEELATRYPATKFVKIISTDCIPNYPDRNVPTILVYNNSAVKGTYVGLQ 267 G+ EC LL CL+EL +RYPATKFVKIISTDCIPNYPD N+PT+LVY++ A+KGT+VGL+ Sbjct: 131 GVAECSLLLGCLDELGSRYPATKFVKIISTDCIPNYPDCNLPTLLVYHHGAIKGTHVGLK 190 Query: 268 KFGGKRCTPESVALALCQSDPVLNDGHGG-SDSSRDNVIEGVRRKFIEKVVAQHEEREEE 444 F G+RCTPESVAL LCQS+PVLNDG GG DSSR+ V+ GVRR+FIE+VV HE+++ + Sbjct: 191 SF-GRRCTPESVALLLCQSEPVLNDGKGGDDDSSREAVMAGVRRQFIERVVKDHEDKDND 249 Query: 445 D 447 D Sbjct: 250 D 250 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,422,431 Number of Sequences: 27288 Number of extensions: 340978 Number of successful extensions: 1088 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1050 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1086 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 922006972 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Q