BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208500|gb|BQ134589.1|BQ134589 1091015E05.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (452 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g56345.1 RNA pseudouridylate synthase, putative / contains... 65 1e-11 >At1g56345.1 RNA pseudouridylate synthase, putative / contains Pfam profile: PF00849: RNA pseudouridylate synthase Length = 254 Score = 65.5 bits (158), Expect = 1e-11 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -3 Query: 447 RRDVKYGGVIEWDGVECEGHALHAESLSFVHPITGLPITLRSPLPPWA 304 R DVKY GV EW+G EGH LHAE LS HP+TG I +R+PLP WA Sbjct: 204 RGDVKYHGVYEWNGRTFEGHELHAECLSLDHPVTGDSIVIRAPLPYWA 251 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,636,735 Number of Sequences: 27288 Number of extensions: 230072 Number of successful extensions: 642 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 642 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 543640560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208494|gb|BQ134583.1|BQ134583 1091015D05.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (508 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11800.1 expressed protein / EST gb|F14156 comes from this... 147 4e-36 >At1g11800.1 expressed protein / EST gb|F14156 comes from this gene;supported by full-length cDNA: Ceres:16491. Length = 426 Score = 147 bits (370), Expect = 4e-36 Identities = 66/101 (65%), Positives = 83/101 (81%) Frame = -2 Query: 507 GPFPLQDGWTDAWVELKPGEDGWTYDTKANGMLSGNRKLQKRLDRFVCKLADFKMDSIEM 328 G FPL D W D W LKPG+ G+TYDTKAN MLSGNR LQKRLDR +C+L D+K+ IEM Sbjct: 324 GKFPLPDKWVDVWEVLKPGDLGFTYDTKANPMLSGNRALQKRLDRILCRLDDYKLGGIEM 383 Query: 327 IGKEAIPGVSYFKEKKIRKENQRIELPVFPSDHFGLVLTIT 205 +GKEAIPG+SY KEKK+R + +++ELPV PSDHFGL++T++ Sbjct: 384 VGKEAIPGLSYVKEKKVRGDIKKLELPVLPSDHFGLLVTLS 424 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,962,896 Number of Sequences: 27288 Number of extensions: 292592 Number of successful extensions: 827 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 827 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 684463600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208471|gb|BQ134560.1|BQ134560 1091015A04.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (443 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20320.1 expressed protein / ;supported by full-length cD... 132 6e-32 >At3g20320.1 expressed protein / ;supported by full-length cDNA: Ceres:17362. Length = 381 Score = 132 bits (333), Expect = 6e-32 Identities = 65/95 (68%), Positives = 82/95 (85%) Frame = -3 Query: 441 AEEMQPLLSEVNDSDLLKDVETIAKGLADASGDLRRLKSSMLTPENTDLIKQSIFTLIFT 262 AE+ QPLLSE DS LLK+VE + + L AS DLR++ SS++TPENT+LI++SI+TL++T Sbjct: 287 AEDAQPLLSEFRDSGLLKEVECLTRSLTQASDDLRKVNSSIMTPENTELIQKSIYTLVYT 346 Query: 261 LKNIESISSDISGFTGDETTRRNIKLLIKSLSRLL 157 LKN+ESISSDI GFTGDE TR+N+KLLIKSLSRLL Sbjct: 347 LKNVESISSDILGFTGDEATRKNLKLLIKSLSRLL 381 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,168,351 Number of Sequences: 27288 Number of extensions: 243022 Number of successful extensions: 2061 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1879 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 516458532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208415|gb|BQ134504.1|BQ134504 1091014C01.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (391 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44620.1 protein-tyrosine-phosphatase-like protein / prote... 106 4e-24 At3g44420.1 putative protein / predicted protein, Arabidopsis... 55 1e-08 >At3g44620.1 protein-tyrosine-phosphatase-like protein / protein-tyrosine-phosphatase - Schizosaccharomyces pombe, PIR:A55446 Length = 177 Score = 106 bits (264), Expect = 4e-24 Identities = 49/76 (64%), Positives = 56/76 (73%) Frame = -3 Query: 350 EQYAEDILNSFERWRRKEPLPDSAPNKVKLMCSYCKHHTESEVPDPYYGGPQGFEKVLDL 171 +Q EDIL ++ W+ + P A KVKLMCSYCK H + VPDPYYGG QGFEKVLDL Sbjct: 102 DQNKEDILKAYNVWKARGNFPPDADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKVLDL 161 Query: 170 LEDACESLLDSIVANN 123 LEDACESLLDSI A + Sbjct: 162 LEDACESLLDSITAQS 177 >At3g44420.1 putative protein / predicted protein, Arabidopsis thaliana Length = 235 Score = 55.1 bits (131), Expect = 1e-08 Identities = 27/58 (46%), Positives = 33/58 (56%) Frame = -3 Query: 344 YAEDILNSFERWRRKEPLPDSAPNKVKLMCSYCKHHTESEVPDPYYGGPQGFEKVLDL 171 +AEDIL ++ VKLMCSYCK H + V DPYYGG Q FEKV+ + Sbjct: 14 FAEDILKAYN---------------VKLMCSYCKKHNDKFVHDPYYGGAQSFEKVISI 56 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,871,441 Number of Sequences: 27288 Number of extensions: 187877 Number of successful extensions: 605 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 605 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 373725332 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208391|gb|BQ134480.1|BQ134480 1091020H03.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (503 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48720.1 putative protein / similar to unknown protein (gb... 76 1e-14 >At5g48720.1 putative protein / similar to unknown protein (gb|AAD20092.1) Length = 286 Score = 75.9 bits (185), Expect = 1e-14 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 6/56 (10%) Frame = -1 Query: 503 QDINQRIRAPPKKA------PEILGTSAFSGKPVIGKTRIRTEGGKGSITILRTKG 354 +DINQ+IR PP K P ++ TSAFSGKPV+GKT+IRTEGGKGSITI+RT+G Sbjct: 231 KDINQKIRNPPAKPKAHIEEPAVIQTSAFSGKPVVGKTKIRTEGGKGSITIMRTRG 286 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,334,201 Number of Sequences: 27288 Number of extensions: 242014 Number of successful extensions: 636 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 632 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 675457500 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208320|gb|BQ134409.1|BQ134409 1091016H05.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (383 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g10050.1 lipase-like protein / monoglyceride lipase - Mus ... 153 2e-39 >At4g10050.1 lipase-like protein / monoglyceride lipase - Mus musculus, PID:e1184892;supported by full-length cDNA: Ceres:6822. Length = 350 Score = 153 bits (387), Expect(2) = 2e-39 Identities = 68/105 (64%), Positives = 92/105 (86%) Frame = +3 Query: 69 EERRVAIPDTDNVFNAYTTGSEGPVVFCLHGGGYSGFSFALAASQMKDKARVVAMDLRGH 248 +E ++I +D+VF+ Y G+EGPVVFCLHGGGYSG SF++ AS++K+KARVVAMDLRGH Sbjct: 56 KEDDISITGSDDVFHVYMAGNEGPVVFCLHGGGYSGLSFSIVASKIKEKARVVAMDLRGH 115 Query: 249 GKSTTNDDLDLSIETLTNDIIAVIRTMYGDLPPAIILVGHSMGGS 383 GKS + ++L+LS+ET++ND++AVI+ +YGD PPAI+LVGHSMGGS Sbjct: 116 GKSVSENELELSLETMSNDVLAVIKELYGDSPPAIVLVGHSMGGS 160 Score = 24.6 bits (52), Expect(2) = 2e-39 Identities = 7/16 (43%), Positives = 13/16 (80%) Frame = +2 Query: 17 SHSLHKYAPLDWSAYF 64 ++S KY+P++W +YF Sbjct: 39 TNSSEKYSPVEWKSYF 54 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,764,385 Number of Sequences: 27288 Number of extensions: 221167 Number of successful extensions: 666 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 662 length of database: 11,516,596 effective HSP length: 87 effective length of database: 9,142,540 effective search space used: 365701600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208269|gb|BQ134358.1|BQ134358 1091016B02.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (523 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g25120.1 putative protein / ATP-dependent DNA helicase Rep... 167 2e-42 >At4g25120.1 putative protein / ATP-dependent DNA helicase Rep, Escherichia coli, PIR1:HJECDR Length = 938 Score = 167 bits (424), Expect = 2e-42 Identities = 90/164 (54%), Positives = 109/164 (65%) Frame = +3 Query: 30 EGIPPPNILAMTFTTAAASEMRERIGTVAGNAVA*DIAISTFHSFCLQLCRTHAEKLGRT 209 +G+ P NILAMTFT AA SEMRERIG AG A DI ISTFHSF LQLCR HA+KL RT Sbjct: 273 KGLLPSNILAMTFTKAATSEMRERIGKSAGKKAAKDITISTFHSFSLQLCRMHADKLQRT 332 Query: 210 SEFIIYGHGQQRRALIETERLLENDKNNGVGDTTNQYDGDIKNSFKDKAKKWQKFITQAK 389 SEF +YGHGQQRRA+IE RL E +K NG + G+ N A K Sbjct: 333 SEFSVYGHGQQRRAIIEAVRLYEEEKKNGSKTSVPCESGEGLNGAGAGA---------GK 383 Query: 390 ASGRTPEDYEKKGDLTGASVLRHYNEILRSCNALDYHDFINSSI 521 ASG++PE K G+ GA +L +YN+IL++C+ALDYHD I+ S+ Sbjct: 384 ASGKSPEQCRKMGNEIGAKILGNYNDILKACDALDYHDLISCSV 427 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,578,157 Number of Sequences: 27288 Number of extensions: 252453 Number of successful extensions: 790 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 789 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 729494100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208255|gb|BQ134344.1|BQ134344 1091015H06.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (483 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g37290.1 putative protein / CG14881, Drosophila melanogast... 137 4e-33 >At5g37290.1 putative protein / CG14881, Drosophila melanogaster, EMBL:AE003713;supported by full-length cDNA: Ceres:9887. Length = 180 Score = 137 bits (344), Expect = 4e-33 Identities = 64/82 (78%), Positives = 75/82 (91%) Frame = +3 Query: 237 MSTNAQRQVERTGRSGTPRDQYLQDLVTQFQNATNEESKEKIVANLANFAYDPFNYAFMR 416 M TN QRQ ERTG+ GTPR QYLQ+LV+QFQNAT+EE+KE+IVANLANFAYDP+NY +R Sbjct: 1 MFTNNQRQEERTGKHGTPRLQYLQELVSQFQNATDEETKERIVANLANFAYDPYNYTILR 60 Query: 417 QLNVLELFLDCITEPNERLIEF 482 QLNVLELF+DCITEPNE+L+EF Sbjct: 61 QLNVLELFVDCITEPNEKLVEF 82 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,265,969 Number of Sequences: 27288 Number of extensions: 241890 Number of successful extensions: 701 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 623303772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208228|gb|BQ134317.1|BQ134317 1091015D06.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (554 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g22800.1 unknown protein / ESTs gb|Z34075, gb|Z34835 and g... 216 8e-57 >At1g22800.1 unknown protein / ESTs gb|Z34075, gb|Z34835 and gb|AA404888 come from this gene Length = 355 Score = 216 bits (549), Expect = 8e-57 Identities = 111/171 (64%), Positives = 134/171 (77%), Gaps = 5/171 (2%) Frame = +3 Query: 57 FSSSSAPDG---LDDGGGRVKIFDRDLKRRHRDRAAWAMFEIY-GLVDAVAENLLDRLED 224 FS+ A G +VKIFDRDLKR HRDRAAW + VDAVA+NLLDRLED Sbjct: 34 FSTEGAYGGDGEFQQNSSKVKIFDRDLKRIHRDRAAWLSRQKNDSFVDAVADNLLDRLED 93 Query: 225 CRKAFPSALCLGGSAGAVRRLLRGRGGIERLIMMDMSADMVKKWRESENATGDGP-ETHF 401 C+K+FP+A CLGGS GAV+RLLRGRGGIE+LIMMD S DM+K R++++ + D ET + Sbjct: 94 CKKSFPTAFCLGGSLGAVKRLLRGRGGIEKLIMMDTSYDMIKSCRDAQDDSLDNSIETSY 153 Query: 402 VIGDEEFLPIKESSQDLIMSCLGLHWTNDLPGAMIQCRLALQPDGLFLSAI 554 +GDEEFLP+KESS DLI+S LGLHWTNDLPG+MIQC+LAL+PDGLFL+AI Sbjct: 154 FVGDEEFLPVKESSVDLIISSLGLHWTNDLPGSMIQCKLALKPDGLFLAAI 204 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,706,528 Number of Sequences: 27288 Number of extensions: 409829 Number of successful extensions: 4761 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3990 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 817071892 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208215|gb|BQ134304.1|BQ134304 1091015B04.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (329 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32050.1 putative protein / norbin, Rattus norvegicus, PIR... 104 7e-24 >At4g32050.1 putative protein / norbin, Rattus norvegicus, PIR2:JC5812; supported by cDNA: gi_18086356 Length = 618 Score = 104 bits (260), Expect = 7e-24 Identities = 55/105 (52%), Positives = 75/105 (71%) Frame = +3 Query: 9 SQKESALHDFLRSIPASIWESHIRVGITAILQNRVVSSEKLHALLLAECMMSILGEDWLS 188 S+ LH+ LRS+P + W ++R G+ AILQNRV SEKLHAL+LAE MMSILGE WL Sbjct: 225 SEYSELLHEPLRSMPDNNWADYMRTGVVAILQNRVAPSEKLHALILAENMMSILGEKWLL 284 Query: 189 EDFEVQDNQNVLSVDKFVLLVLESARVEVAVLLNELAYLKYESSR 323 ++ + + D+ +LLVLES+ VE++VLLN+LAY KYE+ + Sbjct: 285 GGVKLPNVD--IPADRCLLLVLESSHVEISVLLNDLAYKKYEAPK 327 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,689,043 Number of Sequences: 27288 Number of extensions: 162239 Number of successful extensions: 506 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 11,516,596 effective HSP length: 85 effective length of database: 9,197,116 effective search space used: 220730784 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208173|gb|BQ134262.1|BQ134262 1091014F01.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (636 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49810.1 methionine S-methyltransferase (gb|AAD49574.1) / ... 278 2e-75 >At5g49810.1 methionine S-methyltransferase (gb|AAD49574.1) / ; supported by cDNA: gi_5733428_gb_AF137380.1_AF137380 Length = 1071 Score = 278 bits (712), Expect(2) = 2e-75 Identities = 140/197 (71%), Positives = 169/197 (85%) Frame = +1 Query: 37 MFSPALAIVDEHLTRHLPKQWLTSLAIEGRADCNHADGTVTVIEAPLLSDLLIELIRKLQ 216 +FSP LAIVDEHLTR LP+ WLTSLAIE + + +D +TVIE+P SDL+IELI+KL+ Sbjct: 464 LFSPRLAIVDEHLTRQLPRSWLTSLAIEDTS-MDKSDDQITVIESPHQSDLMIELIKKLK 522 Query: 217 PQVVVTGMAQFEAITSAAFENLLNVTKDVGSRLFLDISEHLELSSLPSSNGVLKYLAGKT 396 PQVVVTGMA FE ITS++F +LL VTK++G RLFLDIS+H ELSSLP+SNGVLKYLA Sbjct: 523 PQVVVTGMAPFEVITSSSFLHLLEVTKEIGCRLFLDISDHFELSSLPASNGVLKYLAENQ 582 Query: 397 LPSHAAILCGLVKNQVYSDLEVAFAISEDAAVYKALSQTIELLEGHTSLISQHYYGCLFH 576 LPSHAAI+CGLVKN+VYSDLEVAF I+E A+ KALS+T+E+LEGHT++ISQ+YYGCLFH Sbjct: 583 LPSHAAIICGLVKNKVYSDLEVAFVITEVDAIAKALSKTVEVLEGHTAIISQYYYGCLFH 642 Query: 577 ELLAFQIADRHPQQERQ 627 ELLAFQ+ADRH ER+ Sbjct: 643 ELLAFQLADRHAPAERE 659 Score = 21.9 bits (45), Expect(2) = 2e-75 Identities = 10/21 (47%), Positives = 15/21 (70%) Frame = +2 Query: 2 PSRSVAIENALQCSHRRLQLL 64 PSR+VAIE+A + RL ++ Sbjct: 452 PSRAVAIESAFRLFSPRLAIV 472 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,129,635 Number of Sequences: 27288 Number of extensions: 297580 Number of successful extensions: 831 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 830 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208162|gb|BQ134251.1|BQ134251 1091014D12.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (624 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58110.1 putative protein / predicted proteins, Homo sapie... 200 6e-52 >At5g58110.1 putative protein / predicted proteins, Homo sapiens and Drosophila melanogaster; supported by cDNA: gi_18087564 Length = 196 Score = 200 bits (508), Expect = 6e-52 Identities = 95/163 (58%), Positives = 124/163 (75%), Gaps = 1/163 (0%) Frame = +1 Query: 136 EKASSYRYWVREASGDAAPLPVPRKL-DTAANGNGNPPPVGSVWNQAGTWEEKNLNSWAN 312 ++ SSYRYWVREA+ DAAP P+P+KL + + N P +GS+WN+AGTWEEK+L WA Sbjct: 9 KEGSSYRYWVREATSDAAPPPLPQKLSNNDVSLNTAPASLGSLWNRAGTWEEKSLTKWAT 68 Query: 313 SRIKDLMGSLGSLAFPTGKASIDEVSKCSGDAFQVIVRNKKRVGYNYELSLRFSGEWLIK 492 R+K+L+GS+GSL F +GKA I +V++C GDAF V VRNKKRVGY YELSL+ GEW + Sbjct: 69 DRLKELLGSVGSLQFSSGKAEIIDVNRCVGDAFLVTVRNKKRVGYTYELSLKVEGEWSFE 128 Query: 493 EENKKIKGHLDIPEFSFGKIDDLEVQVRFGDDKGLASDDRTRI 621 E KK+KG L+IPEFSFG++DDLEV V+ +DK L+ + RI Sbjct: 129 ENMKKVKGSLEIPEFSFGELDDLEVDVKLSEDKELSQQLKQRI 171 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.315 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,929,153 Number of Sequences: 27288 Number of extensions: 447323 Number of successful extensions: 6336 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4988 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 999514432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208139|gb|BQ134228.1|BQ134228 1091014B10.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (598 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g23860.1 putative protein / gene T22C1.1, Caenorhabditis e... 127 6e-30 >At4g23860.1 putative protein / gene T22C1.1, Caenorhabditis elegans, Z75550; supported by cDNA: gi_17064723 Length = 222 Score = 127 bits (318), Expect = 6e-30 Identities = 56/121 (46%), Positives = 81/121 (66%) Frame = +2 Query: 188 QYKSEPFFMSKGWRETLCRCETCFNFYAQRGIAYLIDKEDSIEEYEKIAKQKREMKLEQQ 367 +++ +P F++K WR LCRCE C Y QR ++YL+D ED+I EYEK AK+KR KLE+Q Sbjct: 100 EFEKKPLFLTKNWRNILCRCEKCLEMYKQRKVSYLLDAEDTIVEYEKKAKEKRTEKLEKQ 159 Query: 368 QGAETNFLNSLNHVQKIEMISGINDMKNEFQSFLESFDASKPVTSDDIHSFFENLAKKKK 547 +G + LN+L+HV K+E++ GI D ++ Q +ES SK +TS DI F L K+K Sbjct: 160 EGEALDLLNNLDHVSKVELLHGIKDFQDGLQGLMESAGPSKAITSADIEQMFSKLKNKRK 219 Query: 548 Q 550 + Sbjct: 220 R 220 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,857,240 Number of Sequences: 27288 Number of extensions: 273081 Number of successful extensions: 1000 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 956 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 998 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 930958496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208102|gb|BQ134191.1|BQ134191 1091013F09.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (524 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61040.1 unknown protein / ; supported by cDNA: gi_20147192 226 5e-60 >At1g61040.1 unknown protein / ; supported by cDNA: gi_20147192 Length = 643 Score = 226 bits (576), Expect = 5e-60 Identities = 108/172 (62%), Positives = 139/172 (80%), Gaps = 1/172 (0%) Frame = +1 Query: 10 FDDVKSITLRRSKLVKWFMEPFFDDLISGCFVRLGIGKTKNGTPSYRLCIVRNVDAFDPY 189 F+DVK +T+RRSKL KW MEPFF++LI GCFVR+GIG++K+G P YRLC V+NVDA DP Sbjct: 264 FEDVKEVTIRRSKLAKWLMEPFFEELIVGCFVRVGIGRSKSG-PIYRLCWVKNVDATDPD 322 Query: 190 RNYKLENYSTCKYLNVVWDSEANAARWQMTQVSDSPPNEEEFKEWLQAAEKNGARIPTRQ 369 + YKLEN +T KYLNVVW +E +AARWQM +SD P EEE+++W++ E+ R+PT+Q Sbjct: 323 KTYKLENKTTHKYLNVVWGNETSAARWQMAMISDGHPLEEEYRQWIREVERTNGRMPTKQ 382 Query: 370 EVLDKKEAIQNAYNFVYSAATVQQMLQE-KSAVRRPINIAAEKDRLRSELEM 522 ++ +KKEAIQ +FVYSA TV+QMLQE KSA RP+N+AAEKDRLR ELE+ Sbjct: 383 DISEKKEAIQRTNSFVYSAETVKQMLQEKKSASVRPMNVAAEKDRLRKELEI 434 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,699,402 Number of Sequences: 27288 Number of extensions: 295260 Number of successful extensions: 817 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 815 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 727283772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208097|gb|BQ134186.1|BQ134186 1091013E08.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (244 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39680.1 hypothetical protein / 99 4e-22 >At4g39680.1 hypothetical protein / Length = 633 Score = 99.0 bits (245), Expect = 4e-22 Identities = 50/78 (64%), Positives = 56/78 (71%) Frame = +3 Query: 9 SQTGPETPKDIFQPAFKRSFGRSDSTASVDSPKERIVPPAEKPATTSLRIDRFVRPFTLK 188 S T TP+ KR F RSDS+ S D PKER+VPP+ K T SLRIDRF+RPFTLK Sbjct: 415 SATPTTTPRST---GLKRDFSRSDSSVSEDGPKERVVPPSPKEPTNSLRIDRFLRPFTLK 471 Query: 189 AVQELLGKTGSVQDFWMD 242 AVQELLGKTG+V FWMD Sbjct: 472 AVQELLGKTGNVTSFWMD 489 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,339,943 Number of Sequences: 27288 Number of extensions: 98944 Number of successful extensions: 324 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 324 length of database: 11,516,596 effective HSP length: 56 effective length of database: 9,988,468 effective search space used: 239723232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822717|gb|BQ048741.1|BQ048741 952023F05.x4 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (596 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g70570.1 expressed protein / ; supported by cDNA: gi_15293... 167 3e-72 >At1g70570.1 expressed protein / ; supported by cDNA: gi_15293216_gb_AY051042.1_ Length = 595 Score = 167 bits (423), Expect(2) = 3e-72 Identities = 80/97 (82%), Positives = 86/97 (88%) Frame = -3 Query: 300 GPPPVADVNSLTHYGEPYDGNTRFFKSTLFVAAVRACYGESCLLHGVEWMPPKGGITEGQ 121 G PPVADV SLTHYGEPYDGNTRFF+STLFVAAVR+C GES LLHGVEWMPPKGG+TE Q Sbjct: 291 GAPPVADVKSLTHYGEPYDGNTRFFRSTLFVAAVRSCCGESSLLHGVEWMPPKGGVTEEQ 350 Query: 120 MLKFMGANIHLSPTQAKILLEDETAGFAYLNLQEACP 10 MLKFMGAN HLS QAK L+EDE AGFAYL+L+EA P Sbjct: 351 MLKFMGANTHLSVQQAKELIEDEKAGFAYLSLREARP 387 Score = 122 bits (305), Expect(2) = 3e-72 Identities = 62/92 (67%), Positives = 75/92 (81%), Gaps = 1/92 (1%) Frame = -1 Query: 596 ILGANGLAEPRYVGQGTGEMRLVGALREVLAGGHLGYEEVQCVLKDILPIGS-SSDSTVV 420 +LG P +VG T EMRLVGALRE+LAGGHLGYEEV+ VL+D+LP+ + S ++ V Sbjct: 198 LLGTGNSVGPTFVGNETREMRLVGALREILAGGHLGYEEVKGVLRDVLPLETEGSLNSGV 257 Query: 419 SQALLAAFLIGQRMNRETDRELKAYCLTFDDE 324 S++LL+AFLIGQRMNRETDRELKAYCL FDDE Sbjct: 258 SESLLSAFLIGQRMNRETDRELKAYCLAFDDE 289 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,929,421 Number of Sequences: 27288 Number of extensions: 312478 Number of successful extensions: 875 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 873 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 930958496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822478|gb|BQ048502.1|BQ048502 952021D02.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (532 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g56090.1 putative protein / contains similarity to cytochr... 280 3e-76 >At5g56090.1 putative protein / contains similarity to cytochrome oxidase assembly factor Length = 457 Score = 280 bits (716), Expect = 3e-76 Identities = 125/173 (72%), Positives = 152/173 (87%) Frame = -3 Query: 530 GIRLSALFALGGAQGLIGWWMVKSGLEEPTSEYVQPRVSPYRLATHLTSAFIIYCGILWT 351 G++LS LFALG QG IGWWMVKSGLEEP SEY QPRVSPYRLA HLTSAF IYCG+ WT Sbjct: 210 GVQLSGLFALGAGQGFIGWWMVKSGLEEPPSEYSQPRVSPYRLAAHLTSAFAIYCGLFWT 269 Query: 350 ALSVVMPDPPTGSMSWVNGAAKIRKLAIPVSAVVGITAISGAFVAGNDAGHAYNSFPKMG 171 ALSVVMP+PP S++WV GAAK++KLA+PVS +VGITAISGAFVAGNDAG A+N+FPKMG Sbjct: 270 ALSVVMPEPPAESLAWVRGAAKVKKLALPVSLIVGITAISGAFVAGNDAGRAFNTFPKMG 329 Query: 170 DSWIPEDVFSMEPFVRNFFENTSTVQLNHRILAATTLLSVGGLWLAARKIDMH 12 D+WIP+++F M+P +RNFFENT+TVQL+HR+LA TTL+++G +W RK+D+H Sbjct: 330 DTWIPDNIFEMKPLLRNFFENTATVQLDHRLLATTTLIAIGTMWWFTRKLDIH 382 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,084,816 Number of Sequences: 27288 Number of extensions: 293235 Number of successful extensions: 855 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 855 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 745241396 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822463|gb|BQ048487.1|BQ048487 952021B02.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (462 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g12550.1 hypothetical protein / predicted by genscan 99 1e-21 >At2g12550.1 hypothetical protein / predicted by genscan Length = 538 Score = 99.0 bits (245), Expect = 1e-21 Identities = 61/127 (48%), Positives = 82/127 (64%), Gaps = 3/127 (2%) Frame = -2 Query: 383 MLRAEVARRVGDGVEPECVGLIFGGRVLKDDPPASLR--EAGLKANAKVLSSL-TSPDRA 213 MLR EVA+R G++PE + LIF G++LKDD A+L + G+K N+K+LS +P+ Sbjct: 1 MLRDEVAKR--SGLDPESIKLIFAGKILKDDGDATLTLSQLGIKENSKILSCRQAAPEEG 58 Query: 212 KEIDAQAAKAKAEEEHAAKLVRLWEAAKALSQRHTDGSYLAEEDYNLDLEDQSGQKVMFG 33 K I AEEE A +L R+ AA ALS+RH DGS L +DYN++LEDQ G KV FG Sbjct: 59 KSI-------MAEEERARRLSRVKAAATALSKRHADGS-LPIQDYNIELEDQGGHKVQFG 110 Query: 32 SVDDKKA 12 + D+ A Sbjct: 111 TETDQSA 117 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,950,640 Number of Sequences: 27288 Number of extensions: 323342 Number of successful extensions: 5449 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2031 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4319 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 560070056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822413|gb|BQ048437.1|BQ048437 1091008B10.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (576 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g34640.1 expressed protein / ; supported by full-length cD... 105 2e-23 At1g31810.1 unknown protein / 54 6e-08 At1g61080.1 hypothetical protein / predicted by genefinder 52 2e-07 At5g19810.1 proline-rich protein / extensins 51 5e-07 At5g07750.1 putative protein / similar to unknown protein (gb... 50 6e-07 At1g68690.1 protein kinase, putative / similar to protein kin... 50 6e-07 At5g58160.1 strong similarity to unknown protein (gb|AAD23008.1)... 50 8e-07 At5g56330.1 putative protein / contains similarity to carboni... 49 1e-06 At4g13340.1 extensin-like protein / extensin-like protein, Ze... 49 2e-06 At3g24400.1 protein kinase, putative / similar to protein kin... 48 3e-06 At1g20130.1 anter-specific proline-rich protein APG precursor ... 48 3e-06 At4g18670.1 extensin-like protein / extensin-like protein - m... 48 4e-06 At4g30460.1 glycine-rich protein / glycine-rich cell wall str... 48 4e-06 At2g05580.1 unknown protein / predicted by genefinder 48 4e-06 At4g27850.1 putative proline-rich protein / extensin - Volvox... 47 7e-06 At4g22470.1 extensin - like protein / hybrid proline-rich pro... 47 9e-06 At4g39260.1 glycine-rich RNA-binding protein 8 (GRP8) / CCR1 ... 47 9e-06 At4g15160.1 cell wall protein like / 47 9e-06 >At1g34640.1 expressed protein / ; supported by full-length cDNA: Ceres: 10855. Length = 110 Score = 105 bits (262), Expect = 2e-23 Identities = 48/112 (42%), Positives = 72/112 (63%) Frame = +1 Query: 202 MGRDELLRRSLVALAAAVALTGLATASLRKAAATYGFGILAIAGVLLPDWEFFDRDYSQW 381 MG + LR S+V LA + + L T SL+K TY GI I G+LLPDW+FFDR +S+W Sbjct: 1 MGNEAALRSSMVGLAVVMVVVWLWTQSLKKTVVTYAVGISLIGGILLPDWDFFDRSFSRW 60 Query: 382 LTPMPASRRTAAAAAADREHDVWKFKPYPLRVAMLTTIYGFGLHKWWTYVSS 537 P+ A R+AA A R+ +F+ YP+R+ + T+YG+ +++WW +VS+ Sbjct: 61 GYPVTAEERSAALA---RKSHPSRFRVYPMRMVLYGTVYGYAVYRWWMFVSN 109 >At1g31810.1 unknown protein / Length = 1201 Score = 53.9 bits (128), Expect = 6e-08 Identities = 38/103 (36%), Positives = 44/103 (41%), Gaps = 6/103 (5%) Frame = -3 Query: 310 SRTWPPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPL 131 SR+ PPP A P P P P PPP P S + PS A PP PP PS Sbjct: 584 SRSIPPPLAQPPPPRP--PPPPPPPPSSRSIPSPS-----APPPPP----PPPPSFG--- 629 Query: 130 GWGVGTRNEKRVRPAPPPPP------ASVSPPPGPWAPGGRDG 20 G + + + P PPPPP A +PPP P P G Sbjct: 630 --STGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSG 670 Score = 53.9 bits (128), Expect = 6e-08 Identities = 51/168 (30%), Positives = 64/168 (37%), Gaps = 10/168 (5%) Frame = -3 Query: 478 PPSEDRA*ISRRRAPGRRPRPRPCVGRRAWG*ATGSSLGRRTPSPEAARQRWRGCRSRTW 299 PP R+ I AP P P P G +TG+ + P P R ++ Sbjct: 605 PPPSSRS-IPSPSAPPPPPPPPPSFG------STGNKRQAQPPPPPPPPPPTRIPAAKCA 657 Query: 298 PPPCAATPW----------PSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVP 149 PPP P PS P PPP P+ + + A P P PP+S+ P P Sbjct: 658 PPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNA-PKPPAPPPLPPSSTRLGAPPP 716 Query: 148 SLQLPLGWGVGTRNEKRVRPAPPPPPASVSPPPGPWAPGGRDG*AGAP 5 PL PAPPPPP S +P P P GR +G P Sbjct: 717 PPPPPLS----------KTPAPPPPPLSKTPVPPPPPGLGRGTSSGPP 754 >At1g61080.1 hypothetical protein / predicted by genefinder Length = 907 Score = 52.0 bits (123), Expect = 2e-07 Identities = 42/112 (37%), Positives = 48/112 (42%), Gaps = 14/112 (12%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAA--ARPSPCHTDARPPASSLKLPPVPSLQ----- 140 PPP AA AP PPP P G+AAA P P T A PP PP P +Q Sbjct: 528 PPPRAAV------APPPPPPPPGTAAAPPPPPPPPGTQAAPPP-----PPPPPMQNRAPS 576 Query: 139 ---LPLGWGVGTRNEKRVRPAPPPPPA----SVSPPPGPWAPGGRDG*AGAP 5 +P+G N P PPPPP +PPP P +G AG P Sbjct: 577 PPPMPMG------NSGSGGPPPPPPPMPLANGATPPPPPPPMAMANGAAGPP 622 Score = 50.1 bits (118), Expect = 8e-07 Identities = 35/98 (35%), Positives = 38/98 (38%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPP P P+ A PPP P AA A P P PP + PP P P G Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPP-----PPPPGTAAAPPPP--PPPPG--- 557 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGPWAPGGRDG*AGAP 5 + P PPPPP P P P G G G P Sbjct: 558 ----TQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPP 591 Score = 50.1 bits (118), Expect = 8e-07 Identities = 38/116 (32%), Positives = 46/116 (38%), Gaps = 13/116 (11%) Frame = -3 Query: 313 RSRTWPPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPA--------SSLKLP 158 R+ PPP P + P PPP P AA P P R P+ S P Sbjct: 531 RAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGP 590 Query: 157 PVPSLQLPLGWGVGTRNEKRVRPAPPPPPASVS-----PPPGPWAPGGRDG*AGAP 5 P P +PL G P PPPPP +++ PPP P G +G AG P Sbjct: 591 PPPPPPMPLANG--------ATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPP 638 >At5g19810.1 proline-rich protein / extensins Length = 249 Score = 50.8 bits (120), Expect = 5e-07 Identities = 31/85 (36%), Positives = 38/85 (44%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPP +P P P PPP P + P P + PP +L PP P L P Sbjct: 73 PPPVNLSPPPPPVNLSPPPPP--VLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSP----- 125 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGP 44 V +PPPPP ++SPPP P Sbjct: 126 ---PPPPVLLSPPPPPVNLSPPPPP 147 Score = 49.7 bits (117), Expect = 1e-06 Identities = 31/85 (36%), Positives = 36/85 (41%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPP +P P P PPP P + P P + PP L PP P L P Sbjct: 82 PPPVNLSPPPPPVLLSPPPPPVNLSPP--PPPVNLSPPPPPVLLSPPPPPVLLSP----- 134 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGP 44 V +PPPPP +SPPP P Sbjct: 135 ---PPPPVNLSPPPPPVLLSPPPPP 156 Score = 48.5 bits (114), Expect = 2e-06 Identities = 30/85 (35%), Positives = 37/85 (43%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPP + P P PPP P + P P + PP +L PP P L P Sbjct: 46 PPPVNISSPPPPVNLSPPPPPVNLSPP--PPPVNLSPPPPPVNLSPPPPPVLLSP----- 98 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGP 44 V +PPPPP ++SPPP P Sbjct: 99 ---PPPPVNLSPPPPPVNLSPPPPP 120 >At5g07750.1 putative protein / similar to unknown protein (gb|AAD23008.1) Length = 1289 Score = 50.4 bits (119), Expect = 6e-07 Identities = 43/108 (39%), Positives = 43/108 (39%), Gaps = 18/108 (16%) Frame = -3 Query: 298 PPPC--AATPWPSP*----APRPPPAP-RGSAAAARPSPCHTDARPPA-----SSLKLPP 155 PPP A P P P AP PPP P RG A P P H A PP PP Sbjct: 1078 PPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGAPPPP 1137 Query: 154 VPSLQLPLGWGVGTRNEKRVRPAPPPPP------ASVSPPPGPWAPGG 29 P P G G G APPPPP PPPGP PGG Sbjct: 1138 PP----PGGRGPG---------APPPPPPPGGRAPGPPPPPGPRPPGG 1172 Score = 47.8 bits (112), Expect = 4e-06 Identities = 39/104 (37%), Positives = 40/104 (37%), Gaps = 6/104 (5%) Frame = -3 Query: 298 PPPC--AATPWPSP*----APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQL 137 PPP A P P P AP PPP P A P P PP PP P Sbjct: 1066 PPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPP------PPPP---- 1115 Query: 136 PLGWGVGTRNEKRVRPAPPPPPASVSPPPGPWAPGGRDG*AGAP 5 P+ G P PPPPP PP P PGGR GAP Sbjct: 1116 PMHGGA---------PPPPPPPMRGGAPPPPPPPGGRG--PGAP 1148 Score = 47.8 bits (112), Expect = 4e-06 Identities = 35/94 (37%), Positives = 41/94 (43%), Gaps = 6/94 (6%) Frame = -3 Query: 298 PPPCA------ATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQL 137 PPP + + P PS +P PPP P S + P P PP S PP P Sbjct: 923 PPPFSNAHSVLSPPPPSYGSPPPPPPPPPSYGSPPPPP------PPPPSYGSPPPPPPPP 976 Query: 136 PLGWGVGTRNEKRVRPAPPPPPASVSPPPGPWAP 35 P G+G P PPPPP+ SPPP P P Sbjct: 977 P-GYGSPP-------PPPPPPPSYGSPPPPPPPP 1002 Score = 47.8 bits (112), Expect = 4e-06 Identities = 35/108 (32%), Positives = 39/108 (35%) Frame = -3 Query: 352 PSPEAARQRWRGCRSRTWPPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPAS 173 PSP G S PP A P P PPP + + P P + PP Sbjct: 894 PSPSVKILPLHGISSAPSPPVKTAPP-----PPPPPPFSNAHSVLSPPPPSYGSPPPPP- 947 Query: 172 SLKLPPVPSLQLPLGWGVGTRNEKRVRPAPPPPPASVSPPPGPWAPGG 29 PP PS P P PPPPP+ SPPP P P G Sbjct: 948 ----PPPPSYGSP-------------PPPPPPPPSYGSPPPPPPPPPG 978 >At1g68690.1 protein kinase, putative / similar to protein kinase 1 GB:BAA94509 GI:7573596 from [Populus nigra]; supported by cDNA: gi_14334805_gb_AY035076.1_ Length = 708 Score = 50.4 bits (119), Expect = 6e-07 Identities = 34/96 (35%), Positives = 40/96 (41%), Gaps = 8/96 (8%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLP-----PVPSLQLP 134 PPP A P P P PPP G+ P P + + PP + P P P +P Sbjct: 44 PPPNRAPPPPPPVTTSPPPVANGAPPPPLPKPPESSSPPPQPVIPSPPPSTSPPPQPVIP 103 Query: 133 LGWGVGTRNEKRVRPAP--PPPPASVSPP-PGPWAP 35 + V P P PPPPASV PP P P P Sbjct: 104 SPPPSASPPPALVPPLPSSPPPPASVPPPRPSPSPP 139 >At5g58160.1 strong similarity to unknown protein (gb|AAD23008.1) / Length = 1307 Score = 50.1 bits (118), Expect = 8e-07 Identities = 53/160 (33%), Positives = 61/160 (38%), Gaps = 20/160 (12%) Frame = -3 Query: 454 ISRRRAPGRRPRPRPCVGRRAWG*ATGSSLGRRTPSPEAARQRWRGCRSRTWPPPCA--- 284 +S + +P P V +G AT LG S A + RS PPP + Sbjct: 628 LSPQASPATPTNPSKTVSVDFFGAATSPHLGA---SDNVASNLGQPARS---PPPISNSD 681 Query: 283 ---ATPWPSP*APRPP---------PAPRGSAAAARPSPC-HTDARPPASSLKLPPVPSL 143 A P P P P PP P P A A P+P HT + PP PP P Sbjct: 682 KKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAP-- 739 Query: 142 QLPLGWGVGTRNEKRVRPAPPPPPA----SVSPPPGPWAP 35 P G K PAPP PP S SPPP P AP Sbjct: 740 --PTPQSNGISAMKSSPPAPPAPPRLPTHSASPPP-PTAP 776 >At5g56330.1 putative protein / contains similarity to carbonic anhydrase Length = 350 Score = 49.3 bits (116), Expect = 1e-06 Identities = 30/90 (33%), Positives = 39/90 (43%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 P P P P+P P+P PAP + +P+P T +P K P P+ P Sbjct: 48 PTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKP-----KPKPAPTPPNPKPTPA 102 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGPWAPGG 29 T + + PAP P PA P APGG Sbjct: 103 PTPPKPKPAPAPAPTPAPKPKPAPKPAPGG 132 Score = 48.1 bits (113), Expect = 3e-06 Identities = 27/98 (27%), Positives = 37/98 (37%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 P P P P+P P+P P P + +P P T +P + PP P Sbjct: 26 PKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPK-------PA 78 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGPWAPGGRDG*AGAP 5 + +P P P P + P P P P + A AP Sbjct: 79 PAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAP 116 >At4g13340.1 extensin-like protein / extensin-like protein, Zea mays, PIR2:S49915 Length = 760 Score = 48.5 bits (114), Expect = 2e-06 Identities = 34/95 (35%), Positives = 35/95 (36%), Gaps = 1/95 (1%) Frame = -3 Query: 316 CRSRTWPPPCAATPWPSP*APRPPP-APRGSAAAARPSPCHTDARPPASSLKLPPVPSLQ 140 C P P TP P P P PPP AP S SP PP S PP P Sbjct: 388 CGRSVSPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPP 447 Query: 139 LPLGWGVGTRNEKRVRPAPPPPPASVSPPPGPWAP 35 + P PPPPP SPPP P P Sbjct: 448 V---------YSPPPPPPPPPPPPVYSPPPPPPPP 473 Score = 47.4 bits (111), Expect = 5e-06 Identities = 30/85 (35%), Positives = 31/85 (36%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPP +P P P P PPP P P PP S PP P P Sbjct: 444 PPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPP----- 498 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGP 44 P PPPPP SPPP P Sbjct: 499 -------PPPPPPPPPPVYSPPPPP 516 Score = 46.6 bits (109), Expect = 9e-06 Identities = 27/85 (31%), Positives = 32/85 (36%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPP ++ P SP P PP P + P P + PP PP P Sbjct: 564 PPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPC-------- 615 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGP 44 + P PPPP SPPP P Sbjct: 616 -------IEPPPPPPCIEYSPPPPP 633 >At3g24400.1 protein kinase, putative / similar to protein kinase GB:BAA24694 from [Arabidopsis thaliana] Length = 694 Score = 48.1 bits (113), Expect = 3e-06 Identities = 43/122 (35%), Positives = 50/122 (40%), Gaps = 12/122 (9%) Frame = -3 Query: 355 TPSPEAARQRWRGCRSRTWPPPCAATPWP---------SP*APRPPPAPRGSAAAARPSP 203 TPSP T PP A TP P SP P PPP + + PSP Sbjct: 89 TPSPPLTPSPTTPSPPLTPSPPPAITPSPPLTPSPLPPSPTTPSPPPP-----SPSIPSP 143 Query: 202 CHTDARPPASSLK--LPPVPSLQLPLGWGVGTRNEKRVR-PAPPPPPASVSPPPGPWAPG 32 T + PP+S L+ PP PS P R+ P PPP S+SPPP G Sbjct: 144 PLTPSPPPSSPLRPSSPPPPSPATP---STPPRSPPPPSTPTPPPRVGSLSPPPPASPSG 200 Query: 31 GR 26 GR Sbjct: 201 GR 202 >At1g20130.1 anter-specific proline-rich protein APG precursor / identical to SP:P40602 from [Arabidopsis thaliana] Length = 1006 Score = 48.1 bits (113), Expect = 3e-06 Identities = 33/89 (37%), Positives = 40/89 (44%), Gaps = 1/89 (1%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAA-RPSPCHTDARPPASSLKLPPVPSLQLPLGWG 122 PP C TP P PPP P+ + A +P PC + +PPA + K PVP P Sbjct: 65 PPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPK--PVPPHGPP---- 118 Query: 121 VGTRNEKRVRPAPPPPPASVSPPPGPWAP 35 +PAP P PA SP P P P Sbjct: 119 --------PKPAPAPTPAP-SPKPAPSPP 138 >At4g18670.1 extensin-like protein / extensin-like protein - maize, PIR2:S49915 Length = 839 Score = 47.8 bits (112), Expect = 4e-06 Identities = 31/94 (32%), Positives = 39/94 (40%), Gaps = 3/94 (3%) Frame = -3 Query: 316 CRSR---TWPPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPS 146 CR R PPP A + SP +PPP P S P+ + PP + + PP S Sbjct: 693 CRHRLNLASPPPPAPYYYSSP---QPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQS 749 Query: 145 LQLPLGWGVGTRNEKRVRPAPPPPPASVSPPPGP 44 + + P PPP PA SPPP P Sbjct: 750 HPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSP 783 >At4g30460.1 glycine-rich protein / glycine-rich cell wall structural protein - garden petunia,Pir2:A26099; supported by cDNA: gi_20260351 Length = 162 Score = 47.8 bits (112), Expect = 4e-06 Identities = 32/88 (36%), Positives = 39/88 (43%), Gaps = 3/88 (3%) Frame = +3 Query: 45 GPGGGETEAGGGGGAGRTRFSFRVPTPQPRGSWREGTGGSFKEEAGGRASVWHGEG---R 215 G GG + AG G G+G S + S G GG EAG A G G R Sbjct: 51 GGGGSGSGAGAGSGSGGGGSSSSSSSSSSSSSSSGGGGGDAGSEAGSYAGSHAGSGSGGR 110 Query: 216 AAAAEPRGAGGGRGAHGLGHGVAAQGGG 299 + + RG+GGG G G G G +GGG Sbjct: 111 SGSGRGRGSGGGGGHGGGGGGGGGRGGG 138 >At2g05580.1 unknown protein / predicted by genefinder Length = 302 Score = 47.8 bits (112), Expect = 4e-06 Identities = 31/88 (35%), Positives = 34/88 (38%) Frame = +3 Query: 36 GAQGPGGGETEAGGGGGAGRTRFSFRVPTPQPRGSWREGTGGSFKEEAGGRASVWHGEGR 215 G G GG GGGGG G+ Q G + G GG + GG G GR Sbjct: 213 GGGGGGGQGGHKGGGGGGGQGGHKGGGGGGQGGGGHKGGGGGQGGHKGGGGGGHVGGGGR 272 Query: 216 AAAAEPRGAGGGRGAHGLGHGVAAQGGG 299 RG GG G G G G GGG Sbjct: 273 GGGGGGRGGGGSGGGGGGGSGRGGGGGG 300 >At4g27850.1 putative proline-rich protein / extensin - Volvox carteri (fragment), Pir2:S22697 Length = 577 Score = 47.0 bits (110), Expect = 7e-06 Identities = 33/94 (35%), Positives = 38/94 (40%), Gaps = 6/94 (6%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPP + +P P P +P P P P P P + P S L P P LPL Sbjct: 175 PPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLP-SPGPDSPLPL---P 230 Query: 118 GTRNEKRVRPAP------PPPPASVSPPPGPWAP 35 G P P P PP S SP PGP +P Sbjct: 231 GPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSP 264 >At4g22470.1 extensin - like protein / hybrid proline-rich protein, Zea mays, PIR2:JQ1663 Length = 379 Score = 46.6 bits (109), Expect = 9e-06 Identities = 28/88 (31%), Positives = 32/88 (35%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPPC P P P+P P P P + PP S PPV + L Sbjct: 37 PPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKP 96 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGPWAP 35 + PPPPPA PPP P Sbjct: 97 LPPPLSPPQTTPPPPPAITPPPPPAITP 124 Score = 46.6 bits (109), Expect = 9e-06 Identities = 33/92 (35%), Positives = 36/92 (38%), Gaps = 2/92 (2%) Frame = -3 Query: 304 TWPPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGW 125 T PPP A TP P P PPP P P T PPA + L P P P Sbjct: 80 TSPPPVATTPPALPPKPLPPPLSPPQTTPP-PPPAITPPPPPAITPPLSPPPPAITPPPP 138 Query: 124 GVGTRNEKRVRPAPPP--PPASVSPPPGPWAP 35 T +P PPP PP + PPP P Sbjct: 139 LATTPPALPPKPLPPPLSPPQTTPPPPPAITP 170 >At4g39260.1 glycine-rich RNA-binding protein 8 (GRP8) / CCR1 protein; supported by cDNA: gi_166838_gb_L00649.1_ATHRBPB Length = 169 Score = 46.6 bits (109), Expect = 9e-06 Identities = 30/88 (34%), Positives = 39/88 (44%) Frame = +3 Query: 39 AQGPGGGETEAGGGGGAGRTRFSFRVPTPQPRGSWREGTGGSFKEEAGGRASVWHGEGRA 218 ++G GGG GG GG+G G +R G GG + GG S G G Sbjct: 84 SRGSGGG---GGGRGGSG--------------GGYRSGGGGGYSGGGGGGYSGGGGGGYE 126 Query: 219 AAAEPRGAGGGRGAHGLGHGVAAQGGGH 302 + G+GGG G G G G +GGG+ Sbjct: 127 RRSGGYGSGGGGGGRGYGGGGRREGGGY 154 >At4g15160.1 cell wall protein like / Length = 428 Score = 46.6 bits (109), Expect = 9e-06 Identities = 29/85 (34%), Positives = 32/85 (37%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPP P P P PPP P P T PP ++K PP P + P Sbjct: 107 PPPYVKPPPPPTVKPPPPPTP-------YTPPPPTPYTPPPPTVKPPPPPVVTPP----- 154 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGP 44 P PPPPP PPP P Sbjct: 155 -PPTPTPEAPCPPPPPTPYPPPPKP 178 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,212,159 Number of Sequences: 27288 Number of extensions: 614465 Number of successful extensions: 16319 Number of sequences better than 1.0e-05: 36 Number of HSP's better than 0.0 without gapping: 3259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8770 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 868297828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822319|gb|BQ048343.1|BQ048343 1091006G06.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (628 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21150.1 putative protein / ribophorin II precursor, Homo ... 282 1e-77 >At4g21150.1 putative protein / ribophorin II precursor, Homo sapiens, PIR2:B26168; supported by cDNA: gi_16604453 Length = 691 Score = 282 bits (722), Expect(2) = 1e-77 Identities = 133/193 (68%), Positives = 162/193 (83%) Frame = +1 Query: 49 KLCLSFQLTTPLGHTFKPHQVFLKLRHESKVEHLFVVPGSARQFKIVLDFLGLVEKFYYL 228 KL LSFQLTTPLG+ FKPHQ F KL+HES+VEH+F+V S ++ ++VLDFLGLVEK YYL Sbjct: 463 KLRLSFQLTTPLGNAFKPHQAFFKLKHESQVEHIFLVKTSGKKSELVLDFLGLVEKLYYL 522 Query: 229 SGRYDLELTVGDAVMENSFLRPLGHLELDLPDAPEKAPRPPAQAVDPFSKFGPKAEISHI 408 SG+Y+++LT+GDA MENS L +GH+ELDLP+ PEKA RPP Q+ +P+S++GPKAEISHI Sbjct: 523 SGKYEIQLTIGDASMENSLLSNIGHIELDLPERPEKATRPPLQSTEPYSRYGPKAEISHI 582 Query: 409 FRAPEKRPPKELSLAFTGLTLLPFIGFLIGLVRLGVNLKNFPSLPGPAAFASLFHAGIGA 588 FR PEK P K+LSL F G+ +LPFIGFLIGL RLGVN+K+FPS G A A LFH GIGA Sbjct: 583 FRIPEKLPAKQLSLVFLGVIVLPFIGFLIGLTRLGVNIKSFPSSTGSAISALLFHCGIGA 642 Query: 589 VLMLYVLFWIKLD 627 VL+LYVLFW+KLD Sbjct: 643 VLLLYVLFWLKLD 655 Score = 25.4 bits (54), Expect(2) = 1e-77 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 3 LLKDTKVSLSANHLQ 47 L KD VSLSANHLQ Sbjct: 448 LTKDGAVSLSANHLQ 462 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,088,518 Number of Sequences: 27288 Number of extensions: 352432 Number of successful extensions: 1229 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1228 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1008438668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822297|gb|BQ048321.1|BQ048321 1091006D01.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (617 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39580.1 unknown protein / 110 6e-25 >At2g39580.1 unknown protein / Length = 1567 Score = 110 bits (275), Expect = 6e-25 Identities = 67/184 (36%), Positives = 106/184 (57%), Gaps = 4/184 (2%) Frame = +1 Query: 58 EWYEHCIREHAAIHAL-ELEKSSS-STDAQTRATFSLIIGYLADHCNLPTRELLSRRFCQ 231 E + HC+REHA + EL+ + S + Q R L+ YL +LP +E LS +F Sbjct: 1334 EHFMHCLREHAVFQLINELQATGEFSINLQMR----LLNSYLDRASSLPVKEPLSWKFIS 1389 Query: 232 N-IKKHRLRQLIDDTIGSVPADSSLINSVLEVCFGPSLLPKSISDVKYLVDFVETVMEAL 408 N +K R+R+L+ + + V ++ ++N VLE GPSL+P+ +S K LVDFVET++ + Sbjct: 1390 NSAEKPRVRKLVTNLLAPVSSELFVVNVVLEAWHGPSLVPEKLSKQKELVDFVETILGLV 1449 Query: 409 PANYRLGLAVGGFVAK-HFTGYGAASTGTRFWASSVLINAIFRAVPVAPESVWLEGAGLL 585 P+NY L L+V + K +S+G FWA L + I A+PVAPE +W+E ++ Sbjct: 1450 PSNYPLALSVSKLLRKEEKQSDSGSSSGIHFWAGLNLASTISCAIPVAPEYIWVEAGEIV 1509 Query: 586 EKLH 597 ++ Sbjct: 1510 SDIN 1513 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,912,956 Number of Sequences: 27288 Number of extensions: 332544 Number of successful extensions: 908 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 906 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 981665960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822280|gb|BQ048304.1|BQ048304 1091005H05.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (559 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02310.1 eceriferum3 (CER3) / 231 2e-61 >At5g02310.1 eceriferum3 (CER3) / Length = 795 Score = 231 bits (588), Expect = 2e-61 Identities = 109/182 (59%), Positives = 134/182 (72%) Frame = +1 Query: 4 LDLILQDESVHMLALKWSQHFCEEYNPRKYRGTLFSTPAVPFRLMQLPDVYQVLLERYIK 183 +D+IL DE + W QHF EY + + +L TP VPF+LM+LP++YQ LL+R IK Sbjct: 610 IDIILNDELLRSSTQIWLQHFQREYRVNRVKRSLCITPVVPFQLMKLPNLYQDLLQRCIK 669 Query: 184 MQCPDCGSVPDEPALCLLCGKLCSPSWKPCCRTGKCQNHALQCGAGIGIFLLVRKTTILL 363 +C +C V +EP LCLLCG LCSP W PCCR C NHA+ CGAG G+FLL+R+TTILL Sbjct: 670 KRCVNCTKVIEEPVLCLLCGSLCSPIWSPCCRESGCPNHAITCGAGTGVFLLIRRTTILL 729 Query: 364 QRSARLTFWPSLYLDAFGEEDNEMHRGKPLYLSQERYTSLTYLVASHSLDRTSEVLRQTT 543 QR AR + WPS YLD FGEED +M RGK LYL++ERY +LTYLV SH LDR+S+VL QTT Sbjct: 730 QRFARQSPWPSPYLDTFGEEDIDMIRGKRLYLNEERYAALTYLVGSHGLDRSSKVLGQTT 789 Query: 544 IG 549 IG Sbjct: 790 IG 791 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,027,176 Number of Sequences: 27288 Number of extensions: 295919 Number of successful extensions: 765 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 765 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 826050704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822270|gb|BQ048294.1|BQ048294 1091005G06.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (596 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g47570.1 expressed protein / ;supported by full-length cD... 196 8e-51 >At5g47570.1 expressed protein / ;supported by full-length cDNA: Ceres:12344. Length = 125 Score = 196 bits (498), Expect = 8e-51 Identities = 91/125 (72%), Positives = 104/125 (82%), Gaps = 2/125 (1%) Frame = +2 Query: 26 MAGRLTAAGSRILGGGG--ARAAASALRHRAGMGLPVGRHIVPDKPLPVNDELVWDNGTP 199 MAGRL+ SRI+GG G AR+ S+LR RAGMGLPVG+HIVPDKPL VNDEL+WDNGT Sbjct: 1 MAGRLSGVASRIMGGNGVVARSVGSSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA 60 Query: 200 FPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGMAAVVNDKASNIPYTPKVYPYDNLRAE 379 FPEPCIDR+A +GKYEALAWL GGLGFF LG+ AV+NDKAS +P+TP+VYPYDNLR E Sbjct: 61 FPEPCIDRIADTVGKYEALAWLSGGLGFFVGLGLLAVLNDKASKVPFTPRVYPYDNLRVE 120 Query: 380 LGDRP 394 LG P Sbjct: 121 LGGEP 125 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,867,491 Number of Sequences: 27288 Number of extensions: 433391 Number of successful extensions: 3066 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1863 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2824 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 930958496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822251|gb|BQ048275.1|BQ048275 1091005E09.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (557 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63440.1 expressed protein / ; supported by cDNA: gi_1622... 300 3e-82 >At5g63440.1 expressed protein / ; supported by cDNA: gi_16226477_gb_AF428410.1_AF428410 Length = 205 Score = 300 bits (769), Expect = 3e-82 Identities = 139/168 (82%), Positives = 159/168 (93%) Frame = +3 Query: 54 MPKRTTHTYSSEDALPEGPESDLFVYYCKHCASHVLITDTQLQKMPKRKTDRAHVLDKAK 233 MPKRTTHTYSSEDA P+GP+SDLFVYYCKHC SHVLITDTQLQKMPKRKTDR++VLDK Sbjct: 1 MPKRTTHTYSSEDAAPDGPDSDLFVYYCKHCGSHVLITDTQLQKMPKRKTDRSNVLDKKT 60 Query: 234 HLSRLNVKEAGKVMLKRGEGKLEKQFRMSCVGCDLFVCYRSEEDLEVAPFIYVIDGALSS 413 HL+RLNV E GKV+LKRGEGK+E+QFRM+C+GC+LFVCYR+EE+LE A FIY++DGALS+ Sbjct: 61 HLARLNVSEGGKVLLKRGEGKMERQFRMNCIGCELFVCYRAEENLETASFIYIVDGALSA 120 Query: 414 VAAETNPHDAPVPPCITQLEGGVVQVAIEVEDRAQRSAVTRVNADDVR 557 VAAETNP DAPVPPCI+QL+GG+VQVAIEVEDRAQRSA+TRVNADDVR Sbjct: 121 VAAETNPQDAPVPPCISQLDGGLVQVAIEVEDRAQRSAITRVNADDVR 168 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,391,207 Number of Sequences: 27288 Number of extensions: 309371 Number of successful extensions: 2949 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2608 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 826050704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822138|gb|BQ048162.1|BQ048162 1091003G01.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (522 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02100.1 hypothetical protein / predicted by genscan; supp... 203 4e-53 >At1g02100.1 hypothetical protein / predicted by genscan; supported by cDNA: gi_18377693 Length = 332 Score = 203 bits (517), Expect = 4e-53 Identities = 100/150 (66%), Positives = 124/150 (82%) Frame = +1 Query: 73 AATRSSPAAVQATNDDAAVSKLSCVNKGYMKDDYVRXFVRRPTRRAPIINRGYYARWSVL 252 A +RS+ AAVQATNDDA+ SKLSCV KGYMKDDYV FV+RP RR+PIINRGY++RW+ Sbjct: 2 AESRSNRAAVQATNDDASASKLSCVKKGYMKDDYVHLFVKRPVRRSPIINRGYFSRWAAF 61 Query: 253 RTLLHQFLNAGKNSNNDKPKQILSLGAGFDTTFFQLQDEGMAPHCYVELDFKEVTSKKAA 432 R L+ QFL +G +S KQILSLGAGFDTT+FQL DEG P+ YVELDFKEVTSKKAA Sbjct: 62 RKLMSQFLLSGTSSK----KQILSLGAGFDTTYFQLLDEGNGPNLYVELDFKEVTSKKAA 117 Query: 433 IINHYSEMKEKLGSEASISIEKGEVISTHY 522 +I + S++++KLG+ ASISI++G+V+S HY Sbjct: 118 VIQNSSQLRDKLGANASISIDEGQVLSDHY 147 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.131 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,500,313 Number of Sequences: 27288 Number of extensions: 286813 Number of successful extensions: 1027 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1021 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 729494100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822099|gb|BQ048123.1|BQ048123 1091003B11.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (501 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g45360.1 F-box protein family / ;supported by full-length... 219 6e-58 >At5g45360.1 F-box protein family / ;supported by full-length cDNA: Ceres:36901. Length = 316 Score = 219 bits (558), Expect = 6e-58 Identities = 101/155 (65%), Positives = 124/155 (79%), Gaps = 1/155 (0%) Frame = +3 Query: 39 GLFSNVPPELFLQIFKFLSSEDLISCALVCRFMNAAASDETLWRRLYCMRWGLA-SNAKF 215 G+F+NVP ELF I KFLSSEDL+SC+LVC+F+N AA+DE+LWRRLYC+RWGL + K Sbjct: 69 GVFTNVPTELFRHILKFLSSEDLVSCSLVCKFLNFAAADESLWRRLYCIRWGLTLPSRKL 128 Query: 216 RECAWKNLYIQRDREDMVEFVRNTPTEFKEYYIQMQAAKRSQAPRPSEVNDDKVMLDKTV 395 RE AWK LYI RD +DM+E VR P++FKEYY+ MQAAKRSQAP PS++ DD+++LD TV Sbjct: 129 RESAWKKLYIDRDEQDMIELVRTCPSDFKEYYVHMQAAKRSQAPLPSQMVDDRIILDNTV 188 Query: 396 ADQVSSWKNSRGLTDEAVKGHSCSGNTCSYTQIGD 500 +QVS WK S+GLTD+AV GH C G CSY QI D Sbjct: 189 LEQVSLWKKSKGLTDKAVTGHICLGTKCSYHQIDD 223 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,913,085 Number of Sequences: 27288 Number of extensions: 273986 Number of successful extensions: 1106 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1062 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1099 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 666451400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822033|gb|BQ048057.1|BQ048057 1091002A11.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (582 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g17370.1 putative protein / 292 7e-80 >At4g17370.1 putative protein / Length = 364 Score = 292 bits (748), Expect = 7e-80 Identities = 145/194 (74%), Positives = 164/194 (83%) Frame = +1 Query: 1 LCDAIIVSSPNMTHYEILMDIICHREPQHILVEKPLCTTVQDCKKVIEAAKQRPEIVVQV 180 LCD I+VSSPNMTH++ILMDII + +P H+LVEKPLCTTV DCK+V+EAAK+R ++VVQV Sbjct: 77 LCDVIVVSSPNMTHHQILMDIINYSKPHHVLVEKPLCTTVADCKQVLEAAKKRSDMVVQV 136 Query: 181 GLEYRYMPPVAKLIDIVKSGTLGQVRMVAIREHRFPFLVKVNNWNRFNCNSGGTLVEKCC 360 GLEYRYMPPVAKLI+ VK G V+MVAIREHRFPFLVKV N TLVEKCC Sbjct: 137 GLEYRYMPPVAKLIEQVKGRDFGNVKMVAIREHRFPFLVKVG----LNKMGLWTLVEKCC 192 Query: 361 HFFDLMILFAAANPVRVMASGAIDVNHKNEVYDGQVPDIIDNAYVIVEFDNGSRGMLDLC 540 HFFDLM LFA ANPV VMASG +DVNHK+EVY G+VPDIIDNAYVI+EFDNG RGMLDLC Sbjct: 193 HFFDLMRLFAGANPVCVMASGGMDVNHKDEVYGGKVPDIIDNAYVIIEFDNGCRGMLDLC 252 Query: 541 MFAEGSRNKQEICV 582 MFAEGS+N+QEI V Sbjct: 253 MFAEGSKNEQEISV 266 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,339,135 Number of Sequences: 27288 Number of extensions: 288264 Number of successful extensions: 885 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 858 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 884 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 886200876 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19821883|gb|BQ047907.1|BQ047907 952045H02.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (678 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30990.1 putative protein / probable membrane protein YBL0... 108 3e-24 >At4g30990.1 putative protein / probable membrane protein YBL004w, yeast, PIR2:S45734 Length = 2138 Score = 108 bits (270), Expect = 3e-24 Identities = 72/180 (40%), Positives = 112/180 (62%), Gaps = 11/180 (6%) Frame = +3 Query: 12 NLVPAIFSILTVKTASGSITTYALEFIENLLRLDIDLQQQDEHLVKKVVLQHMDVLIHSL 191 +LVP IFSILTV TAS +I + AL+FIENLL LD ++ +DE++++ V +++ LI+SL Sbjct: 1159 SLVPDIFSILTVTTASEAIKSSALKFIENLLCLD-NVLGEDENMIRGFVDPYIEALINSL 1217 Query: 192 HD-FVNHRKELNRRSGTWLGQRELRLFKLLLNYITDPSTADKFIDLILPFFSK--KD--- 353 H F+ L R+S + G+RE+++ KLL + D S K++D++L F +K KD Sbjct: 1218 HSLFIG--DILKRKSVKYHGEREIKILKLLSKRMQDRSHVMKYLDVLLSFLNKSVKDPGM 1275 Query: 354 -----LNSDDCLEALCVVRGIIQNLRCKVSEKVLNALNPLLAIVGLEPRLCICDIYAGLS 518 L +D EAL ++ II L + + K++N ++PLL L+ RLCICD+ L+ Sbjct: 1276 VSLLLLLNDIRREALLAIQDIIAYLGMESTSKIINTVSPLLVDAELDVRLCICDLLESLA 1335 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,193,064 Number of Sequences: 27288 Number of extensions: 291987 Number of successful extensions: 743 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 740 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1147706292 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19821870|gb|BQ047894.1|BQ047894 952045F11.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (531 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27930.1 expressed protein / ;supported by full-length cDN... 220 4e-58 >At3g27930.1 expressed protein / ;supported by full-length cDNA: Ceres:103959. Length = 425 Score = 220 bits (560), Expect = 4e-58 Identities = 102/169 (60%), Positives = 134/169 (78%), Gaps = 2/169 (1%) Frame = -2 Query: 530 HLVVQRRVKNPFEDDQVVGITNYIDFGLELAAKVDKDKV--SGDGNSFQLAASWQANKNF 357 H+VVQRRV+NPFE++QVVGITNYIDFG EL ++VD K + + Q+AASWQANKNF Sbjct: 256 HVVVQRRVQNPFEENQVVGITNYIDFGFELQSRVDDSKTPPNAPDSLLQVAASWQANKNF 315 Query: 356 LLKGKLGPSTSSVALAFKSWWRPSFTFSVTAVNDHSKGTTSYGFGLRVEDLRRASYQRAD 177 LLKGK+G +S+++LAFKSWW+PSF F+++A +H G GFGLRV++LR ASYQRAD Sbjct: 316 LLKGKVGAHSSTLSLAFKSWWKPSFAFNISATTNHRTGNVQCGFGLRVDNLREASYQRAD 375 Query: 176 PNYVMLTPSKEHLAPGVLREYGKRPMFQTQIDSGNYDHLPTELKPLGRI 30 PN+VMLTP+KEHLA G++ + GKRPM+Q +D+ N+ LP EL+P +I Sbjct: 376 PNFVMLTPNKEHLAEGIVWKMGKRPMYQADVDAENFSELPKELRPSQKI 424 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,576,346 Number of Sequences: 27288 Number of extensions: 274254 Number of successful extensions: 662 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 661 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 745241396 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19821832|gb|BQ047856.1|BQ047856 952045B09.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (621 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g08960.1 hypothetical protein / similar to hypothetical pr... 228 3e-60 >At3g08960.1 hypothetical protein / similar to hypothetical proteins: GB:S61997, [Saccharomyces cerevisiae], GB:CAA22859 [Schizosaccharomyces pombe] Length = 754 Score = 228 bits (580), Expect = 3e-60 Identities = 106/198 (53%), Positives = 139/198 (69%) Frame = +3 Query: 27 SLEQRKKNFAAVASDMLKVILSGDRVVLLCNILVRRYFIFTAKDLEEWSENPESFHHEQN 206 + EQRKKN + ++ +L +R+VLLCN+LVRRYF+ TA DLEEW +NPESFHHEQ+ Sbjct: 297 TFEQRKKNASNTVGGIVSSLLPNERIVLLCNVLVRRYFVLTASDLEEWYQNPESFHHEQD 356 Query: 207 LVQWTEKKRPCAEALFIVIFEKYREV*TFKFSLWL*VYSML*CSHDHVSLQLLAPVVVSV 386 ++QWTEK RPCAEAL++V+FE Y QLL P+VVS+ Sbjct: 357 MIQWTEKLRPCAEALYMVLFENYS--------------------------QLLGPIVVSI 390 Query: 387 LREAMAISPPQETEVTAGMLLKDASYTAAGHVYYELSNYLSFNEWLHGSLSIEISNHHPN 566 L+EAM PP TE+T +LLKDA+Y A +VYYELSNYL+F +W +G+LS+E+SN HPN Sbjct: 391 LQEAMNNCPPSVTEITPALLLKDAAYAATAYVYYELSNYLNFRDWFNGALSLELSNDHPN 450 Query: 567 MRIIRRKIALLLGHWISE 620 RII RK+A++LGHW+SE Sbjct: 451 RRIIHRKVAMILGHWVSE 468 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,632,196 Number of Sequences: 27288 Number of extensions: 286259 Number of successful extensions: 810 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 809 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 990590196 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19821810|gb|BQ047834.1|BQ047834 952016H01.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (441 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g68900.1 hypothetical protein / predicted by genscan 155 6e-39 >At1g68900.1 hypothetical protein / predicted by genscan Length = 656 Score = 155 bits (393), Expect = 6e-39 Identities = 79/146 (54%), Positives = 106/146 (72%) Frame = +3 Query: 3 DANQKWTYEQAVEFGSRVQSLHLEYIEEPVSSVYDLIKFCEKNVLPVALDETIDNLRGDV 182 DAN +WT+E+A EFG V S +L+YIEEPV + DLI+F E+ LPVALDET+D+ Sbjct: 151 DANCRWTFEEAREFGLLVNSCNLKYIEEPVQNKDDLIRFHEETGLPVALDETLDDFEECP 210 Query: 183 ICKLHQFVHPGIIALVIKPSVVGGFENAAHIAKWAQLHDKMAVISSTYESSIGLASYIQX 362 + L ++ HPGI+A+VIKPSVVGGFENAA IA+WAQ H KMAVIS+ YES +GL++YI Sbjct: 211 LRMLTKYTHPGIVAVVIKPSVVGGFENAALIARWAQQHGKMAVISAAYESGLGLSAYILF 270 Query: 363 AHYVDQQSSIVSRIRNKDTCRATAHG 440 A Y++ ++ S + + T + AHG Sbjct: 271 ASYLEMENVKASTEQKQGTPPSVAHG 296 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,554,856 Number of Sequences: 27288 Number of extensions: 191064 Number of successful extensions: 536 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 534 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 507397856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770567|gb|BQ035288.1|BQ035288 952078H09.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (588 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60640.1 hypothetical protein / predicted by genemark.hmm 72 3e-13 >At1g60640.1 hypothetical protein / predicted by genemark.hmm Length = 325 Score = 71.6 bits (174), Expect = 3e-13 Identities = 52/203 (25%), Positives = 94/203 (45%), Gaps = 35/203 (17%) Frame = +2 Query: 41 EDNSWNDVDGASIDDDEHSSPRDEERHEISLPIMKSSGANADSAKS--------ADNTDD 196 + +S +D S D D + ++ E S+ + G ++ +S D+ DD Sbjct: 13 DKDSGSDSSCFSSDSDPETEESEQSEEEDSVAEVSEDGDDSGDDESPAAGEDADVDDGDD 72 Query: 197 AVDAD--------------------------FPNCILKCKSVFKCKLCPRIMCLNVEMVK 298 DAD C+++ KSV+KC+ CP ++CLN ++ Sbjct: 73 NSDADDYGGTLEKMSMNRFLEEPPEEEEENYILGCMIQSKSVYKCRYCPTVVCLNENTMQ 132 Query: 299 IHLKSKRHARSEKLLGEGRLKLMLNSDGELEEEQETHAERHARTIALSQQVQKQKKDSGR 478 H+ SK+HAR EKL+ EG+++ +D E ++ ET ++ +K+KK + R Sbjct: 133 AHVSSKKHARMEKLVKEGKIR----TDDEEVDDLETASQ------------EKEKKGNRR 176 Query: 479 -QRQNRRKKKRSRVNLEEAQNNK 544 QRQ +R +K+ + +L + N+ Sbjct: 177 SQRQGKRSQKQEKDSLTKNGENE 199 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,066,331 Number of Sequences: 27288 Number of extensions: 297871 Number of successful extensions: 1664 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1633 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 904103924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770516|gb|BQ035237.1|BQ035237 952078C09.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (620 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22590.1 unknown protein / ; supported by cDNA: gi_17529301 252 1e-67 >At3g22590.1 unknown protein / ; supported by cDNA: gi_17529301 Length = 415 Score = 252 bits (644), Expect = 1e-67 Identities = 123/172 (71%), Positives = 148/172 (85%), Gaps = 1/172 (0%) Frame = +3 Query: 75 LGDGVVPIILVPSASQTLITIYNVKEFLEDGVFVPSEERMRATKGGKPESVTVQKKLIRT 254 +G+GV PIILVPSA QTLITIYNVKEFLEDGV++P++ + + KG KP+ +TVQKK R Sbjct: 248 IGEGV-PIILVPSAFQTLITIYNVKEFLEDGVYIPNDVKAKEMKGLKPDCITVQKKFSRD 306 Query: 255 -ERAGGAGGAVSFEVRDKPASLKSDDWGRVVAVFVLGKEWQFKDWPFKDHVEIFNRVIGF 431 ER ++EVRDKP++LK DDW RVVAVFVLGK+WQFKDWPFKDHVEIFN++IGF Sbjct: 307 RERV-----VTAYEVRDKPSALKPDDWDRVVAVFVLGKDWQFKDWPFKDHVEIFNKIIGF 361 Query: 432 YVRFEDDSVEAAKVVKQWNVKIISISKNKRHQDRTAALEVWERLEEFMRART 587 ++RFEDDS+E+AK VKQWNVKIISISKNKRHQDR AALEVWE+LEEF+R+R+ Sbjct: 362 FLRFEDDSIESAKTVKQWNVKIISISKNKRHQDRAAALEVWEKLEEFVRSRS 413 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,152,579 Number of Sequences: 27288 Number of extensions: 416638 Number of successful extensions: 1881 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1597 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1832 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 990590196 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770512|gb|BQ035233.1|BQ035233 952078C01.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (514 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g45150.1 hypothetical protein / predicted by genemark.hmm 198 2e-51 >At1g45150.1 hypothetical protein / predicted by genemark.hmm Length = 687 Score = 198 bits (503), Expect = 2e-51 Identities = 88/113 (77%), Positives = 102/113 (89%) Frame = -2 Query: 513 TGFLYWGSNCYEKAMIPSAEICFRRGLPPGDGVLFYPGEVFSSSHEPVASTRLERILSGM 334 TGFLYWG+NCYEKA +PSAE+ FRRGLPPGDGVL+YPGEVFSSS EPVAS RLER+LSG+ Sbjct: 573 TGFLYWGANCYEKATVPSAEVKFRRGLPPGDGVLYYPGEVFSSSSEPVASLRLERLLSGL 632 Query: 333 QDIEYLKLYSSRYGREEGLALIEKTGMYLGPDRYTLDHGPVDVMRGEVYRTCR 175 QD EYLKLY S+YGREE + L+EKTG+Y GP+RYTL+H P+DV+RGEVY TCR Sbjct: 633 QDYEYLKLYESKYGREEAMGLLEKTGVYTGPERYTLEHRPIDVLRGEVYNTCR 685 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,431,141 Number of Sequences: 27288 Number of extensions: 291012 Number of successful extensions: 702 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 702 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 702475800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770508|gb|BQ035229.1|BQ035229 952078B08.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (525 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g15352.1 Expressed protein / ; supported by cDNA: gi_14794... 107 3e-24 At1g53030.1 cytochrome C oxidase assembly protein, putative / ... 95 2e-20 >At3g15352.1 Expressed protein / ; supported by cDNA: gi_14794881_gb_AF349684.1_AF349684 Length = 74 Score = 107 bits (268), Expect = 3e-24 Identities = 50/74 (67%), Positives = 58/74 (77%), Gaps = 3/74 (4%) Frame = -1 Query: 381 LPETPAVNG---EGSSAATAAAPGAGSKPKKKICCACPDTKRLRDECVVEHGEPACTKWI 211 + + PA NG +S + AA A +KPKK+ICCACPDTK+LRDEC+VEHGE ACTKWI Sbjct: 1 MTDQPAQNGLIPPPTSEPSKAAASAETKPKKRICCACPDTKKLRDECIVEHGESACTKWI 60 Query: 210 EAHKRCLRAEGFNV 169 EAHK CLRAEGFNV Sbjct: 61 EAHKICLRAEGFNV 74 >At1g53030.1 cytochrome C oxidase assembly protein, putative / similar to GB:5851903 from [Rattus norvegicus];supported by full-length cDNA: Ceres:11496. Length = 72 Score = 94.7 bits (234), Expect = 2e-20 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -1 Query: 312 SKPKKKICCACPDTKRLRDECVVEHGEPACTKWIEAHKRCLRAEGFNV 169 +KPKK+ICCACPDTK+LRDEC+VEHGE ACTKWIEAH CLR+EGF V Sbjct: 25 TKPKKRICCACPDTKKLRDECIVEHGESACTKWIEAHILCLRSEGFKV 72 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,294,655 Number of Sequences: 27288 Number of extensions: 280845 Number of successful extensions: 1207 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1090 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1201 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 727283772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770494|gb|BQ035215.1|BQ035215 952078A05.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (556 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g12530.1 unknown protein / 213 5e-56 >At3g12530.1 unknown protein / Length = 191 Score = 213 bits (542), Expect = 5e-56 Identities = 104/146 (71%), Positives = 120/146 (81%) Frame = +3 Query: 117 VAEDEIVEIVPNIRMDALNMICGDFGPFFPQIPTKVPLWLAVALKKRSKCTIRTPDWMTV 296 +AEDE+VEIVPN+ M+ LN I GDFG F PQIPTKVPLWLAVALK+R KCT R P WM+V Sbjct: 1 MAEDELVEIVPNMNMEQLNFISGDFGRFIPQIPTKVPLWLAVALKRRGKCTFRPPGWMSV 60 Query: 297 DRLTQVLEAERESPREFQPLPFHYIEISKLLFDHARDDISDAYLVRSLIEDIRDVRFHKV 476 D LTQ+LEAERES FQ LPF Y+EI++LLFDHARDDI D Y+VRSL+EDIRDVR HK+ Sbjct: 61 DNLTQILEAERESQSTFQALPFSYVEIARLLFDHARDDIPDMYMVRSLVEDIRDVRLHKL 120 Query: 477 ETGLETISGRTHAVKLKNLSAMEVNI 554 ET L + G T AVK+ N+SAMEVNI Sbjct: 121 ETNLGSFQG-TSAVKISNVSAMEVNI 145 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,182,307 Number of Sequences: 27288 Number of extensions: 364201 Number of successful extensions: 1519 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1506 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 817071892 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770448|gb|BQ035169.1|BQ035169 952077C05.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (669 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g04690.1 unknown protein / ; supported by cDNA: gi_19715625 230 4e-61 >At2g04690.1 unknown protein / ; supported by cDNA: gi_19715625 Length = 210 Score = 230 bits (587), Expect = 4e-61 Identities = 111/186 (59%), Positives = 144/186 (76%) Frame = +1 Query: 1 FLLVVRSSAPGAAAARPIFDGKPSPSEATATARWLAAQNTWGVLSTISSDLSGAPFGNVV 180 FL +++ S+ +AR + KP + A+ARWL +QN+WGVLST+S D GAPFGNVV Sbjct: 19 FLTILQQSS----SARVLTITKPDRHDYAASARWLVSQNSWGVLSTLSVDHKGAPFGNVV 74 Query: 181 SYSDGVPGEGRGIPYFYLTTLDPSARDALEDERTSFTLSEFPLGTCGEIDPENPTCAKLT 360 S+SDG+P +G GIPYFYLTTLDP+AR+AL+D+R S +SE PLGTC DP NPTC+KLT Sbjct: 75 SFSDGLPEKGNGIPYFYLTTLDPTARNALKDQRASLAISESPLGTCTR-DPMNPTCSKLT 133 Query: 361 LNGKLKMVDLQSSEADLAKSALFTKHPEMKDWPKNHHFKIFKMEIENIFLIDWFGGPKPI 540 L GKL +++ S EA++AK ALFTKHPEM DWPK+H F+ FK+EI +IFLI+W+GG KPI Sbjct: 134 LTGKLLILEGGSEEAEVAKKALFTKHPEMMDWPKDHDFRFFKLEIIDIFLINWYGGAKPI 193 Query: 541 SPSQYL 558 + +YL Sbjct: 194 TVDEYL 199 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,818,657 Number of Sequences: 27288 Number of extensions: 467393 Number of successful extensions: 2939 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2673 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770364|gb|BQ035085.1|BQ035085 1091012C12.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (602 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77550.1 hypothetical protein / similar to GB:CAB55886 [Ho... 202 8e-53 >At1g77550.1 hypothetical protein / similar to GB:CAB55886 [Homo sapiens], GB:BAA09774 [Homo sapiens], GB:CAA87778 [Caenorhabditis elegans] Length = 883 Score = 202 bits (515), Expect = 8e-53 Identities = 110/204 (53%), Positives = 140/204 (67%), Gaps = 4/204 (1%) Frame = +3 Query: 3 LNLWGNKLRDPEKVMQEIRKCTKLKALWLNENPVLGKS---IDKAVLDGLSGLEIYNSHF 173 L+L GNK+ + V+QEI K LKALWLN+NPVL KS + +L G LEIYNS F Sbjct: 186 LSLIGNKIESADVVIQEIVKFKNLKALWLNDNPVLQKSERQMADEILQGCPSLEIYNSCF 245 Query: 174 TSKAGEWALGFCADIVGADNPCSSVESTLFGSIGTIDLSDRCIHKLP-EVFSPSKLPSLS 350 T G WALGFC DI G DNP + ++ ++DLS+R IH L + FS ++P LS Sbjct: 246 TPNYGLWALGFCGDIFGKDNPGCVQQDQPLCNVTSLDLSNRSIHNLVNKAFSVHEMPLLS 305 Query: 351 KLNVRGNPLDQISGDDLLKLFGGFTQLQELEVDIPGPLGNSAISILESLPNLSLLNGVDS 530 LN+RGN LDQ S +LL++ F L LEVDIPGPLG +A+ ILESL NLSLLNGVD+ Sbjct: 306 HLNIRGNSLDQNSVGELLEVLKLFPSLSSLEVDIPGPLGINALEILESLSNLSLLNGVDT 365 Query: 531 SSIIESGKHIVDSALEPRLPEWSP 602 + I+E+GKH+VDS L+PR+PE +P Sbjct: 366 AKILETGKHVVDSMLQPRIPELNP 389 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,490,847 Number of Sequences: 27288 Number of extensions: 327007 Number of successful extensions: 1045 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 999 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1040 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 948861544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770263|gb|BQ034984.1|BQ034984 1091011C12.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (533 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20835.1 hypothetical protein / 92 1e-19 >At2g20835.1 hypothetical protein / Length = 68 Score = 92.4 bits (228), Expect = 1e-19 Identities = 42/68 (61%), Positives = 52/68 (75%) Frame = -3 Query: 486 MVFFCFLVEQRRTVRSSKPAAGICSRCGGCASVADMETATRVCYLLTVHRRTWRAIICTF 307 M FCFLV+QR+ VR KPAAG+CSRCGG A VADM T+TR C + +R+ W+AI+C Sbjct: 1 MAIFCFLVDQRKKVRGRKPAAGLCSRCGGGAVVADMRTSTRFCG-VPFYRKAWKAIVCHI 59 Query: 306 CGAMLKSY 283 CGA+LKSY Sbjct: 60 CGAVLKSY 67 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,463,744 Number of Sequences: 27288 Number of extensions: 333929 Number of successful extensions: 2459 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1632 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2314 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 754220208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770156|gb|BQ034877.1|BQ034877 1091010B08.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (580 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g45830.1 DNA-binding protein - like / DNA-binding protein... 283 6e-77 >At3g45830.1 DNA-binding protein - like / DNA-binding protein R kappa B, Homo sapiens, PIR:S52863 Length = 1298 Score = 283 bits (723), Expect = 6e-77 Identities = 133/187 (71%), Positives = 163/187 (87%) Frame = +1 Query: 10 KVQELKAQKSLNTISPSSDEARTYFQREEFLRYSIPDRAFCYTAADGEKSIVAPLRRGGG 189 + ++L+AQKSL+TI+ SS+EAR YF++EEFLRYSIPDRAF YTAADG+KSIVAPLRRGGG Sbjct: 1016 RFKDLRAQKSLSTITQSSEEARAYFRKEEFLRYSIPDRAFVYTAADGKKSIVAPLRRGGG 1075 Query: 190 KPTANARGHPMLLPDRPPHVTILCLVRDAASRLPARTGTRADVCTLLRDSQYLNHEEANK 369 KPT+ AR H ML +RPPHVTILCLVRDAA+RLP GTRADVCTL+RDSQY+ + ++ Sbjct: 1076 KPTSKARDHFMLKRERPPHVTILCLVRDAAARLPGSIGTRADVCTLIRDSQYIVEDVSDS 1135 Query: 370 EAAINQVVSGALDRLHYERDPCVLYDNDKKLWTYLHRGREEEDFEDDGTSSTKKWKRPRR 549 + +NQVVSGALDRLHYERDPCV +D+++KLW YLHR RE+EDFEDDGTSSTKKWKRP++ Sbjct: 1136 Q--VNQVVSGALDRLHYERDPCVQFDSERKLWVYLHRDREQEDFEDDGTSSTKKWKRPKK 1193 Query: 550 DVSDAAE 570 + ++ E Sbjct: 1194 EAAEQTE 1200 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.315 0.133 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,984,431 Number of Sequences: 27288 Number of extensions: 322817 Number of successful extensions: 1172 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1168 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 877249352 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770131|gb|BQ034852.1|BQ034852 1091009H04.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (568 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g15200.1 expressed protein / EST gb|H77143 comes from this... 193 4e-50 >At1g15200.1 expressed protein / EST gb|H77143 comes from this gene; supported by cDNA: gi_15293206_gb_AY051037.1_ Length = 423 Score = 193 bits (491), Expect = 4e-50 Identities = 98/162 (60%), Positives = 127/162 (77%), Gaps = 6/162 (3%) Frame = +3 Query: 3 ARVAAKAEEKRLELLYIQWTEHHKRLSNFLRTKAEPPIYYMPTKPIIDDPAIVEQNKEKV 182 ARVAAKAE+K+LELL++QW+EH K+LSNF+RTKAEP IYY P KP+ +D + VEQ KE+ Sbjct: 231 ARVAAKAEQKKLELLFLQWSEHQKKLSNFIRTKAEPRIYYAPVKPLEEDTSEVEQQKERT 290 Query: 183 FEEWKSMRRAELTQFQKQVEEQYLSNVERQLERIQNARNARKANGPG-NMQE-MDKELDT 356 F EWK+ RR E++++QK++EEQ L NVE++LER QNAR ARKAN G N+QE MDKEL+T Sbjct: 291 FLEWKAARRQEVSEYQKEIEEQCLGNVEKELERWQNARKARKANNEGMNLQETMDKELET 350 Query: 357 HRAEHGPKPRRVPEEGGNDDDED---ADDMAAEDE-LMDEVL 470 HR EHGPK R++P G D+DE+ D EDE +MD++L Sbjct: 351 HRMEHGPKKRKIPGGGVGDEDEEDEVEDINGGEDEMIMDDLL 392 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,127,132 Number of Sequences: 27288 Number of extensions: 363572 Number of successful extensions: 3117 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2759 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 841443256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770114|gb|BQ034835.1|BQ034835 1091009F04.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (622 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49970.1 putative protein / contains similarity to pyridox... 177 5e-45 >At5g49970.1 putative protein / contains similarity to pyridoxamine 5-phosphate oxidase;supported by full-length cDNA: Ceres:6244. Length = 466 Score = 177 bits (448), Expect = 5e-45 Identities = 77/119 (64%), Positives = 100/119 (83%) Frame = +1 Query: 1 WNEMNRQVRVEGSAEKVPEAESDKYFHSRPRGSQLGAIVSKQSTVIAGREVLQQDYKKLE 180 W +NRQVR+EG E++PE+ES+ YFHSRPRGSQ+GAIVSKQS+V+ GR VL +Y++L Sbjct: 348 WEILNRQVRIEGPVERIPESESENYFHSRPRGSQIGAIVSKQSSVVPGRHVLYDEYEELT 407 Query: 181 QKYSDGSLIPKPEYWGGYKLTPTLFEFWQGQQSRLHDRLQYSQREVDGSTVWHIERLSP 357 ++YSDGS+IPKP+ WGG++L P LFEFWQGQ SRLHDRLQYS ++V+G+ W I RL+P Sbjct: 408 KQYSDGSVIPKPKNWGGFRLKPNLFEFWQGQPSRLHDRLQYSLQDVNGNPAWKIHRLAP 466 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,444,680 Number of Sequences: 27288 Number of extensions: 319261 Number of successful extensions: 959 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 959 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 990590196 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19769779|gb|BQ034500.1|BQ034500 1091003A07.x2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (573 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g23090.1 Expressed protein / ; supported by full-length cD... 135 2e-32 >At2g23090.1 Expressed protein / ; supported by full-length cDNA: Ceres: 14468. Length = 78 Score = 135 bits (339), Expect = 2e-32 Identities = 65/78 (83%), Positives = 68/78 (86%), Gaps = 1/78 (1%) Frame = -3 Query: 445 MGGGNGQKSKMARERNLEKNKGA-KGSQLETNKKAMSIQCKVCMQTFMCTTTEVKCREHA 269 MGGGN QKS MAR +NLEK K A KGSQLE NKKAMSIQCKVCMQTF+CTT+EVKCREHA Sbjct: 1 MGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHA 60 Query: 268 EAKHPKTDVYQCFPHLKK 215 EAKHPK DV CFPHLKK Sbjct: 61 EAKHPKADVVACFPHLKK 78 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,781,235 Number of Sequences: 27288 Number of extensions: 372873 Number of successful extensions: 1293 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1216 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1288 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 859346304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19769502|gb|BQ034223.1|BQ034223 1091006G07.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (431 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30820.1 Expressed protein / ; supported by full-length cD... 109 5e-25 >At4g30820.1 Expressed protein / ; supported by full-length cDNA: Ceres: 14193. Length = 178 Score = 109 bits (273), Expect = 5e-25 Identities = 52/87 (59%), Positives = 70/87 (79%) Frame = -2 Query: 430 LRRRIASIFNKTQEHFPTLKDYNDYLEEVEDMTFNLIEGIDVEEIEAKIARYQQENAEQI 251 +RRRI+ I+N+ +E FP+LKDYNDYLEEVE M F+LI+GI+VE IE KI RY +ENAEQI Sbjct: 16 VRRRISEIYNRREEEFPSLKDYNDYLEEVECMVFDLIDGINVEAIEQKIKRYSKENAEQI 75 Query: 250 YLSRAKRAEDLAAALKASRMNPVKAEA 170 ++RA++AE+L AAL A + P + +A Sbjct: 76 MINRARKAEELTAALAACKAKPPQTDA 102 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,352,217 Number of Sequences: 27288 Number of extensions: 193275 Number of successful extensions: 522 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 522 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 480215828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19437282|gb|BM953692.1|BM953692 952064H07.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (425 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g15140.1 expressed protein / ; supported by cDNA: gi_16930... 220 2e-58 >At3g15140.1 expressed protein / ; supported by cDNA: gi_16930516_gb_AF419612.1_AF419612 Length = 337 Score = 220 bits (560), Expect = 2e-58 Identities = 97/141 (68%), Positives = 116/141 (81%) Frame = +2 Query: 2 EQRTTEYIEGKYGKFGVDRVWHDTATPFKQVLQEFEDWLGNHNLWKKEQGGSLNRGAFVT 181 EQ +YIEGKYG+ GVDRVWHDTA PFKQV++EFE WL H+LW K+ LN AFVT Sbjct: 170 EQAINKYIEGKYGELGVDRVWHDTAIPFKQVVEEFEVWLAEHDLWDKDTDWGLNDAAFVT 229 Query: 182 CGNWDLKTKVPEQCKVSKINLPTYFMEWINLKDIYLNFYNRRATGMMTMMRELQLPIVGN 361 CGNWD+KTK+PEQC VS INLP YFMEWINLKD+YLNFY R A GM++MMR+ + ++G+ Sbjct: 230 CGNWDIKTKIPEQCVVSNINLPPYFMEWINLKDVYLNFYGREARGMVSMMRQCGIKLMGS 289 Query: 362 HHLGIDDSKNIARVVQRMLAD 424 HHLGIDD+KNI RVVQRML++ Sbjct: 290 HHLGIDDTKNITRVVQRMLSE 310 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,418,307 Number of Sequences: 27288 Number of extensions: 229322 Number of successful extensions: 721 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 720 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 472574128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19437058|gb|BM953468.1|BM953468 952062H09.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (487 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g29660.1 putative protein / predicted proteins, Arabidopsi... 128 2e-30 >At4g29660.1 putative protein / predicted proteins, Arabidopsis thaliana; supported by full-length cDNA: Ceres: 13465. Length = 103 Score = 128 bits (321), Expect = 2e-30 Identities = 53/83 (63%), Positives = 69/83 (82%) Frame = +3 Query: 27 YADRQFHKWEKTVLWDMVEPYRPPRSFAPLVGTYVAAFYTGVVGAAVTEQLYKEKYWEDH 206 YAD +++K+E+ +W+M+EPYR P++F L+ YVAAFYTGV+GAAVTEQLYKEK+WE+H Sbjct: 12 YADYKYNKFERFAVWEMIEPYRRPKTFTTLITIYVAAFYTGVIGAAVTEQLYKEKFWEEH 71 Query: 207 PGEAVPIMPPKFYWGPWRVMNGE 275 PG+ VP+M P FY GPWRV GE Sbjct: 72 PGKTVPLMKPVFYRGPWRVYRGE 94 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,129,935 Number of Sequences: 27288 Number of extensions: 347235 Number of successful extensions: 3293 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3069 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 632337160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19437030|gb|BM953440.1|BM953440 952062E02.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (385 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g53710.1 cell division control protein, putative / similar... 65 8e-12 >At1g53710.1 cell division control protein, putative / similar to SP:P40986 from [Saccharomyces cerevisiae] Length = 393 Score = 65.5 bits (158), Expect = 8e-12 Identities = 36/84 (42%), Positives = 53/84 (62%), Gaps = 3/84 (3%) Frame = +2 Query: 35 RGSVVARATAGRHRLEPDSSIRVDMGSEMTSEDGGK---LARAGKSGARKVLQRLFRVIQ 205 +G+ V R+ A ++ E I + M S++ + GG + A KS + V+QR+ R I Sbjct: 312 KGNAVMRSAARKNASE---QIELVMDSDVNASAGGSDPLMRSASKSRTKLVIQRVIRTIM 368 Query: 206 SVLVIAALNAPLYMMLLFKDWIDR 277 V+VIAALN P+YMMLLFKDWI++ Sbjct: 369 MVIVIAALNVPIYMMLLFKDWIEQ 392 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,783,710 Number of Sequences: 27288 Number of extensions: 196686 Number of successful extensions: 2116 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 826 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1154 length of database: 11,516,596 effective HSP length: 87 effective length of database: 9,142,540 effective search space used: 365701600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19436955|gb|BM953365.1|BM953365 952061C12.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (499 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g04900.1 expressed protein / ;supported by full-length cDN... 223 5e-59 >At1g04900.1 expressed protein / ;supported by full-length cDNA: Ceres:98874. Length = 442 Score = 223 bits (567), Expect = 5e-59 Identities = 106/158 (67%), Positives = 132/158 (83%) Frame = +2 Query: 26 ALFSSGILAGNKPILVRDFVRSALYDPNHGYFSKRAGPVGVLDASIRFNQLEGRSAYIQH 205 A FS+ L G++P+LVRDF+ +ALYDP GYFS+R+ VGVL+ SI+FNQLEGR AY++ Sbjct: 29 AFFSTQKLIGDEPVLVRDFIHTALYDPIQGYFSQRSKSVGVLERSIKFNQLEGRKAYMKL 88 Query: 206 LDKLYKKHDIAWFTPVELFKPWYAYAIAASILRTANLSVPLKIYEIGGGSGTCAKCILDY 385 L+K+YK+ DI+WFTPVELFKPWYA+ IA +ILRT NLSVPLKIYEIGGGSGTCAK +LDY Sbjct: 89 LEKVYKQSDISWFTPVELFKPWYAHGIAEAILRTTNLSVPLKIYEIGGGSGTCAKGVLDY 148 Query: 386 MMLNAPPKVYNDMKYISVEISSSLAEKQLETVGEVQSH 499 +MLNAP ++Y +M Y S+EIS SLA+ Q ETV +V SH Sbjct: 149 IMLNAPERIYKNMSYTSIEISPSLAKIQKETVAQVGSH 186 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,004,190 Number of Sequences: 27288 Number of extensions: 272461 Number of successful extensions: 820 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 820 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 657445300 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19436953|gb|BM953363.1|BM953363 952061C10.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (563 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21820.1 putative protein / calmodulin-binding protein SHA... 103 6e-23 >At4g21820.1 putative protein / calmodulin-binding protein SHA1, Mus musculus,AF062378 Length = 1088 Score = 103 bits (257), Expect = 6e-23 Identities = 65/156 (41%), Positives = 90/156 (57%), Gaps = 15/156 (9%) Frame = -3 Query: 561 LVAAGAVDILLKQIYLLXRGIADQEVLMQVFLTLRNIARYSNLRQVLASTAESVEIIFHE 382 LVAAGA++ LL I R I DQ+V TL ++ARY + L +T S++ IF E Sbjct: 933 LVAAGAIEKLLTLIRSASRSIPDQQVSKHALSTLGHLARYPQMADELINTKGSIQTIFWE 992 Query: 381 LLR-------------NKADGFFIASDILKSLCESKEGRETVQALSHLIKRLRNLVHDLE 241 LLR NK + +FIASD+LK +C S +G E V+ L L+KRL LV +L Sbjct: 993 LLRSSFSSQVFFLSFKNKEEAYFIASDVLKKICSSHKGVEAVRKLPALVKRLHVLVEELT 1052 Query: 240 KKVELDKRN--GRTGAMKATNLRRLREAATLYHILT 139 +K ++KRN G+TG K+ RRL+EA L ++T Sbjct: 1053 RKANIEKRNVKGQTGKEKSE--RRLKEAIELVKLIT 1086 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,179,842 Number of Sequences: 27288 Number of extensions: 261946 Number of successful extensions: 729 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 728 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 832491732 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19436444|gb|BM952854.1|BM952854 952059F11.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (593 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14240.1 putative protein / various predicted proteins fro... 175 1e-44 >At5g14240.1 putative protein / various predicted proteins from D. melanogaster, H. sapiens and S. pombe;supported by full-length cDNA: Ceres:37589. Length = 256 Score = 175 bits (444), Expect = 1e-44 Identities = 83/121 (68%), Positives = 103/121 (84%), Gaps = 1/121 (0%) Frame = +1 Query: 88 GIPECGLLQNCLEELATRYPATKFVKIISTDCIPNYPDRNVPTILVYNNSAVKGTYVGLQ 267 G+ EC LL CL+EL +RYPATKFVKIISTDCIPNYPD N+PT+LVY++ A+KGT+VGL+ Sbjct: 131 GVAECSLLLGCLDELGSRYPATKFVKIISTDCIPNYPDCNLPTLLVYHHGAIKGTHVGLK 190 Query: 268 KFGGKRCTPESVALALCQSDPVLNDGHGG-SDSSRDNVIEGVRRKFIEKVVAQHEEREEE 444 F G+RCTPESVAL LCQS+PVLNDG GG DSSR+ V+ GVRR+FIE+VV HE+++ + Sbjct: 191 SF-GRRCTPESVALLLCQSEPVLNDGKGGDDDSSREAVMAGVRRQFIERVVKDHEDKDND 249 Query: 445 D 447 D Sbjct: 250 D 250 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,553,828 Number of Sequences: 27288 Number of extensions: 347926 Number of successful extensions: 1123 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1081 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1121 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 922006972 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19436394|gb|BM952804.1|BM952804 952059C06.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (625 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g34090.1 hypothetical protein / predicted by genefinder, s... 196 6e-55 >At2g34090.1 hypothetical protein / predicted by genefinder, similar to GP|1301832|gnl|PID|e239862|Z71287 Length = 488 Score = 196 bits (497), Expect(2) = 6e-55 Identities = 94/120 (78%), Positives = 107/120 (88%) Frame = +2 Query: 74 VVEELKKVTTRVAHVLPVSDDGGSTAEIVRVLGGPAVGDIRSRCLRLSDESTAEALSVRK 253 VVEELKK+TTRVAHVLPVSDDGGSTAEIVRVLGGPAVGDIRSRCLRLSDEST+EAL+VR+ Sbjct: 66 VVEELKKLTTRVAHVLPVSDDGGSTAEIVRVLGGPAVGDIRSRCLRLSDESTSEALAVRR 125 Query: 254 LLGHRLPIDPSEAKLEWYQIVEGDHTLWEGVSRPYRETIRAFLVYFHSEILRRSAEMFCF 433 LLGHRLPID +AK +WY IVEG+H+LW+GVSRPY ETIRAFL+YF +E++ E F Sbjct: 126 LLGHRLPIDAHQAKKDWYDIVEGNHSLWDGVSRPYSETIRAFLIYFQNEVMLTDTEKHVF 185 Score = 35.8 bits (81), Expect(2) = 6e-55 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +3 Query: 30 PPSLLVFSGGTAFNGLLKN*RK 95 PPSLLVFSGGT FNG+++ +K Sbjct: 51 PPSLLVFSGGTGFNGVVEELKK 72 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,401,313 Number of Sequences: 27288 Number of extensions: 374633 Number of successful extensions: 4245 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3650 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 999514432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19436199|gb|BM952609.1|BM952609 952076D03.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (594 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g31780.1 unknown protein / 282 8e-77 >At1g31780.1 unknown protein / Length = 706 Score = 282 bits (722), Expect = 8e-77 Identities = 148/223 (66%), Positives = 163/223 (72%), Gaps = 26/223 (11%) Frame = +2 Query: 2 HHQRAGLELMDMMSVYQEGAYERLCRWV--------------------------QAECKK 103 HHQRAGLELMDMM+VYQEGAYERLCR + AEC+K Sbjct: 175 HHQRAGLELMDMMAVYQEGAYERLCRTIICFQKGSPFLNSFRANEKTQYWLLKQNAECRK 234 Query: 104 LGDTDNPEVSELLKMAVCCLKERPVLFKYCAEEVANMRHHALFRRFISALTRGGPGGFPR 283 LGDTDNPEVSELL+ AV CLKERPVLFKYCAEEV N+RH+ALFRRFISALTRGGPGG PR Sbjct: 235 LGDTDNPEVSELLRTAVRCLKERPVLFKYCAEEVGNLRHNALFRRFISALTRGGPGGMPR 294 Query: 284 PIEVHAHDPLRYVGEMLGWLHQALASERELIVVLLDPDAMTDSGPTFRRQSGRDGDSSKG 463 PIEVHAHDPLRYVG+MLGWLHQALASEREL+ L D D+ + + + G Sbjct: 295 PIEVHAHDPLRYVGDMLGWLHQALASERELVHALFDIDSADHQSNA--KNTSENIALKAG 352 Query: 464 EPDVTSVLDRIFEGACRPFKGRVEQGLQAQPSLIGSFKLSNTL 592 E D T VLDRIFEG CRPFK RVEQ LQ+QPSLI S+KL+NTL Sbjct: 353 ESDFTFVLDRIFEGVCRPFKVRVEQVLQSQPSLIISYKLTNTL 395 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,807,342 Number of Sequences: 27288 Number of extensions: 304144 Number of successful extensions: 883 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 879 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 922006972 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19436192|gb|BM952602.1|BM952602 952076C06.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (637 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25830.1 expressed protein / ; supported by cDNA: gi_15810... 288 1e-78 >At2g25830.1 expressed protein / ; supported by cDNA: gi_15810382_gb_AY056230.1_ Length = 331 Score = 288 bits (738), Expect = 1e-78 Identities = 144/211 (68%), Positives = 178/211 (84%), Gaps = 1/211 (0%) Frame = +2 Query: 2 RSCKIAGRKDAQNLKKMKRNSKIGKEIVAAIKKGGPNPSSNTTLSAILEKARELDVPREI 181 RS KIAGRK AQ+ KK K +IGKE+V+A+KKGGPNP SNTTL+ IL+KA+ELDVP++I Sbjct: 87 RSSKIAGRKGAQDSKKAKLYCRIGKEVVSAVKKGGPNPVSNTTLATILDKAKELDVPKDI 146 Query: 182 LERNIKRASEKGQDTYTEKVYEVYGFGGVGMVVEVLTDKITRSVADIRNVVKDCGAKLAD 361 +ERNIKRASEKGQ+ + EK+YEVYG+GGV MVVEVLTDKI RSVA IR+VVKD G K+AD Sbjct: 147 VERNIKRASEKGQEAFIEKIYEVYGYGGVSMVVEVLTDKINRSVAAIRSVVKDYGGKMAD 206 Query: 362 PGSVTFRFRQARVVNIKVTDADKDQLLTVALDAGADDVLE-PNFDDDDSEEEAERFYKIV 538 GSV F+F++ RVVNIKVT+ADKDQLL +ALDAGA+DV+E P ++DD E+ ER+YKIV Sbjct: 207 SGSVMFKFKRVRVVNIKVTEADKDQLLIIALDAGAEDVIEPPTYEDDTDEDREERYYKIV 266 Query: 539 TTSENYPGLLSKLQEEGLKVETDNGYELGPL 631 T++ENY +LSKL++EG+ E DNG EL PL Sbjct: 267 TSNENYSTILSKLRDEGVNFEPDNGSELLPL 297 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,163,437 Number of Sequences: 27288 Number of extensions: 313062 Number of successful extensions: 1571 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1524 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19436134|gb|BM952544.1|BM952544 952075E04.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (653 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30790.1 putative protein / 92 2e-19 At1g05130.1 unknown protein / EST gb|ATTS1136 comes from this... 48 4e-06 >At4g30790.1 putative protein / Length = 1148 Score = 92.4 bits (228), Expect = 2e-19 Identities = 50/119 (42%), Positives = 74/119 (62%), Gaps = 1/119 (0%) Frame = -1 Query: 362 KLIVHVAENGHTLEFQCGGDTLVEAIQHSIQLHCEIPPADQLLLCGNISLDGANALATYK 183 KL++ VAENGH+ EFQC T VE++ ++ I +DQLLL ++ L+ L+ + Sbjct: 14 KLLLCVAENGHSFEFQCSETTSVESVMRFVESVSGIALSDQLLLSLDMKLEPQKLLSAFG 73 Query: 182 LPRDDREVFLYNKARLLADSRPPAPESLYIPE-PNIPPPPRPQGSPPSDASADPALKAL 9 LP DREVF++NKA L ++S PP+PE + + + + PP P D ++DPALKAL Sbjct: 74 LPASDREVFVFNKAMLQSNSHPPSPEDVDLQDVADALPPASLHEHHPLDDASDPALKAL 132 >At1g05130.1 unknown protein / EST gb|ATTS1136 comes from this gene Length = 402 Score = 48.1 bits (113), Expect = 4e-06 Identities = 36/118 (30%), Positives = 61/118 (51%), Gaps = 6/118 (5%) Frame = -2 Query: 349 TWRRTATPWSSSAAATRSSRPSSTPSSSTAKYPLPISSSSAATSPSTAPTRSPPTSFRGT 170 T ++T +SSA+ T+SS S+T SSS +K P +S+++A T+ +++PT P T+ Sbjct: 275 TTNTSSTTTTSSASTTKSSSSSATNSSSGSK-PSTLSTTTAYTATTSSPTAEPSTTTASK 333 Query: 169 TVRSSSTTRPGSLRTPGPRRRSPSTSLSQIF------LRRPGRRAHHLRTHLQTPR*R 14 SS+ P ++ PRR + F +R + ++ L+ HLQ R R Sbjct: 334 PATSSTPPAPPTIIVSKPRRTHHRSIPQNTFHTRIKQNQRKKQTSNALKFHLQGERER 391 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,101,008 Number of Sequences: 27288 Number of extensions: 552657 Number of successful extensions: 11058 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 3378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8913 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1088756792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19351633|gb|BM896165.1|BM896165 952067D07.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (515 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67140.1 hypothetical protein / predicted by genemark.hmm 145 9e-36 >At1g67140.1 hypothetical protein / predicted by genemark.hmm Length = 2149 Score = 145 bits (367), Expect = 9e-36 Identities = 84/164 (51%), Positives = 104/164 (63%), Gaps = 38/164 (23%) Frame = -2 Query: 508 VAYVSQVQGTLFLAMEILLLEENGYVDLRQGIGHLINAIVAVIGPELAPDSTFFSRCKSV 329 +++VS VQ L LA++ILL EE+G++DL QGIG LINAIVAV+GPEL+P S FSRCKSV Sbjct: 831 LSFVSHVQAALGLALDILLTEESGWIDLSQGIGRLINAIVAVLGPELSPGSILFSRCKSV 890 Query: 328 IAEISSSNEMATLLE--------------------------------------SVRFSQQ 263 IAEISS E+ TLLE SV F+QQ Sbjct: 891 IAEISSWQEIPTLLEYVNAFLFATIILIHCYYYMNYLYPVSSLIFIVNLNIFRSVCFTQQ 950 Query: 262 LVLFAPQAVPVHLHVQGLIPMLYSRQPSLRYLAVSTLHHLIERD 131 L+LFAPQAV VH+HV+ L+ L SRQP +R L+VSTL HL+E+D Sbjct: 951 LILFAPQAVSVHIHVKNLLMTLASRQPIIRRLSVSTLRHLVEKD 994 Score = 64.7 bits (156), Expect = 3e-11 Identities = 29/45 (64%), Positives = 36/45 (79%) Frame = +1 Query: 1 PAAMIDENIEENLFSMLDEETDSETAMLVRATIIRLLYTSCPVCP 135 P ++IDE IE+NLF MLDEETDSE L+R+T+IRLLY +CP P Sbjct: 995 PVSVIDEQIEDNLFQMLDEETDSEIGNLIRSTLIRLLYATCPSRP 1039 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,928,489 Number of Sequences: 27288 Number of extensions: 225287 Number of successful extensions: 646 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 631 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 711481900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19351626|gb|BM896158.1|BM896158 952067C10.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (611 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g13540.1 putative cap-binding protein / ; supported by cD... 237 4e-63 >At2g13540.1 putative cap-binding protein / ; supported by cDNA: gi_15192737_gb_AF272891.1_AF272891 Length = 848 Score = 237 bits (604), Expect = 4e-63 Identities = 119/203 (58%), Positives = 149/203 (72%), Gaps = 2/203 (0%) Frame = +2 Query: 8 ANLQDALHNENRDRIRILLRFLSGLMCSKVVVPSSIIETFETLLSSAVTILDDETGNPSW 187 AN Q AL + N + IRILLRF++ L+CSKV+ P+S+I FETLLSSA T +D+E GNPSW Sbjct: 88 ANFQVALDSGNCNSIRILLRFMTSLLCSKVIQPASLIVVFETLLSSAATTVDEEKGNPSW 147 Query: 188 QPRADFYVYCILASLPWAGPELFEQVPDEFERVLFGIQSYISIRRHFDDIAFSVFETDEG 367 QP+ADFYV CIL+SLPW G EL EQVPDE ERVL GIQ+Y+SIR++ + F E Sbjct: 148 QPQADFYVICILSSLPWGGSELAEQVPDEIERVLVGIQAYLSIRKNSSTSGLNFFHNGEF 207 Query: 368 HSP-NKKDFMEDLWERIQALSRNGWKVKSVPKPHLPFEAQLVAGKSHRLSPISC-PPPTP 541 S +KDF+EDL +RIQ+L+ NGWK++SVP+PHL FEAQLVAGK H L PI C P+P Sbjct: 208 ESSLAEKDFVEDLLDRIQSLASNGWKLESVPRPHLSFEAQLVAGKFHELRPIKCMEQPSP 267 Query: 542 SQSSSEMLKGQEKHEADMKYPQR 610 S G++KH+A +YPQR Sbjct: 268 PSDHSRAYSGKQKHDALTRYPQR 290 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,147,481 Number of Sequences: 27288 Number of extensions: 319044 Number of successful extensions: 1108 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1102 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 963817488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19351533|gb|BM896065.1|BM896065 952072G04.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (500 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g03910.1 hypothetical protein / predicted by genscan 253 5e-68 >At1g03910.1 hypothetical protein / predicted by genscan Length = 672 Score = 253 bits (645), Expect = 5e-68 Identities = 111/119 (93%), Positives = 115/119 (96%) Frame = +3 Query: 3 PRKPKYFNRVHTGYEWNKYNQTHYDHDNPPPKIVQGYKFNIFYPDLVDKSKAPTYSIEKD 182 PRKPKYFNRVHTGYEWNKYNQTHYDHDNPPPKIVQGYKFNIFYPDLVDK KAP Y+IEKD Sbjct: 554 PRKPKYFNRVHTGYEWNKYNQTHYDHDNPPPKIVQGYKFNIFYPDLVDKIKAPIYTIEKD 613 Query: 183 GSAGETCFIRFHAGPPYEDIAFRIVNKEWEYSHKKGFKCTFERGILHLYFNFKRYRYRR 359 G++ ETC IRFHAGPPYEDIAFRIVNKEWEYSHKKGFKCTFERGILHLYFNFKR+RYRR Sbjct: 614 GTSAETCMIRFHAGPPYEDIAFRIVNKEWEYSHKKGFKCTFERGILHLYFNFKRHRYRR 672 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,101,401 Number of Sequences: 27288 Number of extensions: 280411 Number of successful extensions: 853 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 852 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 666451400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19351510|gb|BM896042.1|BM896042 952072D10.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (494 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g37190.1 tubulin-like protein / 174 3e-44 >At4g37190.1 tubulin-like protein / Length = 562 Score = 174 bits (440), Expect = 3e-44 Identities = 90/161 (55%), Positives = 119/161 (73%), Gaps = 2/161 (1%) Frame = +2 Query: 2 FFVEECDHIQGIQFLVDDSGGFASVAAQFLESIVDDYTNTPVMLYCVRNPDSYGSSRNQR 181 FFVEECDHIQGI+FLVDDSGGF++VAA FLE++ D+YTN PV+LY VR P S SS + Sbjct: 203 FFVEECDHIQGIKFLVDDSGGFSAVAADFLENMADEYTNVPVLLYSVRTPMSQMSS---K 259 Query: 182 ETIIRSLHDAVSLSKLSYYCNLMVPIGLPSL--SYLSPLLSIKDEKHFHSSAICAAAMHS 355 +T+ LHDA+S S+LS +C L PIGLPSL S S L++ DEK + SSA+ AAA+HS Sbjct: 260 KTVSNKLHDAISFSRLSSFCKLFTPIGLPSLTGSKASKFLNLGDEKPYRSSAVYAAALHS 319 Query: 356 LSIPFRLQHVGPASDSAHSSGKLDIGELVHILSDQGRQNMI 478 +IPFR+Q +SDS+ S +D+ LV +L+ +GRQN++ Sbjct: 320 STIPFRMQPT--SSDSSEVSNSMDVNTLVQLLTGRGRQNIV 358 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,622,845 Number of Sequences: 27288 Number of extensions: 249312 Number of successful extensions: 726 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 723 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 648439200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19351489|gb|BM896021.1|BM896021 952072B05.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (529 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19140.1 expressed protein / ;supported by full-length cD... 154 3e-38 >At4g19140.1 expressed protein / ;supported by full-length cDNA: Ceres:151921. Length = 303 Score = 154 bits (388), Expect = 3e-38 Identities = 81/171 (47%), Positives = 109/171 (63%), Gaps = 3/171 (1%) Frame = +2 Query: 8 STCRILSSGVDLRSSKVCELGLLNYRAKHVFYPSSKRRFRCHDDYYWASVLQVEYTEYFS 187 S C+I+SS VDLRSSKVC +GLLN +A+HVFYP + +FRC DYYWASV +VEY + Sbjct: 69 SRCKIVSSSVDLRSSKVCGIGLLNVKAQHVFYPFERDKFRCRYDYYWASVFKVEYKDNLM 128 Query: 188 GQLSYAVAEAPKEALPHNCRPDFGAAWSTTLKFKVNESYSCRYMLGSNKADIHSNKLFNC 367 GQ A +EAP EALP CRP+FGAA T FKVNE+Y C Y LG K ++ + F C Sbjct: 129 GQTRLAFSEAPNEALPPECRPNFGAALLTKDNFKVNETYDCWYTLGIPKIKLYRDSFFGC 188 Query: 368 TAEEPSTGELFKRILILFSEMYVS--EDFSSGRMLVY-VAAGVALGMLSSM 511 A++ S ++ K+ I+ S++ S S+ + Y V AG+ G +S+ Sbjct: 189 QADDLSFTDIAKQYSIVISKLLQSWLNGESTPKYWKYDVIAGIVSGFATSI 239 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,423,570 Number of Sequences: 27288 Number of extensions: 237606 Number of successful extensions: 606 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 606 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 736262584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19351230|gb|BM895762.1|BM895762 952065B06.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (615 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11790.1 expressed protein / supported by full-length cDNA... 155 1e-38 >At4g11790.1 expressed protein / supported by full-length cDNA: Ceres:151415. Length = 443 Score = 155 bits (393), Expect = 1e-38 Identities = 79/136 (58%), Positives = 98/136 (71%), Gaps = 1/136 (0%) Frame = -3 Query: 613 SPSVKKAEEKGVVVVHETKCKVYVKHDD-ATKGWKDIGVGQLSIRSKEGTEKASKESTPT 437 SPSVKK EEKG+ VVHE KCK+YVK D A KGWKD G G L I+ KEG +K +KES PT Sbjct: 312 SPSVKKTEEKGITVVHEVKCKLYVKSSDPADKGWKDKGTGNLYIKCKEGVDKGTKESKPT 371 Query: 436 IVIRNDVGKILLNALIYKGIKMNLQKNTVASIFHTSDAQSSESAGDTVVARTYLFRLKNV 257 I++RNDVGK+LLNAL+Y G+K + QKN + +IFH+SD + + V RT+L R KN Sbjct: 372 ILVRNDVGKLLLNALLYAGMKTSPQKNALVAIFHSSD-----DSNENVTPRTFLIRTKNA 426 Query: 256 EEATKLSTAIKENAPS 209 E L+TAI+E APS Sbjct: 427 EARDNLATAIQEYAPS 442 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,534,609 Number of Sequences: 27288 Number of extensions: 294606 Number of successful extensions: 765 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 763 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 972741724 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19351133|gb|BM895665.1|BM895665 952076G04.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (562 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g00450.1 hypothetical protein / 143 5e-35 >At4g00450.1 hypothetical protein / Length = 2124 Score = 143 bits (361), Expect = 5e-35 Identities = 78/125 (62%), Positives = 94/125 (74%), Gaps = 20/125 (16%) Frame = -3 Query: 335 ALKKRLRAINESRAQKRK--------------------AGQVYGVPLSGSLLIKPGVYPE 216 A++K LRAINESRA KRK AGQVYGVPLSGSLL KPG +PE Sbjct: 12 AVRKCLRAINESRALKRKVIKRLSDSNPFQFIFCAEFRAGQVYGVPLSGSLLCKPG-FPE 70 Query: 215 QRPCNEDARRKWIEALAQPNKRLRSLSEHVPHGYRRKSLFEGLIRYNVPLLRATWFIKVT 36 QR C E+ +++WIE+L+Q +KRLRSL++++P GYRRK+LFE LIR NVPLLRATWFIKVT Sbjct: 71 QRSCGEETKKRWIESLSQQHKRLRSLADNIP-GYRRKTLFEVLIRNNVPLLRATWFIKVT 129 Query: 35 YLNQL 21 YLNQ+ Sbjct: 130 YLNQV 134 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,857,132 Number of Sequences: 27288 Number of extensions: 274493 Number of successful extensions: 801 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 781 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 798 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 835029516 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19351055|gb|BM895587.1|BM895587 952075F03.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (498 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g18700.1 unknown protein / ; supported by cDNA: gi_17979006 108 2e-24 >At1g18700.1 unknown protein / ; supported by cDNA: gi_17979006 Length = 700 Score = 108 bits (269), Expect = 2e-24 Identities = 63/171 (36%), Positives = 97/171 (55%), Gaps = 7/171 (4%) Frame = +3 Query: 6 LSKAATAFKDDRLTFVWLDGEVQKQICAFYLATDYT-GACGPRDFGDDNDKPEIFIVRFQ 182 ++ AA+A K RL+F WLDGE Q + C FY+ ++ + CG R D P I IVR+ Sbjct: 445 ITPAASAHKSKRLSFAWLDGEAQNKYCFFYVQSETSYDTCGTRRA--PIDVPRILIVRYH 502 Query: 183 RNATYEALXAEKKNNLVDVLQGQHAD----ASQLVARYKGPVEIEEINRWISQIIKDGDT 350 RNAT A +K + + AD A+QLV Y G EI +I +W+S+++ DGD Sbjct: 503 RNATETANAEQKSSKWPKTVWQSEADDVDPAAQLVVSYDGTAEIPQIIKWLSKMVDDGDN 562 Query: 351 REIPYFTSKVPDLVPE--ETSKAWSSKSIRSAGKSLKENIGFHFQDYLTHP 497 R +P++ +K P+LVPE E ++ K++++ K L ++ +DYL P Sbjct: 563 RNLPFYRAKTPELVPESAEPMRSGVPKTVKATQKLL--SLWNRIKDYLADP 611 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,306,498 Number of Sequences: 27288 Number of extensions: 239804 Number of successful extensions: 719 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 707 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 717 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 657445300 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19351030|gb|BM895562.1|BM895562 952075C05.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (474 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g16570.1 unknown protein / contains similarity to beta-1,4... 143 5e-35 >At1g16570.1 unknown protein / contains similarity to beta-1,4 mannosyltransferase GI:6970470 from [Homo sapiens] Length = 465 Score = 143 bits (360), Expect = 5e-35 Identities = 75/124 (60%), Positives = 92/124 (73%), Gaps = 1/124 (0%) Frame = -2 Query: 377 ERRRASVVVLGDIGRSPRMQYHSLSLANQASMEVDIVANGGSDPHLSLRENPSIHIHEMK 198 +R RA VVVLGD+GRSPRMQYH+LSLA QAS +VDIVA GGS PH ++ +PSIHIH M Sbjct: 3 KRGRACVVVLGDLGRSPRMQYHALSLARQASFQVDIVAYGGSIPHEAVLNHPSIHIHTMA 62 Query: 197 TVQ-LTGISKISGALSLLLKAAVQFILLVWFLCFKIPRPDVFFVQNPPSVPTLAAVKLAA 21 + + KI ++LLLKA +QF +L+WFL K+P PD+F VQNPPSVPTL AVK A+ Sbjct: 63 QPRFIQYFPKILYPVTLLLKAFIQFTMLLWFLFVKVPAPDIFLVQNPPSVPTLIAVKWAS 122 Query: 20 G*ER 9 R Sbjct: 123 SWRR 126 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,412,963 Number of Sequences: 27288 Number of extensions: 261963 Number of successful extensions: 1000 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 955 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 994 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 596203608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19351029|gb|BM895561.1|BM895561 952075C03.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (568 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18070.1 N-acetylglucosamine-phosphate mutase / ; support... 156 8e-39 >At5g18070.1 N-acetylglucosamine-phosphate mutase / ; supported by cDNA: gi_166925_gb_L11367.1_ATHUNIDA Length = 277 Score = 156 bits (394), Expect = 8e-39 Identities = 78/117 (66%), Positives = 97/117 (82%) Frame = +2 Query: 218 VRCASLDGDADRLVYFRLSSASDNRVDLVDGDKILSLFALFIREQLDIVNNNGGQANKSL 397 +RCASLDGDADRLVYF + S S +V+L+DGDKILSLFALFI+EQL+ + ++ + Sbjct: 1 MRCASLDGDADRLVYFYIPSDSSEKVELLDGDKILSLFALFIKEQLNALEDD----EERK 56 Query: 398 SARLGIVQTAYANGASTLFLKSLGLEVVFTPTGVKYLHKRALEYDIGIYFEANGHGT 568 +RLG+VQTAYANGAST +LK LGL+VVF TGVK+LH++A E+DIGIYFEANGHGT Sbjct: 57 QSRLGVVQTAYANGASTDYLKHLGLDVVFAKTGVKHLHEKAAEFDIGIYFEANGHGT 113 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,463,886 Number of Sequences: 27288 Number of extensions: 304299 Number of successful extensions: 988 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 960 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 986 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 841443256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19351014|gb|BM895546.1|BM895546 952074H12.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (597 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g64960.1 hypothetical protein / predicted by genscan+ 128 3e-30 >At1g64960.1 hypothetical protein / predicted by genscan+ Length = 1227 Score = 128 bits (321), Expect = 3e-30 Identities = 69/187 (36%), Positives = 112/187 (58%) Frame = +1 Query: 1 KLLIPSYFPSKLSPKEACARCIALIKRSPTAGARFCEFALSEGSSPRSIVELVKYSITLA 180 +LLIPSYFPS+ +EAC RC LI R+P AGARFCEF +S G++ +S++ LV + + Sbjct: 533 RLLIPSYFPSRKRAEEACQRCRTLINRNPKAGARFCEFLVSLGATVKSVLHLVGFFLNSV 592 Query: 181 LSQTGLNSDQIDGLIIASVNLIKSLSNERSSLAALREFLANGKLRLVLQVAVSERARAAL 360 LS L +Q +GL+ A+ L K L + +A+L+E L KL+ +L A + +A++++ Sbjct: 593 LSGDKLLENQTEGLLRAAYYLCKDLVADSGCMASLKELLPGEKLKSLLAFAPTAQAQSSV 652 Query: 361 LGIVPVVLPDELSVLHEECMDIVVNAARISKQEEYQETVLEAHKLIVLGGWSDELFEALT 540 + I+ +V PD +S + E+CM++VVN + Q + HKL++ +L T Sbjct: 653 IDIITMVSPDIVSEVLEDCMNLVVNCGGLPSDAGRQTELRSVHKLLLSSNAFCDLIGTFT 712 Query: 541 NTLQSKA 561 + +Q A Sbjct: 713 SIMQKTA 719 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.317 0.133 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,477,280 Number of Sequences: 27288 Number of extensions: 254214 Number of successful extensions: 676 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 675 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 930958496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19351001|gb|BM895533.1|BM895533 952074H04.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (568 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61150.1 putative protein / Atu, Drosophila melanogaster, ... 146 6e-36 At1g20290.1 hypothetical protein / predicted by genemark.hmm 52 2e-07 At1g03530.1 hypothetical protein / similar to hypothetical pr... 48 3e-06 At2g02200.1 hypothetical protein / predicted by genscan 48 4e-06 At1g20920.1 DEAD/DEAH box RNA helicase, putative / Contains D... 48 4e-06 >At5g61150.1 putative protein / Atu, Drosophila melanogaster, EMBL:DMU75467 Length = 633 Score = 146 bits (369), Expect = 6e-36 Identities = 85/185 (45%), Positives = 121/185 (64%), Gaps = 14/185 (7%) Frame = -1 Query: 517 DQRMESDAKGLDSE--DEGYQQRTVSSRRRGVVASESEGSEDNYYADGAQEDEEPRQTRK 344 D + ES+A+ DS+ +E + R RR+ VV S SE S + +Y EDEE QTR Sbjct: 100 DPQEESEARDSDSDNKEEEHGGRVAKKRRQEVVESGSERSGEKHYES---EDEEVDQTRS 156 Query: 343 QSSPMEEERDHEV------VRDVFGDSDEDEPAPYRSRHEIDEDSHRSPMEDEDQHEKDM 182 SP EE+ + +V +R+VFG SD+++ Y R+++++D HRSP+EDE+ EKD+ Sbjct: 157 PRSPSEEKEEVQVAQSDVNIRNVFGSSDDEDAEEY-VRNDVEQDEHRSPIEDEEGSEKDL 215 Query: 181 QPDDTVAD-----EDMRYESD-ENRELKPKEKPVGPPLDLVVPFKQPPARPDKMNVIKVS 20 +PDD V D ED +YES+ E+ E + +E+PVGPPL++ VPF+ PP P KMN+IKVS Sbjct: 216 RPDDMVLDDIIPEEDPQYESEAEHVEARYRERPVGPPLEVEVPFRPPPGDPVKMNMIKVS 275 Query: 19 NIMGI 5 NIMGI Sbjct: 276 NIMGI 280 >At1g20290.1 hypothetical protein / predicted by genemark.hmm Length = 497 Score = 52.0 bits (123), Expect = 2e-07 Identities = 30/146 (20%), Positives = 67/146 (45%), Gaps = 3/146 (2%) Frame = -1 Query: 532 ERELDDQRMESDAKGLDSEDEGYQQRTVSSRRRG---VVASESEGSEDNYYADGAQEDEE 362 + E + R+ K ++ D + + T S G +V +E E E+ + +E+EE Sbjct: 323 DMEANSWRVLCSTKWVNPSDSDFYKFTPSMVHVGEGTIVQAEEEEEEEEEEEEEEEEEEE 382 Query: 361 PRQTRKQSSPMEEERDHEVVRDVFGDSDEDEPAPYRSRHEIDEDSHRSPMEDEDQHEKDM 182 + ++ EEE + E + + +E+E E +E+ E+E++ E++ Sbjct: 383 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 442 Query: 181 QPDDTVADEDMRYESDENRELKPKEK 104 + ++ +E+ E +E E + +E+ Sbjct: 443 EEEEEEEEEEEEEEEEEEEEEEEEEE 468 Score = 48.1 bits (113), Expect = 3e-06 Identities = 23/105 (21%), Positives = 50/105 (46%) Frame = -1 Query: 418 ESEGSEDNYYADGAQEDEEPRQTRKQSSPMEEERDHEVVRDVFGDSDEDEPAPYRSRHEI 239 E E E+ + +E+EE + ++ EEE + E + + +E+E E Sbjct: 378 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 437 Query: 238 DEDSHRSPMEDEDQHEKDMQPDDTVADEDMRYESDENRELKPKEK 104 +E+ E+E++ E++ + ++ +E+ E +E E + +EK Sbjct: 438 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEK 482 Score = 47.8 bits (112), Expect = 4e-06 Identities = 24/127 (18%), Positives = 56/127 (43%) Frame = -1 Query: 484 DSEDEGYQQRTVSSRRRGVVASESEGSEDNYYADGAQEDEEPRQTRKQSSPMEEERDHEV 305 + E+E ++ E E E+ + +E+EE + ++ EEE + E Sbjct: 364 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 423 Query: 304 VRDVFGDSDEDEPAPYRSRHEIDEDSHRSPMEDEDQHEKDMQPDDTVADEDMRYESDENR 125 + + +E+E E +E+ E+E++ E++ + ++ +E+ E +E + Sbjct: 424 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEKK 483 Query: 124 ELKPKEK 104 + K+K Sbjct: 484 YMIVKKK 490 Score = 47.0 bits (110), Expect = 7e-06 Identities = 25/123 (20%), Positives = 56/123 (45%) Frame = -1 Query: 418 ESEGSEDNYYADGAQEDEEPRQTRKQSSPMEEERDHEVVRDVFGDSDEDEPAPYRSRHEI 239 E E E+ + +E+EE + ++ EEE + E + + +E+E E Sbjct: 373 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 432 Query: 238 DEDSHRSPMEDEDQHEKDMQPDDTVADEDMRYESDENRELKPKEKPVGPPLDLVVPFKQP 59 +E+ E+E++ E++ + ++ +E+ E +E E + +E+ ++V K+ Sbjct: 433 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEKKYMIVKKKKK 492 Query: 58 PAR 50 R Sbjct: 493 KRR 495 >At1g03530.1 hypothetical protein / similar to hypothetical protein GB:O14360 Length = 797 Score = 48.1 bits (113), Expect = 3e-06 Identities = 44/162 (27%), Positives = 75/162 (46%), Gaps = 12/162 (7%) Frame = -1 Query: 523 LDDQRMESDAKGLDSEDEGYQQRTVSSRRRGVVASESEGSEDNYYADGAQEDEEPRQTRK 344 +DD +AKG E + + SS +S+S SE+ + + EDE ++ K Sbjct: 229 VDDDEKSDEAKGEMDSAESESETSSSSAS----SSDSSSSEE----EESDEDESDKEENK 280 Query: 343 QSSPMEEERDHEVVRDVFGDSDEDEPAPYRSRHEIDEDSHRSPMEDEDQHEKDMQPDDTV 164 + EE+ +H VV ED+ A R+ +DE++ +EDED + D DD Sbjct: 281 K----EEKFEHMVV------GKEDDLAGDLKRN-LDEENGDDDIEDEDDDDDDDDDDDDD 329 Query: 163 ADEDMRYESDENREL------------KPKEKPVGPPLDLVV 74 +E + + +DE+ +L + KE P PP+D+ + Sbjct: 330 VNEMVAWSNDEDDDLGLQTKEPIRSKNELKELPPVPPVDVTL 371 >At2g02200.1 hypothetical protein / predicted by genscan Length = 586 Score = 47.8 bits (112), Expect = 4e-06 Identities = 38/166 (22%), Positives = 73/166 (43%), Gaps = 24/166 (14%) Frame = -1 Query: 532 ERELDDQRMESDAKGLDSEDEGYQQRTVSSRRRGVVASES-----------EGSEDNYYA 386 ++E D+++ + + K E+EG +++ RG +E EG E+ Sbjct: 206 QKEEDEKKEQEEEK---QEEEGKEEKLEKIEYRGDEGTEKQEIPKQGDEEMEGEEEKQEE 262 Query: 385 DGAQEDEEPRQ------TRKQSSPM---EEERDHEVVRDVFGDSDEDEPAPYRSRHEI-- 239 +G +E+EE + T KQ P EE E + G +E+E YR H Sbjct: 263 EGKEEEEEKVEYRGDEGTEKQEIPKQGDEEMEGEEEKQKEEGKEEEEEKVEYRDHHSTCN 322 Query: 238 --DEDSHRSPMEDEDQHEKDMQPDDTVADEDMRYESDENRELKPKE 107 + + +P + +++ E++ ++ V E+ E DE+ E + +E Sbjct: 323 VEETEKQENPKQGDEEMEREEGKEEKVLKEENVEEHDEHDETEDQE 368 >At1g20920.1 DEAD/DEAH box RNA helicase, putative / Contains DEAD-box subfamily ATP-dependent helicases protein motif Length = 1166 Score = 47.8 bits (112), Expect = 4e-06 Identities = 42/150 (28%), Positives = 69/150 (46%), Gaps = 7/150 (4%) Frame = -1 Query: 532 ERELDDQRMESDAKGLDSEDEGYQQRTVSSRRRGVVASESEGSEDNYYADGAQEDEEPRQ 353 E +L R + D +D+G ++R RR+ V +S SED+Y D D+E R+ Sbjct: 19 EADLKKSRRDRDRSNERKKDKGSEKRREKDRRKKRV--KSSDSEDDYDRD----DDEERE 72 Query: 352 TRKQSSPMEEERDHEVV-----RDVFGDSDED-EPAPYRSRHEIDEDSHRSPMEDEDQHE 191 RK+ RD + V R DS++D E R + ++E R E E Sbjct: 73 KRKEKERERRRRDKDRVKRRSERRKSSDSEDDVEEEDERDKRRVNE-KERGHREHERDRG 131 Query: 190 KDMQPD-DTVADEDMRYESDENRELKPKEK 104 KD + D + +D E +++RE + +E+ Sbjct: 132 KDRKRDREREERKDKEREREKDRERRERER 161 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,250,198 Number of Sequences: 27288 Number of extensions: 369482 Number of successful extensions: 3744 Number of sequences better than 1.0e-05: 10 Number of HSP's better than 0.0 without gapping: 2255 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2978 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 841443256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19350967|gb|BM895499.1|BM895499 952074F09.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (602 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g29420.1 hypothetical protein / 148 2e-36 >At4g29420.1 hypothetical protein / Length = 446 Score = 148 bits (373), Expect = 2e-36 Identities = 71/117 (60%), Positives = 92/117 (77%) Frame = +2 Query: 113 LVKLCLKNAWLSVDRLKKMPNLTYLTLEFIRLDDEDLNQLNECFPCLHTLNLIGVGGLKD 292 LVKL +KNAWLSV L +MPNL YLTLEFIRLDDE+L ++N+CFP L LNLIGVGGLK+ Sbjct: 153 LVKLEVKNAWLSVVGLTEMPNLRYLTLEFIRLDDENLEKVNDCFPFLQELNLIGVGGLKE 212 Query: 293 PKIHLLQLKACCWEVSNVPRSLVVHAPDLVFLELKCIRPDTLILDTPSLSTLKLTID 463 P+IH L LK+C W VSN P SL + AP+L+ L+LKC +P +L+++TP L L+++ Sbjct: 213 PRIHFLHLKSCHWTVSNAPLSLAIVAPNLLELKLKCNKPKSLLVETPKLVQCHLSVE 269 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,412,614 Number of Sequences: 27288 Number of extensions: 290615 Number of successful extensions: 817 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 791 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 948861544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19350966|gb|BM895498.1|BM895498 952074F08.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (567 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g21150.1 putative XAP-5 protein [Homo sapiens] / 280 3e-76 >At2g21150.1 putative XAP-5 protein [Homo sapiens] / Length = 383 Score = 280 bits (717), Expect = 3e-76 Identities = 150/209 (71%), Positives = 163/209 (77%), Gaps = 22/209 (10%) Frame = +3 Query: 6 LSIRTKIEEEEKEKLQKLQQEEEELQMQKR-KKRRVKSDPRLSFCDDIENGSDEDDFENQ 182 ++IR K EEEEKEKLQKLQQEEEELQ++KR KKR++K RLSF +D ENGSDEDD EN+ Sbjct: 81 VNIRNKFEEEEKEKLQKLQQEEEELQLEKRNKKRKIKGSSRLSFAEDFENGSDEDDGENK 140 Query: 183 ETKKNGP--AKLGKDPTVETSFLPDREREAEEQAERERLKKQWSHEQELIK-----NEPL 341 + KLGKDP+VET+FLPD EREAEEQAERERLKKQW EQE IK NEPL Sbjct: 141 SSGTGNLRCGKLGKDPSVETNFLPDSEREAEEQAERERLKKQWLREQEQIKSCPFSNEPL 200 Query: 342 SITYSYWDGTGHRRAIQ--------------VRKGDTIGEFLRAVQQQLAPEFREVRTTS 479 ITYSYWDGTGHRR IQ VRKGD IG FLRAVQQQLAP+FRE+RT S Sbjct: 201 EITYSYWDGTGHRRVIQASTNYTFVILLEPYVRKGDPIGNFLRAVQQQLAPDFREIRTAS 260 Query: 480 VENLLYVKEDLIIPHQHSFYELIINKARG 566 VENLLYVKEDLIIPHQHSFYELIINKARG Sbjct: 261 VENLLYVKEDLIIPHQHSFYELIINKARG 289 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,816,687 Number of Sequences: 27288 Number of extensions: 292804 Number of successful extensions: 3130 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2550 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 841443256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19350961|gb|BM895493.1|BM895493 952074F06.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (572 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05680.1 unknown protein / 184 2e-47 >At3g05680.1 unknown protein / Length = 2070 Score = 184 bits (468), Expect = 2e-47 Identities = 95/190 (50%), Positives = 128/190 (67%) Frame = +3 Query: 3 GPAAEILMGIASSIESIILSLLFCRSGLSFLLSQPEATELILLSLQDAEKMNKSECITLR 182 G ++ IA I +IILS +F R+GLSFLL PE T I+ SL+ + +NK EC+ L Sbjct: 509 GDIMDVFTDIAMFIGNIILSFMFSRTGLSFLLHHPELTATIIQSLKGSVDLNKEECVPLH 568 Query: 183 QAFVLLSKGFFCRPKEVGLITELHLKVGSAATRILSVPPNSDELLWVLWELCAISRSDSG 362 A +L+SKGF C E+G+ E+HL+V SA R+L ++E LW+LWEL +SRSD G Sbjct: 569 YASILISKGFTCSLLEIGINLEMHLRVVSAVDRLLKSIQQTEEFLWILWELRDVSRSDCG 628 Query: 363 RQALLALGYFPEAISVLLRSLSSYKDLDSVMAENGGSPLGLAIFHSAAEILEALAADSTA 542 R+ALL LG FPEA++VL+ +L S KD++ + +G SPL LAI HSAAEI E + +DSTA Sbjct: 629 REALLTLGVFPEALAVLIEALHSAKDMEPAVENSGISPLNLAICHSAAEIFEVIVSDSTA 688 Query: 543 SSLESWIGFA 572 S L +WI A Sbjct: 689 SCLHAWIEHA 698 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,980,737 Number of Sequences: 27288 Number of extensions: 275394 Number of successful extensions: 813 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 813 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 859346304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19350952|gb|BM895484.1|BM895484 952074E10.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (591 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g64790.1 hypothetical protein / predicted by genemark.hmm 318 1e-87 >At1g64790.1 hypothetical protein / predicted by genemark.hmm Length = 2428 Score = 318 bits (815), Expect = 1e-87 Identities = 159/193 (82%), Positives = 177/193 (91%) Frame = -3 Query: 589 QCLPKIVPKLAELLTDTHPKVQASGQTALQEVGSVIKNPEISALVPILLSALMDPNAHTK 410 QCLP++VPKL E+LTDTHPKVQ++GQ ALQ+VGSVIKNPEIS+LVP LL AL DPN +T+ Sbjct: 1295 QCLPRVVPKLTEVLTDTHPKVQSAGQLALQQVGSVIKNPEISSLVPTLLLALTDPNEYTR 1354 Query: 409 HSLDILLQTTFINSIDAPSLALLVPIVHRGLRERGVETKKKAAQIVGNMSSLVTEPKDMI 230 H+LD LLQTTF+NS+DAPSLALLVPIVHRGLRER ETKKKA+QIVGNM SLVTEPKDMI Sbjct: 1355 HALDTLLQTTFVNSVDAPSLALLVPIVHRGLRERSSETKKKASQIVGNMCSLVTEPKDMI 1414 Query: 229 PYISLLLPEVKKVLVDPIPEVRAVAARALGSLISGMGEEIFPDLVPWLLDTLKSDNSNVE 50 PYI LLLPEVKKVLVDPIPEVR+VAARA+GSLI GMGE+ FPDLVPWL +TLKSD SNVE Sbjct: 1415 PYIGLLLPEVKKVLVDPIPEVRSVAARAVGSLIRGMGEDNFPDLVPWLFETLKSDTSNVE 1474 Query: 49 RSGAAQGLSEVLA 11 R GAAQGLSEV+A Sbjct: 1475 RYGAAQGLSEVIA 1487 Score = 50.8 bits (120), Expect = 5e-07 Identities = 40/174 (22%), Positives = 82/174 (46%), Gaps = 6/174 (3%) Frame = -3 Query: 514 QTALQEVGSVIKNPE--ISALVPILLSALMD----PNAHTKHSLDILLQTTFINSIDAPS 353 Q AL +++ N + ++PIL+S L+ P++ + L + + Sbjct: 1662 QAALHVWKTIVANTPKTLKEIMPILMSTLISSLASPSSERRQVAGRSLGE-LVRKLGERV 1720 Query: 352 LALLVPIVHRGLRERGVETKKKAAQIVGNMSSLVTEPKDMIPYISLLLPEVKKVLVDPIP 173 L L++PI+ +GL++ V+ K++ I N ++ ++ L+P ++ L D Sbjct: 1721 LPLIIPILSKGLKDPDVD-KRQGVCIGLNEVMASAGRSQLLSFMDQLIPTIRTALCDSAL 1779 Query: 172 EVRAVAARALGSLISGMGEEIFPDLVPWLLDTLKSDNSNVERSGAAQGLSEVLA 11 EVR A A +L G + +++P LL+ L+ D + + A GL ++++ Sbjct: 1780 EVRESAGLAFSTLYKSAGLQAMDEIIPTLLEALEDDEMS---TTALDGLKQIIS 1830 Score = 49.3 bits (116), Expect = 1e-06 Identities = 38/176 (21%), Positives = 85/176 (47%), Gaps = 5/176 (2%) Frame = -3 Query: 574 IVPKLAELLTDTHPKVQASG-----QTALQEVGSVIKNPEISALVPILLSALMDPNAHTK 410 ++ L E L D + + G + +++G + + P + ++P+LL + D + Sbjct: 1179 LIVTLQEALIDRNSAKRREGALLAFECLCEKLGKLFE-PYVIKMLPLLLVSFSDQVGAVR 1237 Query: 409 HSLDILLQTTFINSIDAPSLALLVPIVHRGLRERGVETKKKAAQIVGNMSSLVTEPKDMI 230 + + + ++ + A + L++P + +GL ++ TK+ + Q++G M+ P+ + Sbjct: 1238 EAAECAARA-MMSQLSAYGVKLVLPSLLKGLEDKAWRTKQSSVQLLGAMAFCA--PQQLS 1294 Query: 229 PYISLLLPEVKKVLVDPIPEVRAVAARALGSLISGMGEEIFPDLVPWLLDTLKSDN 62 + ++P++ +VL D P+V++ AL + S + LVP LL L N Sbjct: 1295 QCLPRVVPKLTEVLTDTHPKVQSAGQLALQQVGSVIKNPEISSLVPTLLLALTDPN 1350 Score = 47.4 bits (111), Expect = 6e-06 Identities = 27/80 (33%), Positives = 44/80 (54%) Frame = -3 Query: 244 PKDMIPYISLLLPEVKKVLVDPIPEVRAVAARALGSLISGMGEEIFPDLVPWLLDTLKSD 65 PK + + +L+ + L P E R VA R+LG L+ +GE + P ++P L LK Sbjct: 1676 PKTLKEIMPILMSTLISSLASPSSERRQVAGRSLGELVRKLGERVLPLIIPILSKGLKDP 1735 Query: 64 NSNVERSGAAQGLSEVLADS 5 + + +R G GL+EV+A + Sbjct: 1736 DVD-KRQGVCIGLNEVMASA 1754 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,255,330 Number of Sequences: 27288 Number of extensions: 289440 Number of successful extensions: 895 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 890 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 913055448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19350941|gb|BM895473.1|BM895473 952074E05.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (601 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24350.1 putative protein / similar to unknown protein (re... 176 6e-45 >At5g24350.1 putative protein / similar to unknown protein (ref|NP_056993.1) Length = 2376 Score = 176 bits (447), Expect = 6e-45 Identities = 97/201 (48%), Positives = 132/201 (65%), Gaps = 1/201 (0%) Frame = +2 Query: 2 RMVITCQAGAYLHFEEIIDVAKLLGLRSEEEVADVEEAIAREAVVNGDLQLALDICLNLT 181 +M IT AYLH EE+I+VAKLLGL S E+++ V+EAIAREA + GD+QLA D+CL LT Sbjct: 1076 KMAITGDPEAYLHGEELIEVAKLLGLNSSEDISSVKEAIAREAAIAGDMQLAFDLCLVLT 1135 Query: 182 KKSHGAVWDLCAAIARGPPLDNLDTGTREKLLGFALSHCDDDSVGELLNAWKELHAQGTF 361 K+ HG +WDL AAIAR P L+++D +R++LLGFAL HCDD+S+ ELL+AWK+ QG Sbjct: 1136 KEGHGPIWDLGAAIARSPALEHMDISSRKQLLGFALGHCDDESISELLHAWKDFDLQGQC 1195 Query: 362 EKLMITTATNPPNF-LIDGSSITPLPVQSVQDILDLRDDNGHDRRSDLVGIVKDMLSKVC 538 E L + + +N P F +DG V + D + D D++ DL KD +S V Sbjct: 1196 ETLGMLSESNSPEFQKMDG-------VSCLTDFPQMLDGLSSDQQLDL-DRAKDSISCVA 1247 Query: 539 LDFSNGDTHNWESMLEENRKL 601 D D+ + ES+L+EN KL Sbjct: 1248 KDMPVDDSVDLESLLKENGKL 1268 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,375,008 Number of Sequences: 27288 Number of extensions: 329752 Number of successful extensions: 1044 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1010 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1044 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 939910020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19350746|gb|BM895278.1|BM895278 952073B09.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (504 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g11560.1 putative protein / predicted proteins, Homo sapie... 270 4e-73 >At5g11560.1 putative protein / predicted proteins, Homo sapiens, Drosophila melanogaster, Caenorhabditis elegans Length = 955 Score = 270 bits (689), Expect = 4e-73 Identities = 132/164 (80%), Positives = 152/164 (92%) Frame = +1 Query: 13 DNKDVMKLILGKHNLSAPITSYARPEVAVKSQSYFFTHSVKAMAVTQTAKGITSKQLLIG 192 +NK+V KLILGKHNL+APITSY+RPEV KSQSYFF SVK +AVT TAKGITSKQLLIG Sbjct: 767 ENKNVWKLILGKHNLTAPITSYSRPEVFTKSQSYFFAQSVKTIAVTSTAKGITSKQLLIG 826 Query: 193 TIGDQVLALDKRYLDPRRSVNPTQQEKEEGIIPLTDSLPIIPQSFVTHSHQVEALRGIVS 372 TIGDQ+LALDKR++DPRR++NP+Q EKEEGIIPLTD+LPIIPQ++VTHSH+VE LRGIV+ Sbjct: 827 TIGDQILALDKRFVDPRRTLNPSQAEKEEGIIPLTDTLPIIPQAYVTHSHKVEGLRGIVT 886 Query: 373 IPAKLESTTLVFTYGVDLFYTQLAPSRTYDSLTDEFSYALLLIT 504 P+KLESTT VF YGVDLFYT+LAPS+TYDSLTD+FSYALLLIT Sbjct: 887 APSKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLLIT 930 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,504,883 Number of Sequences: 27288 Number of extensions: 255483 Number of successful extensions: 705 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 705 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 675457500 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19350666|gb|BM895198.1|BM895198 952070A07.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (529 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15566.1 hypothetical protein / 99 1e-21 >At4g15566.1 hypothetical protein / Length = 249 Score = 99.4 bits (246), Expect = 1e-21 Identities = 61/138 (44%), Positives = 82/138 (59%), Gaps = 3/138 (2%) Frame = +2 Query: 122 SGTSTPSTTSTMDRFQKIVLSWDYLCLVAES--KGGKQAKV-LQHVKNTYVSVAEYLGVF 292 +G S++ RF I+L WDY L E+ K K +K L VKNTY V +Y F Sbjct: 5 NGKLQEEEASSVTRFYNIILGWDYKQLTKENERKNRKDSKEKLNVVKNTYKDVDDYFETF 64 Query: 293 EPLLFEEVKAQIIQGRSNDEEESGMDWRRGAVGSCTESEGFHKLSVAVEDNFQDNVSEND 472 EPLLFEEVKAQI+Q + D EE+ + R V C E EGFH L V E + +++ND Sbjct: 65 EPLLFEEVKAQILQNK--DGEEASVCKMR-LVMECNEGEGFHFLLVTYEHEEDEYLAQND 121 Query: 473 LLLISKEKIEEGSTPNAY 526 LLL+SKE+++ S P++Y Sbjct: 122 LLLLSKEEVKGNSFPSSY 139 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,360,617 Number of Sequences: 27288 Number of extensions: 441636 Number of successful extensions: 4202 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3516 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 736262584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19350653|gb|BM895185.1|BM895185 952066H04.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (560 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g17560.1 putative protein / ;supported by full-length cDN... 138 2e-33 At1g55805.1 Expressed protein / ; supported by cDNA: gi_14488... 47 5e-06 >At5g17560.1 putative protein / ;supported by full-length cDNA: Ceres:9667. Length = 177 Score = 138 bits (348), Expect = 2e-33 Identities = 75/144 (52%), Positives = 96/144 (66%), Gaps = 6/144 (4%) Frame = +3 Query: 90 FSSYSSSSVYSVRHHASSALSSQPSTRPTTTWSSSPNSSSR------RIRGFAAWASAPG 251 F+S+S+ V SA+ S+ T P++ + + + S R F+ +S Sbjct: 33 FASFSAPLVRFTNSRCVSAVLSRKETAPSSIYGNRVSRVSGFGALDIRSLNFSTKSSQIN 92 Query: 252 PAGSADSLATKALEAKIKEQLEADTVTVVDTSGDGRHVCIDVISKAFEGKSAVNRQRMVY 431 AGS D +++E KIKEQL A++VTV D SGDGRHVCI+V+S AFEG+SAVNRQRMVY Sbjct: 93 DAGSIDQTLMQSMELKIKEQLNAESVTVTDMSGDGRHVCINVVSSAFEGQSAVNRQRMVY 152 Query: 432 KAIWEELQSTVHAVDQMTTKTPDE 503 KAIWEELQ+ VHAVDQMTTKTP E Sbjct: 153 KAIWEELQNVVHAVDQMTTKTPSE 176 >At1g55805.1 Expressed protein / ; supported by cDNA: gi_14488091_gb_AF389294.1_AF389294 Length = 109 Score = 47.4 bits (111), Expect = 5e-06 Identities = 29/97 (29%), Positives = 53/97 (53%), Gaps = 13/97 (13%) Frame = +3 Query: 255 AGSADSLATKALEAKIKEQLEADTVTVVDTS-------------GDGRHVCIDVISKAFE 395 +G+ ++ A++ E K++++LE + + D S D H + ++SK FE Sbjct: 11 SGAIENRASRMRE-KLQKELEPVELVIEDVSYQHAGHAGMKGRTDDETHFNVKIVSKGFE 69 Query: 396 GKSAVNRQRMVYKAIWEELQSTVHAVDQMTTKTPDEA 506 G + V R R+VY + EEL + +HA+ + +KTP E+ Sbjct: 70 GMNLVKRHRLVYHLLREELDTGLHAL-SIVSKTPSES 105 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,679,377 Number of Sequences: 27288 Number of extensions: 492881 Number of successful extensions: 14558 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 2998 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8550 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 835029516 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19272538|gb|BM888794.1|BM888794 952069E07.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (499 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g40480.1 nuclear pore protein -like / nuclear pore protein... 121 2e-28 >At5g40480.1 nuclear pore protein -like / nuclear pore protein gp210 precursor, rat, PIR:S04921 Length = 1919 Score = 121 bits (303), Expect = 2e-28 Identities = 61/151 (40%), Positives = 90/151 (59%) Frame = +3 Query: 27 GVLSRVVYRVEALKRLSFSDKVTIVLPATGQTEEVEVSYDTGEEAESPSSWGLTTTAVML 206 G+ Y+V L+ F+D++ I LPATGQ E++V YDTGE + S G + +L Sbjct: 1772 GIAGHAQYKVNVLRSEQFTDRIIITLPATGQIVEIDVCYDTGESLVASSKDGYSVLLKIL 1831 Query: 207 TCIIVTIVTVALFIKLLQRPIRQAPSGSMTASTPARAPAADPAAMADPASPANGQFSPRT 386 ++V +V+V + +K++ R + +G+ T S AA + + SPRT Sbjct: 1832 WGVLVLVVSVIILMKVIDRQVPTGATGTATYS----GNAAQGTPERRSGTVIYHEESPRT 1887 Query: 387 PQPFMEYVRRTIDDTPYYKRDARRRFNPQNT 479 P PFMEYV+RT+D+TPYY+R+ RRRFNPQNT Sbjct: 1888 PSPFMEYVKRTVDETPYYRREGRRRFNPQNT 1918 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,301,790 Number of Sequences: 27288 Number of extensions: 249129 Number of successful extensions: 1093 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 965 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1069 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 657445300 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19272453|gb|BM888709.1|BM888709 952068B02.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (493 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g10370.1 putative glycerol-3-phosphate dehydrogenase / sim... 180 9e-70 >At3g10370.1 putative glycerol-3-phosphate dehydrogenase / similar to glycerol-3-phosphate dehydrogenase GB:BAA08926 [Mus musculus]; supported by cDNA: gi_17380777 Length = 629 Score = 180 bits (457), Expect(2) = 9e-70 Identities = 84/96 (87%), Positives = 89/96 (92%) Frame = +2 Query: 206 KEFETFAKVVVNAAGPFCDSVRKMADSTVAPMICPSSGVHIVLPDYYSPEGMGLIVPKTK 385 +EF ++AKVVVNAAGPFCDS+RKM D PMICPSSGVHIVLPDYYSPEGMGLIVPKTK Sbjct: 281 QEFNSYAKVVVNAAGPFCDSIRKMIDEDTKPMICPSSGVHIVLPDYYSPEGMGLIVPKTK 340 Query: 386 DGRVVFMLPWLGRTVAGTTDSNTAITMLPEPHEDEI 493 DGRVVFMLPWLGRTVAGTTDSNT+IT LPEPHEDEI Sbjct: 341 DGRVVFMLPWLGRTVAGTTDSNTSITSLPEPHEDEI 376 Score = 100 bits (248), Expect(2) = 9e-70 Identities = 48/62 (77%), Positives = 58/62 (93%) Frame = +1 Query: 13 LKGTVVYYDGQMNDSRLNVGLACTAAVVGAAVLNYAEVVSLIKDESGERIIGARVRDTLS 192 L+GTVVYYDGQMNDSRLNVGLACTAA+ GAAVLN+AEVVSLI D++ +RIIGAR+R+ L+ Sbjct: 220 LRGTVVYYDGQMNDSRLNVGLACTAALAGAAVLNHAEVVSLITDDATKRIIGARIRNNLT 279 Query: 193 GR 198 G+ Sbjct: 280 GQ 281 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,063,357 Number of Sequences: 27288 Number of extensions: 237409 Number of successful extensions: 583 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 583 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 639433100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19058676|gb|BM737343.1|BM737343 952055C09.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (602 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g12050.1 fumarylacetoacetate hydrolase-like protein / simi... 341 1e-94 >At1g12050.1 fumarylacetoacetate hydrolase-like protein / similar to fumarylacetoacetate hydrolase, gb|L41670 from Emericella nidulans; supported by cDNA: gi_20334819 Length = 421 Score = 341 bits (875), Expect = 1e-94 Identities = 152/200 (76%), Positives = 177/200 (88%) Frame = +1 Query: 1 RGPQTPVNPNWFYLPIGYNGRASSIVVSGTDVIRPRGQGHPTGNSAPYFGPSQKLDFELE 180 RGP+ +NPNWF LPI Y+GRASSIV+SGTD+IRPRGQGHP GNS PYFGPS+KLDFELE Sbjct: 147 RGPENAINPNWFRLPIAYHGRASSIVISGTDIIRPRGQGHPQGNSEPYFGPSKKLDFELE 206 Query: 181 MAAIVGPGNELGKPIDINDAEEHIFGLTLMNDWSARDIQAWETIPLGPFLGKSFSTTISP 360 MAA+VGPGNELGKPID+N+A +HIFGL LMNDWSARDIQAWE +PLGPFLGKSF TTISP Sbjct: 207 MAAVVGPGNELGKPIDVNNAADHIFGLLLMNDWSARDIQAWEYVPLGPFLGKSFGTTISP 266 Query: 361 WIVTLDALKPFMCEAPKQEPEPLPYLAEKNHINYDIPLEVLIKPKDQNVALIXTKTNFKH 540 WIVTLDAL+PF C+APKQ+P PLPYLAEK +NYDI LEV +KP ++ + + TK+NF++ Sbjct: 267 WIVTLDALEPFGCQAPKQDPPPLPYLAEKESVNYDISLEVQLKPSGRDDSCVITKSNFQN 326 Query: 541 LYWTATQQLTHHTINGCNMR 600 LYWT TQQL HHT+NGCN+R Sbjct: 327 LYWTITQQLAHHTVNGCNLR 346 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,422,223 Number of Sequences: 27288 Number of extensions: 291968 Number of successful extensions: 812 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 812 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 948861544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19058554|gb|BM737221.1|BM737221 952053F12.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (589 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49930.1 putative protein / strong similarity to unknown p... 167 2e-43 >At5g49930.1 putative protein / strong similarity to unknown protein (gb|AAF56406.1) Length = 1080 Score = 167 bits (424), Expect(2) = 2e-43 Identities = 83/138 (60%), Positives = 110/138 (79%) Frame = +1 Query: 175 LAYGPALAEHIILDAGLVPSTKVGKDPESTINDSTVQSLMESITRFEDWLVDIISGQRIP 354 L YGP L+EHIILDAGLVP+TK+ +D + ++D+ +Q L++++ FEDWL DII+GQ++P Sbjct: 227 LGYGPQLSEHIILDAGLVPTTKLSEDKK--LDDNEIQLLVQAVIVFEDWLEDIINGQKVP 284 Query: 355 EGYILMQNKMTAKNITPLEEASINHKIYDEYCPVLLNQFKSREYNEFATFDAALDEFYSK 534 EGYILMQ ++ A + T E+ K+YDE+C +LLNQFKSR Y +F TFDAALDEFYSK Sbjct: 285 EGYILMQKQILANDTT--SESGGVKKMYDEFCSILLNQFKSRVYEKFETFDAALDEFYSK 342 Query: 535 IESQKVNQQQKAKEESAA 588 IESQ+ QQQKAKE+SA+ Sbjct: 343 IESQRSEQQQKAKEDSAS 360 Score = 25.0 bits (53), Expect(2) = 2e-43 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +3 Query: 51 KSLSKKEKKAAAKAKQFGSNAKVNNGAQSNKATLKTILGEAPGLWP 188 K + KE+ K K N+ + + TLK ILG+A G P Sbjct: 192 KQIEPKEQNGGKKG------GKSNDSTGAKQYTLKNILGDALGYGP 231 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,323,908 Number of Sequences: 27288 Number of extensions: 258037 Number of successful extensions: 767 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 765 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 904103924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19058552|gb|BM737219.1|BM737219 952053F10.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (543 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02220.1 unknown protein / 159 9e-57 >At3g02220.1 unknown protein / Length = 227 Score = 159 bits (402), Expect(2) = 9e-57 Identities = 70/131 (53%), Positives = 94/131 (71%) Frame = +1 Query: 127 RCRDQIDWKRRYGKYKPIVEPAKCQKCNKRNVRQAYHNVCRDCSKDLGICAKCCTCVNEL 306 RCR+QI WKR+YGKYK + E KCQKC KRNVRQAYH +C C+K+ +CAKCC V+++ Sbjct: 45 RCREQIAWKRKYGKYKTLTEATKCQKCTKRNVRQAYHKLCPGCAKEQKVCAKCCQSVDQI 104 Query: 307 VGRDANEEESERKSLEEAVRGARERERRTLLRIMNKGKGGESGPSVPKIADRSREGDIFP 486 +GRD E E+E+K L+E ++ ARER+RRTLLR MNK +D S+ GD+FP Sbjct: 105 LGRDIYEVEAEQKLLDETIKNARERDRRTLLRAMNKDNKPNKSDEEASRSDSSKVGDVFP 164 Query: 487 AASLDEYAEQT 519 + SL+EYA ++ Sbjct: 165 STSLEEYANKS 175 Score = 78.2 bits (191), Expect(2) = 9e-57 Identities = 33/41 (80%), Positives = 37/41 (89%) Frame = +3 Query: 3 RQGPPKHQNRYAWKPNLGLKINETEPGGRFRPLSEITGVCH 125 RQGPPKHQN++AW P G+KINETE GGRFRPLSEITGVC+ Sbjct: 4 RQGPPKHQNKFAWVPKAGVKINETEVGGRFRPLSEITGVCY 44 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,665,259 Number of Sequences: 27288 Number of extensions: 294413 Number of successful extensions: 1347 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1342 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 781156644 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19058488|gb|BM737155.1|BM737155 952053B02.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (534 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g04950.1 unknown protein / 108 2e-24 At3g24400.1 protein kinase, putative / similar to protein kin... 52 2e-07 At1g62763.1 hypothetical protein / 50 7e-07 >At3g04950.1 unknown protein / Length = 152 Score = 108 bits (269), Expect = 2e-24 Identities = 53/109 (48%), Positives = 73/109 (66%), Gaps = 7/109 (6%) Frame = +2 Query: 227 DKIKSTITGKKPEEASEAS----SFTLIH---TMEKARKLGTFKNFVAGRASEATVVNVF 385 D IK TG K E++ +FTL+ ++ AR+LG FK ++ GR+SEAT + F Sbjct: 2 DSIKGVFTGNKDTPLEESNLPVEAFTLLRFADELKNARRLGKFKQYIVGRSSEATFADAF 61 Query: 386 EKHSAVLRYLGAIDPTGENLRNTDKINATKHCNCTMADVEHILAKYTWA 532 EK AV+RYLGA+D TGENL+ + K +A KHC CT+ DVE+ L+K+TWA Sbjct: 62 EKQEAVIRYLGALDATGENLQASQKQDAAKHCKCTITDVENTLSKFTWA 110 >At3g24400.1 protein kinase, putative / similar to protein kinase GB:BAA24694 from [Arabidopsis thaliana] Length = 694 Score = 52.0 bits (123), Expect = 2e-07 Identities = 51/152 (33%), Positives = 64/152 (41%), Gaps = 1/152 (0%) Frame = +3 Query: 9 PLLSLTLLPVAAVNP*XETPPLLAAAGSPVTASKSMASRRRSTSSRPPGGRCTSSRRPAA 188 P LT P P +PP P+T S S +T S PP S Sbjct: 90 PSPPLTPSPTTPSPPLTPSPPPAITPSPPLTPSPLPPSP--TTPSPPPPSPSIPSPPLTP 147 Query: 189 SPRPRTS-RPSAGLIRSSPPSLARSPRRPPRHPPSPSSTRWRKRGSWGRSRTSLPGGPAR 365 SP P + RPS S PP +P PPR PP PS+ R SL P Sbjct: 148 SPPPSSPLRPS-----SPPPPSPATPSTPPRSPPPPSTPTPPPRVG------SLSPPPPA 196 Query: 366 PPS*TSSRSTPLCCATSVPSTPPARTSETLTK 461 PS S STP +T+ S+PPA++S+ L+K Sbjct: 197 SPSGGRSPSTP---STTPGSSPPAQSSKELSK 225 >At1g62763.1 hypothetical protein / Length = 312 Score = 50.1 bits (118), Expect = 7e-07 Identities = 45/122 (36%), Positives = 58/122 (46%), Gaps = 4/122 (3%) Frame = +3 Query: 132 STSSRPPGGRCTSSRRPAASPRPRTSRPSAG----LIRSSPPSLARSPRRPPRHPPSPSS 299 S+SS P SS P+ SP P +S PS+ L SSPP L+ SP PP PPS SS Sbjct: 23 SSSSLSP-----SSSSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPS-SS 76 Query: 300 TRWRKRGSWGRSRTSLPGGPARPPS*TSSRSTPLCCATSVPSTPPARTSETLTKLTRPST 479 S S S A P S + S PL + S P PP +S L+ L+ S+ Sbjct: 77 PLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPP-SSSPLSSLSPSSS 135 Query: 480 AT 485 ++ Sbjct: 136 SS 137 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,284,865 Number of Sequences: 27288 Number of extensions: 403698 Number of successful extensions: 3372 Number of sequences better than 1.0e-05: 6 Number of HSP's better than 0.0 without gapping: 1863 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2736 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 754220208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19058409|gb|BM737076.1|BM737076 952049B01.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (614 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g03250.1 expressed protein / EST gb|N96383 comes from this... 188 2e-48 >At1g03250.1 expressed protein / EST gb|N96383 comes from this gene;supported by full-length cDNA: Ceres:40461. Length = 245 Score = 188 bits (477), Expect = 2e-48 Identities = 92/176 (52%), Positives = 126/176 (71%) Frame = +3 Query: 69 MASADLLRREEFYSSLFDSAKGDGARSRSQLIERKIEALEDMATRVSNRRSRKWFNDRLL 248 MA+ +++RR+E S L D +GD + SR +E+KIEALE +A +VSNRRSR+W NDR+L Sbjct: 1 MAATNVMRRDE--SLLIDPQRGDTSVSRGLSLEKKIEALESLAGQVSNRRSRRWLNDRIL 58 Query: 249 IELVPRLYVEEIKGLFAPPPWGEQVPLSSFYRANVGEWDAFRSIDMDAEARLMQHMKKSL 428 +ELVPRL +EI+GLFAPPPWG+ VP S+F NVGEWD FR+IDMD EA +M + +S Sbjct: 59 MELVPRLDAQEIRGLFAPPPWGDDVPPSAFSLTNVGEWDKFRNIDMDKEANIMDSLNRSS 118 Query: 429 EKPRNHVDEGESIALNAWHRIDRHTREAIKRNFLPDLLGIYEERVRAFIEDASDKD 596 + + VD + LNAW RID TR+A++R+FLP+L+ YE + FIE+ + D Sbjct: 119 VRQKGSVDGDKIAVLNAWRRIDCRTRDALRRSFLPELIEGYESCISHFIEEGGEGD 174 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,343,947 Number of Sequences: 27288 Number of extensions: 331265 Number of successful extensions: 1063 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1007 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1063 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 972741724 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19058377|gb|BM737044.1|BM737044 952052F11.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (603 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g37460.1 putative protein / SPINDLY protein, Petunia x hyb... 277 3e-75 At4g12400.1 stress-induced protein sti1 -like protein / stres... 56 2e-08 At3g04240.1 putative O-linked GlcNAc transferase / similar to... 54 8e-08 At1g12270.1 hypothetical protein / ; supported by cDNA: gi_17... 53 1e-07 At1g62740.1 TPR-repeat protein / contains multiple TPR domain... 52 2e-07 At2g42810.1 putative phosphoprotein phosphatase / ; supporte... 51 5e-07 At4g22670.1 HSP associated protein like / p48, Homo sapiens, ... 50 9e-07 At3g17870.1 HSC70-interacting protein, putative / similar to ... 49 2e-06 >At4g37460.1 putative protein / SPINDLY protein, Petunia x hybrida, Y17720 Length = 1013 Score = 277 bits (708), Expect = 3e-75 Identities = 128/199 (64%), Positives = 167/199 (83%) Frame = -3 Query: 601 IGRGTAYAFQRELDSAISDFTKAIQSSPSAGEAWKRRGQARAALGEFKEAIEDLTKALEF 422 IGRGTAYAFQREL+SAI+DFTKAIQS+P+A EAWKRRGQARAALGE+ EA+EDLTKAL F Sbjct: 335 IGRGTAYAFQRELESAIADFTKAIQSNPAASEAWKRRGQARAALGEYVEAVEDLTKALVF 394 Query: 421 EPNSPDILHERGIVNFKFKDYNSALEDLSTCVKHDKKNSSAHTYLGLTLSALGEYKRAED 242 EPNSPD+LHERGIVNFK KD+ +A++DLS C+K +K N SA+TYLGL ++LGEYK+AE+ Sbjct: 395 EPNSPDVLHERGIVNFKSKDFTAAVKDLSICLKQEKDNKSAYTYLGLAFASLGEYKKAEE 454 Query: 241 EHVIGLKYDESFLDCWAHLAQLYLDLAYPEKLLNCLEKAIQIDSRFAKAYHLRGILYHGM 62 H+ ++ D ++L+ W HLAQ Y +LA K L C+E+ +Q+D+R KAYHLRG+++HG+ Sbjct: 455 AHLKSIQLDSNYLEAWLHLAQFYQELADHCKALECIEQVLQVDNRVWKAYHLRGLVFHGL 514 Query: 61 GRHRSAIKELSVALTYESS 5 G HR AI+ELS+ L+ E++ Sbjct: 515 GEHRKAIQELSIGLSIENT 533 >At4g12400.1 stress-induced protein sti1 -like protein / stress-induced protein sti1 -Glycine max,PID:g872116 Length = 558 Score = 55.8 bits (133), Expect = 2e-08 Identities = 25/96 (26%), Positives = 49/96 (51%) Frame = -3 Query: 595 RGTAYAFQRELDSAISDFTKAIQSSPSAGEAWKRRGQARAALGEFKEAIEDLTKALEFEP 416 +G + +++ A+ +++AI+ +P+ A+ R LG E ++D K +E +P Sbjct: 375 KGNGFFKEQKYPEAVKHYSEAIKRNPNDVRAYSNRAACYTKLGALPEGLKDAEKCIELDP 434 Query: 415 NSPDILHERGIVNFKFKDYNSALEDLSTCVKHDKKN 308 + +G + F K+Y+ A+E +KHD KN Sbjct: 435 SFTKGYSRKGAIQFFMKEYDKAMETYQEGLKHDPKN 470 >At3g04240.1 putative O-linked GlcNAc transferase / similar to O-linked GlcNAc transferase GB:AAB63465 [Caenorhabditis elegans]; supported by cDNA: gi_18139886 Length = 977 Score = 53.5 bits (127), Expect = 8e-08 Identities = 44/197 (22%), Positives = 78/197 (39%) Frame = -3 Query: 592 GTAYAFQRELDSAISDFTKAIQSSPSAGEAWKRRGQARAALGEFKEAIEDLTKALEFEPN 413 G Y +E D I+ +A++ P E + A G+ AI A+E PN Sbjct: 94 GAIYYQLQEYDMCIARNEEALRIQPQFAECYGNMANAWKEKGDTDRAIRYYLIAIELRPN 153 Query: 412 SPDILHERGIVNFKFKDYNSALEDLSTCVKHDKKNSSAHTYLGLTLSALGEYKRAEDEHV 233 D + + A + + + AH+ LG + A G A ++ Sbjct: 154 FADAWSNLASAYMRKGRLSEATQCCQQALSLNPLLVDAHSNLGNLMKAQGLIHEAYSCYL 213 Query: 232 IGLKYDESFLDCWAHLAQLYLDLAYPEKLLNCLEKAIQIDSRFAKAYHLRGILYHGMGRH 53 ++ +F W++LA L+++ + L ++A+++ F AY G +Y +GR Sbjct: 214 EAVRIQPTFAIAWSNLAGLFMESGDLNRALQYYKEAVKLKPAFPDAYLNLGNVYKALGRP 273 Query: 52 RSAIKELSVALTYESSS 2 AI AL +S Sbjct: 274 TEAIMCYQHALQMRPNS 290 >At1g12270.1 hypothetical protein / ; supported by cDNA: gi_17473521 Length = 572 Score = 53.1 bits (126), Expect = 1e-07 Identities = 25/96 (26%), Positives = 49/96 (51%) Frame = -3 Query: 595 RGTAYAFQRELDSAISDFTKAIQSSPSAGEAWKRRGQARAALGEFKEAIEDLTKALEFEP 416 +G + +++ AI +T+AI+ +P+ +A+ R + LG E ++D K +E +P Sbjct: 389 KGNDFFKEQKYPEAIKHYTEAIKRNPNDHKAYSNRAASYTKLGAMPEGLKDAEKCIELDP 448 Query: 415 NSPDILHERGIVNFKFKDYNSALEDLSTCVKHDKKN 308 + V F K+Y++A+E ++HD N Sbjct: 449 TFSKGYSRKAAVQFFLKEYDNAMETYQAGLEHDPSN 484 >At1g62740.1 TPR-repeat protein / contains multiple TPR domains: Pfam profile: PF00515 Length = 571 Score = 52.4 bits (124), Expect = 2e-07 Identities = 25/96 (26%), Positives = 47/96 (48%) Frame = -3 Query: 595 RGTAYAFQRELDSAISDFTKAIQSSPSAGEAWKRRGQARAALGEFKEAIEDLTKALEFEP 416 +G + +++ A+ +T+AI+ +P A+ R LG E ++D K +E +P Sbjct: 388 KGNDFFKEQKYPDAVRHYTEAIKRNPKDPRAYSNRAACYTKLGAMPEGLKDAEKCIELDP 447 Query: 415 NSPDILHERGIVNFKFKDYNSALEDLSTCVKHDKKN 308 +G V F K+Y++A+E ++HD N Sbjct: 448 TFLKGYSRKGAVQFFMKEYDNAMETYQKGLEHDPNN 483 Score = 47.8 bits (112), Expect = 4e-06 Identities = 22/62 (35%), Positives = 34/62 (54%) Frame = -3 Query: 595 RGTAYAFQRELDSAISDFTKAIQSSPSAGEAWKRRGQARAALGEFKEAIEDLTKALEFEP 416 R A+A D A+SD K ++ P G+ + R G A L +F EA+E +K LE +P Sbjct: 42 RSAAHASLNHYDEALSDAKKTVELKPDWGKGYSRLGAAHLGLNQFDEAVEAYSKGLEIDP 101 Query: 415 NS 410 ++ Sbjct: 102 SN 103 >At2g42810.1 putative phosphoprotein phosphatase / ; supported by cDNA: gi_16930440_gb_AF419574.1_AF419574 Length = 484 Score = 50.8 bits (120), Expect = 5e-07 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 5/83 (6%) Frame = -3 Query: 595 RGTAYAFQRELDSAISDFTKAIQSSPSAGEAWKRRGQARAALGEFKEAIEDLTKALEFEP 416 R A+ E SAI D +KAI+ + + RRG A A+G+FK+A++D + P Sbjct: 53 RAFAHTKLEEYGSAIQDASKAIEVDSRYSKGYYRRGAAYLAMGKFKDALKDFQQVKRLSP 112 Query: 415 NSPDILH-----ERGIVNFKFKD 362 N PD E+ ++ KF++ Sbjct: 113 NDPDATRKLKECEKAVMKLKFEE 135 >At4g22670.1 HSP associated protein like / p48, Homo sapiens, PATCHX:G904032;supported by full-length cDNA: Ceres:35786. Length = 441 Score = 50.1 bits (118), Expect = 9e-07 Identities = 33/102 (32%), Positives = 55/102 (53%), Gaps = 4/102 (3%) Frame = -3 Query: 505 AWKRRGQARAAL--GEFKEAIEDLTKALEFEPNSPDILHERGIVNFKFKDYNSALEDLST 332 A + +G+A AL G F EAIE LT+A+ P S + R V K K N+A+ D + Sbjct: 123 AQEAKGKAMEALSEGNFDEAIEHLTRAITLNPTSAIMYGNRASVYIKLKKPNAAIRDANA 182 Query: 331 CVKHDKKNSSAHTYLGLTLSALGEY-KRAEDEHVIG-LKYDE 212 ++ + ++ + G+ + LGE+ + A+D H+ + YDE Sbjct: 183 ALEINPDSAKGYKSRGMARAMLGEWAEAAKDLHLASTIDYDE 224 >At3g17870.1 HSC70-interacting protein, putative / similar to HSC70-INTERACTING PROTEIN GB:P50502 from [Homo sapiens] Length = 281 Score = 48.9 bits (115), Expect = 2e-06 Identities = 33/103 (32%), Positives = 53/103 (51%), Gaps = 4/103 (3%) Frame = -3 Query: 508 EAWKRRGQARAAL--GEFKEAIEDLTKALEFEPNSPDILHERGIVNFKFKDYNSALEDLS 335 +A + +A A+ G F EAIE LTKA+ P S + R V K K N+A+ D + Sbjct: 125 DAQSEKSKAMEAISDGRFDEAIEHLTKAVMLNPTSAILYATRASVFLKVKKPNAAIRDAN 184 Query: 334 TCVKHDKKNSSAHTYLGLTLSALGEYKR-AEDEHVIG-LKYDE 212 ++ + ++ + G+ + LG+++ A D HV L YDE Sbjct: 185 VALQFNSDSAKGYKSRGMAKAMLGQWEEAAADLHVASKLDYDE 227 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,113,269 Number of Sequences: 27288 Number of extensions: 277726 Number of successful extensions: 1040 Number of sequences better than 1.0e-05: 16 Number of HSP's better than 0.0 without gapping: 898 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1020 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 948861544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19058376|gb|BM737043.1|BM737043 952052F09.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (605 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g12930.1 expressed protein / ; supported by cDNA: gi_15215... 145 1e-45 At5g62600.1 putative protein / contains similarity to transpo... 47 8e-06 >At1g12930.1 expressed protein / ; supported by cDNA: gi_15215745_gb_AY050402.1_ Length = 1005 Score = 145 bits (366), Expect(2) = 1e-45 Identities = 69/127 (54%), Positives = 95/127 (74%) Frame = +2 Query: 41 ERNRRILRCLLSWVRVRCFSETPAASLARHPLLTFAFNSLQVSFSFEVAIEVMTELVSQH 220 + NR+ILRCLLSWVR CFSE P ++ HPLL + FN+LQ + +F++AIEV+ ELV++H Sbjct: 198 DNNRKILRCLLSWVRAGCFSEIPQGAVPSHPLLNYVFNALQGT-TFDLAIEVLVELVTRH 256 Query: 221 QELPEAFLSKTPYIREALLLPALANRNEKIIAGLACLMCEVGQAAPALVAEGGSQALALT 400 ++LP+ L K ++R+ LL PAL N + KII+GLACLM E+GQAAP L+ E S+AL LT Sbjct: 257 EDLPQVLLYKVQFLRDTLLKPALINADLKIISGLACLMSEIGQAAPCLIVEASSEALILT 316 Query: 401 DGLLRSI 421 D +L + Sbjct: 317 DAILSCV 323 Score = 55.1 bits (131), Expect(2) = 1e-45 Identities = 27/56 (48%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = +3 Query: 441 CVAFTSEDWEIAESTLQFWCSLAHFILGI-DVKSAKRNVAQELLGPVFSSLLDALL 605 CV F SEDWEIA+ST+QFW + A +IL + + R ++ PVFS+L+DAL+ Sbjct: 322 CVTFPSEDWEIADSTVQFWSTFATYILSLGGNRQNDRTRVKDTFLPVFSALVDALV 377 >At5g62600.1 putative protein / contains similarity to transportin-SR Length = 572 Score = 47.0 bits (110), Expect = 8e-06 Identities = 34/137 (24%), Positives = 67/137 (48%), Gaps = 11/137 (8%) Frame = +2 Query: 35 LDERNRRILRCLLSWVRVRCFSETPAASLARHPLLTFAFNSLQVSFSFEVAIEVMTELVS 214 + E ++L SW+R+R P LA HPL+ A +SL E ++ V++EL+ Sbjct: 195 ISELKEQVLEAFASWLRLR--HGIPGTVLACHPLVHAALSSLNCDPLSEASVNVISELI- 251 Query: 215 QHQELPEA--FLSKTPYIREALLLPAL---------ANRNEKIIAGLACLMCEVGQAAPA 361 H P + ++TP I+ +++P + ++++E+ + + L +VG + Sbjct: 252 HHTASPSSGGISAQTPLIQ--VIVPQILSLQAHLRDSSKDEEDVKAIGRLFADVGDSYVE 309 Query: 362 LVAEGGSQALALTDGLL 412 L+A G + + + LL Sbjct: 310 LIATGSDEPMVIVHALL 326 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,196,212 Number of Sequences: 27288 Number of extensions: 308668 Number of successful extensions: 787 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 785 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 957813068 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19058329|gb|BM736996.1|BM736996 952051H12.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (566 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24260.1 dipeptidyl peptidase IV-like protein / 218 2e-57 >At5g24260.1 dipeptidyl peptidase IV-like protein / Length = 746 Score = 218 bits (554), Expect = 2e-57 Identities = 101/167 (60%), Positives = 130/167 (77%), Gaps = 1/167 (0%) Frame = -3 Query: 564 PFAGAATVKVRLGVVHSHGG-EVTWMDLLCGDPNGPHSDEEYLARVNWMHNSALAVQVLN 388 PFAGA +RLGVV S GG + TWM+L+CG ++++EYL RVNW+ + L VQVLN Sbjct: 244 PFAGALNSTLRLGVVSSAGGGKTTWMNLVCGGRG--NTEDEYLGRVNWLPGNVLIVQVLN 301 Query: 387 RSHTKLKLLKFDISTGEREVLLEEQHDVWITLHDCFTPLDKGVNNKHPGGFIWASEKTGF 208 RS +KLK++ FDI+TG+ VLL E+ D W+TLHDCFTPL+K +++ GGFIWASE+TGF Sbjct: 302 RSQSKLKIISFDINTGQGNVLLTEESDTWVTLHDCFTPLEKVPSSRGSGGFIWASERTGF 361 Query: 207 RHLYVHGNDGACLGPLTQGDWMVEHIAGINESNGLIYFTGTLDGPLE 67 RHLY++ +DG CLG +T G+WMVE IAG+NE L+YFTGTLDGPLE Sbjct: 362 RHLYLYESDGTCLGAITSGEWMVEQIAGVNEPMSLVYFTGTLDGPLE 408 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,784,521 Number of Sequences: 27288 Number of extensions: 312904 Number of successful extensions: 869 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 838 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 866 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 841443256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19058314|gb|BM736981.1|BM736981 952051G03.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (209 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60360.1 putative protein / CGI-94 protein, Homo sapiens, ... 87 1e-18 >At3g60360.1 putative protein / CGI-94 protein, Homo sapiens, EMBL:AF151852;supported by full-length cDNA: Ceres:13387. Length = 228 Score = 87.4 bits (215), Expect = 1e-18 Identities = 40/56 (71%), Positives = 49/56 (87%) Frame = +3 Query: 33 MSSLRNAIPRRAHKERAQPEARKKVGLLEKHKDYVVRARAYHIKEATIAKLKEKAA 200 MSSLRNAIPR AHKER+QPEARK+ G+LEKHKDY++RA AYH K+ T+ L++KAA Sbjct: 1 MSSLRNAIPRPAHKERSQPEARKRFGILEKHKDYIIRANAYHKKQETLKILRQKAA 56 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,047,364 Number of Sequences: 27288 Number of extensions: 106755 Number of successful extensions: 571 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 487 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 559 length of database: 11,516,596 effective HSP length: 45 effective length of database: 10,288,636 effective search space used: 246927264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19058310|gb|BM736977.1|BM736977 952051F08.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (569 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80460.1 putative glycerol kinase / similar to GLYCEROL KI... 283 5e-78 >At1g80460.1 putative glycerol kinase / similar to GLYCEROL KINASE GB:O69664 from [Mycobacterium tuberculosis] Length = 522 Score = 283 bits (724), Expect(2) = 5e-78 Identities = 131/171 (76%), Positives = 150/171 (87%) Frame = +2 Query: 56 YDRHAKPGASHQLEFKQHYPEAGWVEHDPMEIIETVKVCMKDAVGKAKAGKHNVVAGLKA 235 YD A+P ASHQ+EF Q YPEAGWVEHDPMEI+E+VKVC+ A+ KA A HNV GLKA Sbjct: 23 YDHDARPVASHQVEFTQFYPEAGWVEHDPMEILESVKVCIAKALDKATADGHNVDGGLKA 82 Query: 236 IGITNQRETTVMWSKSTGRPLNNAIVWMDARTSPVCRRLENELSGGRTHFVETCGLPIST 415 IG+T+QRETTV+WSKSTG PL+ AIVWMDARTS +CRRLE ELSGGR+HFVE+CGLPIST Sbjct: 83 IGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICRRLEKELSGGRSHFVESCGLPIST 142 Query: 416 YFSALKLLWLMENVDAVKDAVRTGDALFGTIDTWLIWNLTGGVAGGQHVTD 568 YFSA+KLLWLMENVD VKDA++ GDA+FGTIDTWLIWN+TGG+ GG HVTD Sbjct: 143 YFSAMKLLWLMENVDDVKDAIKKGDAIFGTIDTWLIWNMTGGINGGLHVTD 193 Score = 25.4 bits (54), Expect(2) = 5e-78 Identities = 10/16 (62%), Positives = 13/16 (80%) Frame = +1 Query: 1 EEVYVAAIDQGTTSTR 48 E ++ +IDQGTTSTR Sbjct: 4 ENGFIGSIDQGTTSTR 19 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,414,720 Number of Sequences: 27288 Number of extensions: 372682 Number of successful extensions: 1017 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 975 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1017 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 850394780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19058179|gb|BM736846.1|BM736846 952049G08.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (299 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27325.1 hypothetical protein / similar to negative regula... 122 1e-29 >At3g27325.1 hypothetical protein / similar to negative regulator of COPII vesicle formation GB:NP_011162 from [Saccharomyces cerevisiae] Length = 1048 Score = 122 bits (305), Expect(2) = 1e-29 Identities = 55/73 (75%), Positives = 67/73 (91%) Frame = +3 Query: 78 LSNVVVVSVSGGIHDYQIRSRVASLDGIVPSTHGFMVGSSSMKNVWLSMEHQSILWCNQL 257 LS VVVVS+SGG +DYQ+RS++ SLDGIVPS+HGFM+ S+SM NVWLSMEHQ+ILWCNQL Sbjct: 295 LSGVVVVSISGGYNDYQVRSKLESLDGIVPSSHGFMISSTSMTNVWLSMEHQAILWCNQL 354 Query: 258 AVQVAHTLLSIID 296 VQV+HTLLS++D Sbjct: 355 VVQVSHTLLSMVD 367 Score = 23.1 bits (48), Expect(2) = 1e-29 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +1 Query: 13 SHVNEEWRKGYK 48 + VN EW+KGY+ Sbjct: 269 AQVNREWKKGYE 280 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,811,903 Number of Sequences: 27288 Number of extensions: 129313 Number of successful extensions: 261 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 256 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 261 length of database: 11,516,596 effective HSP length: 75 effective length of database: 9,469,996 effective search space used: 227279904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19058175|gb|BM736842.1|BM736842 952049F12.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (561 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g64570.1 hypothetical protein / predicted by genscan+ 167 3e-42 >At1g64570.1 hypothetical protein / predicted by genscan+ Length = 1239 Score = 167 bits (424), Expect = 3e-42 Identities = 80/117 (68%), Positives = 95/117 (80%) Frame = -2 Query: 395 LLALGILEYNNDWAAIQKRFLPCKSKHQIFVSQKNRSSSKAPDNPVKDVRHMKTSPLTDE 216 LLALGI+EYN+DW AI++RFLP K +HQI+V QKNR SSKAP+NP+K V MK+SPLT + Sbjct: 511 LLALGIMEYNSDWKAIKQRFLPSKGEHQIYVRQKNRRSSKAPENPIKAVLRMKSSPLTPQ 570 Query: 215 EKECIQEGLRIFKNDWTSVWRFVVPHRDPSLLQRQWRVASGIQKSYTKSDAEKERRR 45 E IQEGL+ FK DWTSVW+FVVP+RDPSLL RQWR A GIQKSY +KE+RR Sbjct: 571 EILRIQEGLKYFKYDWTSVWKFVVPYRDPSLLPRQWRTALGIQKSYKLDAVKKEKRR 627 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,960,233 Number of Sequences: 27288 Number of extensions: 332995 Number of successful extensions: 1169 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1169 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 835029516 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19058079|gb|BM736746.1|BM736746 952048D04.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (544 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60740.1 beta-tubulin cofactor - like protein / beta-tubul... 199 6e-52 >At3g60740.1 beta-tubulin cofactor - like protein / beta-tubulin folding cofactor D, Homo sapiens, EMBL:HSA6417; supported by cDNA: gi_20514262 Length = 1254 Score = 199 bits (507), Expect = 6e-52 Identities = 100/181 (55%), Positives = 136/181 (74%), Gaps = 1/181 (0%) Frame = +3 Query: 3 HQEHLIPFIPHRELLEEIIPNSRDLEWAVPTVSYPRLVKLLQVSYYSKSVLSGLVISTGG 182 H+ +P +P+RE LEEI+PN +L+WAVP S+PR V+LL++ YSK V+SGLVIS GG Sbjct: 964 HKSVSVPHVPYREKLEEILPNKANLQWAVPAFSFPRFVQLLKLRCYSKEVMSGLVISIGG 1023 Query: 183 LQESLKKASMSALVGYLQDSDINTNCEGKSREYLLSCDLLWGLQHYQKCDRVITPMFKTI 362 LQ+SL+KAS+ AL+ Y+++ + E +SRE L D+LW LQ Y+KCDRV+ P +TI Sbjct: 1024 LQDSLRKASLVALLEYMREGEAKDPKEQQSRESALGDDILWILQEYKKCDRVMVPCLQTI 1083 Query: 363 EALFSKKVFLNKEGYS-EFYSGLVDSVSSELKGSKDFTKLCAGLSILGYISSESDGTCTK 539 E LFS K+FLN+E Y+ FY+G++DS++ EL+ SKDFTKL AGL+ILGYI+S S TK Sbjct: 1084 EILFSSKIFLNQESYTFSFYAGVMDSLAIELRASKDFTKLKAGLAILGYIASVSHFISTK 1143 Query: 540 A 542 A Sbjct: 1144 A 1144 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,349,645 Number of Sequences: 27288 Number of extensions: 259207 Number of successful extensions: 701 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 700 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 781156644 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19058073|gb|BM736740.1|BM736740 952048C10.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (574 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20190.1 unknown protein / ; supported by cDNA: gi_20259451 147 5e-36 >At2g20190.1 unknown protein / ; supported by cDNA: gi_20259451 Length = 1330 Score = 147 bits (370), Expect = 5e-36 Identities = 95/187 (50%), Positives = 122/187 (64%), Gaps = 1/187 (0%) Frame = -1 Query: 574 GTSAIVAMDKSAAISSDSSFPSNTLRLSQSKTIGRSSERSLESVLSSSKEKVSAIESLLK 395 GTSAIVAMD+S+ +SS S S L LSQSK + + SERSLESVL SSK+KVSAIES+L+ Sbjct: 429 GTSAIVAMDRSSNLSSGGSLSSGLL-LSQSKDVNKGSERSLESVLQSSKQKVSAIESMLR 487 Query: 394 GVSMSG-QNFSAARSTSLDLGVDPPSSRDPPVPLAAPASNVLSLQNSALLDSSLPTIPPS 218 G+ +S QN +A RS+SLDLGVDPPSSRDPP APASN S +SA +S+ S Sbjct: 488 GLHISDRQNPAALRSSSLDLGVDPPSSRDPPFHAVAPASN--SHTSSAAAESTHSINKGS 545 Query: 217 SRNGGSRLLDTMTTHLPTKERSRSPYLSNMSSESISGLSLPYSRKSLDRLQEGGRMDESY 38 +RNGG L D +T +K+ RS Y N+ SES S +++ +R E ++ES Sbjct: 546 NRNGGLGLSDIITQIQASKDSGRSSYRGNLLSESHPTFSSLTAKRGSER-NERSSLEESN 604 Query: 37 DIRSTRQ 17 D R R+ Sbjct: 605 DAREVRR 611 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,289,073 Number of Sequences: 27288 Number of extensions: 303512 Number of successful extensions: 1276 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1265 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 859346304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19057997|gb|BM736664.1|BM736664 952047A12.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (406 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18410.1 putative protein / p53 inducible protein PIR121, ... 175 8e-45 >At5g18410.1 putative protein / p53 inducible protein PIR121, Homo sapiens, EMBL:AF160973 Length = 1235 Score = 175 bits (443), Expect = 8e-45 Identities = 85/122 (69%), Positives = 100/122 (81%) Frame = +2 Query: 8 VGDSVAWAGCTIMYLLGQQQHFELFDFSYQFLNVAEVESATVSHYQSSERTKSSNFLQGY 187 +GDS+AW GCTI+YLLGQQ HFELFDFSYQ LNV+EVE+ + SH ++ QG+ Sbjct: 1117 LGDSIAWGGCTIIYLLGQQLHFELFDFSYQVLNVSEVETVSASHTH-----RNPQIHQGW 1171 Query: 188 EGILEAMRKARRLNNHVFSMLRARCPLEDKVACAIKPSGAPLHRMKFMNTVSAFETLPQR 367 EG+LE M+KARRLNNHVFSML+ARCPLEDK ACAIK SGAPL R++F NTVSAFETLPQ+ Sbjct: 1172 EGLLEGMKKARRLNNHVFSMLKARCPLEDKTACAIKQSGAPLPRVRFENTVSAFETLPQK 1231 Query: 368 VT 373 T Sbjct: 1232 GT 1233 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,147,922 Number of Sequences: 27288 Number of extensions: 182116 Number of successful extensions: 514 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 419301592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19057936|gb|BM736603.1|BM736603 952038G05.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (380 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g51740.1 putative protein / contains similarity to peptidase 189 5e-49 >At5g51740.1 putative protein / contains similarity to peptidase Length = 485 Score = 189 bits (479), Expect = 5e-49 Identities = 95/126 (75%), Positives = 112/126 (88%) Frame = +2 Query: 2 NKFRADAEVATVVGHEGGHAIARHSAEQITKNLWVAILQIGILQFIYMPDLINTGSTLLL 181 N F++DAEVATV+GHE GHA+ARH AE ITKNLW AILQ+ + QF+ MPDL+NT S L L Sbjct: 338 NHFKSDAEVATVIGHEVGHAVARHVAEGITKNLWFAILQLVLYQFV-MPDLVNTMSALFL 396 Query: 182 RLPFSRRMEIEADHIGLLLLAAAGYDPRVAPSVYEKLGKIGGDSALNNYLSTHPSSKKRA 361 RLPFSR+MEIEAD+IGLLLLA+AGYDPRVAP+VYEKLGK+GGD AL +YLSTHPS KKR+ Sbjct: 397 RLPFSRKMEIEADYIGLLLLASAGYDPRVAPTVYEKLGKLGGD-ALGDYLSTHPSGKKRS 455 Query: 362 QLLSQA 379 +LL+QA Sbjct: 456 KLLAQA 461 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,475,274 Number of Sequences: 27288 Number of extensions: 171669 Number of successful extensions: 490 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 487 length of database: 11,516,596 effective HSP length: 87 effective length of database: 9,142,540 effective search space used: 356559060 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19057773|gb|BM736440.1|BM736440 952050G10.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (518 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g21110.1 phosphoribosyamidoimidazole-succinocarboxamide synth... 267 2e-72 >At3g21110.1 phosphoribosyamidoimidazole-succinocarboxamide synthase, putative / similar to PHOSPHORIBOSYLAMIDOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE GB:P38025 from [Arabidopsis thaliana];supported by full-length cDNA: Ceres:35508. Length = 411 Score = 267 bits (683), Expect = 2e-72 Identities = 124/168 (73%), Positives = 149/168 (87%) Frame = +2 Query: 14 NQTRHITPNAVVSSPDKNVTIAKRCTVFPVEFVVRGFVTGSTDTSLWTGYNKGVRNYCGN 193 N T+HITPNA+VSSPD+NV IAK+C+VFP+EFVVRG+VTGSTDTSLWT YNKGVRNYCGN Sbjct: 158 NNTQHITPNAIVSSPDRNVVIAKKCSVFPIEFVVRGYVTGSTDTSLWTVYNKGVRNYCGN 217 Query: 194 VLPDGMVKNEKLSSNILTPTTKAADHDVPVTPDEIIESGLMSKEDFHEAGSKALSLFAYG 373 L DG+VKN+KL +NILTPTTKAADHDVP++P+EI+E G M++ +F EA KALSLF +G Sbjct: 218 ELSDGLVKNQKLPANILTPTTKAADHDVPISPNEIVEGGFMTQAEFDEASMKALSLFEFG 277 Query: 374 QKVALENGLILVDTKYEFGKTPDGTIGLIDEGHTPDSSRYWIANSYED 517 Q VA ++GLILVDTKYEFG++ DG+I LIDE HTPDSSRYW+A SYE+ Sbjct: 278 QGVAKKHGLILVDTKYEFGRSSDGSILLIDEIHTPDSSRYWLAGSYEE 325 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,695,590 Number of Sequences: 27288 Number of extensions: 253308 Number of successful extensions: 599 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 590 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 599 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 720488000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19057755|gb|BM736422.1|BM736422 952050E05.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (609 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g33945.1 putative protein / ; supported by cDNA: gi_20466... 234 3e-62 >At4g33945.1 putative protein / ; supported by cDNA: gi_20466737 Length = 464 Score = 234 bits (596), Expect = 3e-62 Identities = 113/194 (58%), Positives = 152/194 (78%) Frame = +1 Query: 28 KSNVQSLYDAIRVLLKPDDNRVVASQVYGYSRRFAEIGVAEVLVNALREQVAPSSLPSAC 207 K+ +++LYDAI LL PDD RVVASQVYGY+R FA++G+A L AL+ + SL SA Sbjct: 219 KTTIRALYDAICALLTPDDFRVVASQVYGYARTFAKLGIATALTEALQAGIGSDSLVSAS 278 Query: 208 AALKSIAVNDEICRSISENGGIDVLLQCIDGAGEQKNKAVARSCCSLLSKLAASDANKSI 387 ALK+IAVNDEIC+SI+E+GGID LL+CID +GEQ NK A++CCSLLSKLA SD+NKS Sbjct: 279 TALKAIAVNDEICKSIAESGGIDTLLRCIDDSGEQGNKTAAKTCCSLLSKLAGSDSNKST 338 Query: 388 IIQRGGFDRFLKLTSRFSEDPAIIQEVMSMVTVLTLRSPENAARAMEEGYGTLAIQAMQR 567 I+++ G D+ + L RFS+DP +IQEVM +++++ LRSP++AA+A+E G G LA+QAM+R Sbjct: 339 IVEKQGLDKLITLALRFSDDPLVIQEVMLIISIICLRSPDHAAKAIEAGAGDLAVQAMKR 398 Query: 568 FPSSVQTQKQACLM 609 FP + Q Q+ AC M Sbjct: 399 FPVAAQMQRNACNM 412 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,337,064 Number of Sequences: 27288 Number of extensions: 325867 Number of successful extensions: 951 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 921 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 951 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 966764592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18965232|gb|BM661467.1|BM661467 952048G12.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (424 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05570.1 putative protein / similar to unknown protein (pi... 151 1e-37 >At5g05570.1 putative protein / similar to unknown protein (pir||T04661) Length = 1124 Score = 151 bits (382), Expect = 1e-37 Identities = 77/139 (55%), Positives = 98/139 (70%) Frame = -2 Query: 420 LQFITNQGLLVAISNENEIQVWNLEFRQLFYSSQWDVNITAFAVIERTFMMYLGDENGLL 241 L+F+ NQG LV+ISNENEIQVW+L+ RQ S +W+ NITAFA++ T MY+GDE G++ Sbjct: 91 LEFMQNQGFLVSISNENEIQVWDLDLRQPASSLKWESNITAFAILHGTGYMYVGDEYGMV 150 Query: 240 SVLKYDVDDGKLQIMPYNVHIHSLIERSGVSLQDPQPIVGILIQPDTFGTRLLIAYERGL 61 SVL Y D+GKL +PY V +L E +G+S P+VG+L QP + GTRLLIA+ GL Sbjct: 151 SVLNYSADEGKLLQLPYYVPTDALSEAAGLSSPIDYPVVGLLSQPCSKGTRLLIAFSNGL 210 Query: 60 LVLWDVSEDRAVSVRGYGD 4 L LWD SED V VRG D Sbjct: 211 LFLWDASEDHVVLVRGNKD 229 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,698,453 Number of Sequences: 27288 Number of extensions: 201158 Number of successful extensions: 603 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 588 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 463486164 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18965199|gb|BM661448.1|BM661448 952048E07.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (585 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g15180.1 expressed protein / ;supported by full-length cDN... 132 2e-31 >At3g15180.1 expressed protein / ;supported by full-length cDNA: Ceres:39566. Length = 519 Score = 132 bits (331), Expect = 2e-31 Identities = 63/152 (41%), Positives = 98/152 (64%), Gaps = 1/152 (0%) Frame = +3 Query: 132 AAADFASYPGLHSDDTGREFLERCPLPKLLGALQSEEDVPGMVETVTECLDKIFSSRYGA 311 AA +FA YPG ++ + +EFL+R PLP + ALQ++ D+PG T+ CL+++F ++YGA Sbjct: 10 AAFEFAHYPGAQNETSVKEFLDRFPLPVIFNALQTDPDIPGFENTLVTCLERLFKTKYGA 69 Query: 312 SLLPNYGAFIQAGLHTDSKQIRKLACKAVLHLLDKAEDGG-AAVETVVQHNLYPLLIKCL 488 SL+P Y +Q GL DS ++ LACK VL LL+ + ++V+ VV + +YPLL+ + Sbjct: 70 SLIPQYMPVLQVGLKADSAVVKSLACKTVLCLLEDCDTNDVSSVQLVVNNGIYPLLLDYI 129 Query: 489 IEGDEEISAIILDTGKRLAQIPKGAEVIFPPD 584 I D+E++ +T K LA+ P VIFP + Sbjct: 130 INSDDEVANAASETIKSLARFPDAMSVIFPSE 161 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,472,438 Number of Sequences: 27288 Number of extensions: 329922 Number of successful extensions: 1196 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1192 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 895152400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18965131|gb|BM661409.1|BM661409 952047H04.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (285 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g56730.1 zinc protease PQQL-like protein / 132 3e-32 >At5g56730.1 zinc protease PQQL-like protein / Length = 956 Score = 132 bits (333), Expect = 3e-32 Identities = 61/94 (64%), Positives = 84/94 (88%) Frame = +1 Query: 1 EISIVRALMMSEMESAYLERDQMQSTSLRDEFLQHFLREEPVVGIEYEAQLQKTLLPHIS 180 EIS+VRALMMSE+ESAYLERDQ+QSTSLRDE++QHFL +EPV+GIEYEAQLQKTLLP IS Sbjct: 358 EISVVRALMMSEIESAYLERDQVQSTSLRDEYIQHFLHKEPVIGIEYEAQLQKTLLPQIS 417 Query: 181 SAEVAKFAENFSTASSCVIKIVEPRAHASLEDLK 282 +++V++++E T+ CVIK +EP++ A+++ ++ Sbjct: 418 ASDVSRYSEKLRTSCGCVIKSMEPKSAATIDHMR 451 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.128 0.333 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,389,807 Number of Sequences: 27288 Number of extensions: 123512 Number of successful extensions: 381 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 381 length of database: 11,516,596 effective HSP length: 70 effective length of database: 9,606,436 effective search space used: 230554464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18965050|gb|BM661364.1|BM661364 952047B05.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (537 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g42440.1 expressed protein / ; supported by cDNA: gi_13605... 233 6e-62 At1g06720.1 unknown protein / 50 7e-07 >At1g42440.1 expressed protein / ; supported by cDNA: gi_13605689_gb_AF361826.1_AF361826 Length = 793 Score = 233 bits (593), Expect = 6e-62 Identities = 116/176 (65%), Positives = 140/176 (78%), Gaps = 2/176 (1%) Frame = +2 Query: 14 KEANADDEEFPDEVETPLDVPAKKRFAKYRGLKSFRTSSWDPKESLPLDYARIFAFDNFT 193 KEA ADDEEFPDEVETP+DVPA++RFAKYRGLKSFRTSSWDP ESLP DYARIFAFDN Sbjct: 472 KEAYADDEEFPDEVETPIDVPARRRFAKYRGLKSFRTSSWDPNESLPQDYARIFAFDNVA 531 Query: 194 RTQKHVFAKIAEL-DGGMKNCAQVGSYVRLYVKNVPTDIASKLCH-PSRRIPVVVSGLLQ 367 RTQK V + ++ + +C +GSYVRL++K VP ASKL + P++ GLLQ Sbjct: 532 RTQKLVLKQALKMEEEDRDDCVPIGSYVRLHIKEVPLGAASKLSSLVNTTKPIIGFGLLQ 591 Query: 368 HESKMSVLHFSIKKHDSYEAPIKSKEPLIFNVGFRQFTARPLXSSDNINCNKHKME 535 HESKMSVLHFS+KK+D YEAPIK+KE L+F+VGFRQF ARP+ ++DN + +KHKME Sbjct: 592 HESKMSVLHFSVKKYDGYEAPIKTKEELMFHVGFRQFIARPVFATDNFSSDKHKME 647 >At1g06720.1 unknown protein / Length = 1147 Score = 50.1 bits (118), Expect = 7e-07 Identities = 25/94 (26%), Positives = 55/94 (57%), Gaps = 2/94 (2%) Frame = +2 Query: 257 QVGSYVRLYVKNVPTDIASKL--CHPSRRIPVVVSGLLQHESKMSVLHFSIKKHDSYEAP 430 + G+Y+RL + NVP ++ CHP ++V G+ E + + +KKH ++ Sbjct: 751 RTGTYLRLEIHNVPYEMVEFFDPCHP-----ILVGGIGFGEDNVGYMQARLKKHRWHKKV 805 Query: 431 IKSKEPLIFNVGFRQFTARPLXSSDNINCNKHKM 532 +K+++P+I ++G+R++ P+ + ++ N +H+M Sbjct: 806 LKTRDPIIVSIGWRRYQTIPVFAIEDRN-GRHRM 838 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,725,561 Number of Sequences: 27288 Number of extensions: 249779 Number of successful extensions: 763 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 759 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 763199020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18965006|gb|BM661336.1|BM661336 952046H04.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (476 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g64420.1 putative protein / similar to unknown protein (pi... 114 2e-26 >At5g64420.1 putative protein / similar to unknown protein (pir||T00246) Length = 1306 Score = 114 bits (286), Expect = 2e-26 Identities = 61/156 (39%), Positives = 97/156 (62%), Gaps = 9/156 (5%) Frame = +3 Query: 33 SRYNTVASVAQNATFWILKIINSKHCSEQELARVVDLFRSILSDY-DRKKSRLKLGFVKQ 209 +RY + + QN+T+W++KII+S+ SE EL +++D+FRS ++ Y D +KS+LK+ F+++ Sbjct: 1113 NRYKMITHLGQNSTYWVMKIIDSRKFSETELEKILDVFRSAVTGYFDSRKSQLKIDFLEE 1172 Query: 210 VAKRNPWIGQKLFGFVLQRAENTKAQYRRNQLLELAEFILKS--------WADGTSEMFL 365 V +R PWIG +LFGF+L+ + N ++RR + L+L L+S AD M Sbjct: 1173 VFRRRPWIGHQLFGFLLEASVNANVEFRRLEALDLITETLRSLIPINENTQADSRKTM-T 1231 Query: 366 NHLSQLCGLIQAALSAVAENKSRRREVRNFCTGILQ 473 HL +L LI+ + + E K RR +VR FC I Q Sbjct: 1232 THLKELILLIKELVGNMPEAKVRRAQVRKFCGRIFQ 1267 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,411,893 Number of Sequences: 27288 Number of extensions: 212896 Number of successful extensions: 741 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 739 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 605236996 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18965004|gb|BM661335.1|BM661335 952046H02.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (448 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62360.1 putative protein / Pm5 protein - Homo sapiens, PI... 167 2e-42 >At3g62360.1 putative protein / Pm5 protein - Homo sapiens, PIR:S21977 Length = 1227 Score = 167 bits (423), Expect = 2e-42 Identities = 86/136 (63%), Positives = 101/136 (74%), Gaps = 2/136 (1%) Frame = +3 Query: 42 PATSDVDIKILAAGKSNYAHLNKGDVATEAKTDSEGSFFAGPLYDDIVYKVEASKDGYHL 221 P V+IKI AA S + L KG++A E T S GSF AGPLYDDI Y EASK GYH+ Sbjct: 811 PPLPGVNIKIFAAKDSLISSLKKGEIAIETSTLSAGSFVAGPLYDDIPYATEASKPGYHI 870 Query: 222 KQTGPYTFSCQKLGQILVRIYG-ENSEL-LPSVLLSLSGEKGYRNNSISSSGGTFTFDNL 395 K+ GPY+FSCQKLGQI VR+ +N+E +P +LLSLSG+ GYRNNSIS +GG F FD+L Sbjct: 871 KRLGPYSFSCQKLGQISVRVNSKDNAETSIPPLLLSLSGDHGYRNNSISGAGGLFVFDSL 930 Query: 396 FPGXFYLRPLLKEYKF 443 FPG FYLRPLLKEY F Sbjct: 931 FPGNFYLRPLLKEYSF 946 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,502,462 Number of Sequences: 27288 Number of extensions: 194776 Number of successful extensions: 496 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 495 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 525519208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18964932|gb|BM661293.1|BM661293 952046E10.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (455 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g18730.1 hypothetical protein / predicted by genscan+ 167 4e-43 >At3g18730.1 hypothetical protein / predicted by genscan+ Length = 1220 Score = 167 bits (424), Expect(2) = 4e-43 Identities = 81/133 (60%), Positives = 105/133 (78%), Gaps = 1/133 (0%) Frame = +1 Query: 55 KKYFKSSMKLAWILKERSP-SQKSDFLKELIDAYNNMGMLELELDNFEEAEKLLIQGLKI 231 KKYFK +M+LA ILKE+ P + S FL+E I+A+NN+GML+L+LDN E A +L +GL+I Sbjct: 134 KKYFKKAMELAQILKEKPPPGESSGFLEEYINAHNNIGMLDLDLDNPEAARTILKKGLQI 193 Query: 232 CDDEEVDSYDDARTRLHHNLGNVYTELQNWKKARGHIEKDIEICRKIRHLQGEAKGFINL 411 CD+EEV YD AR+RLHHNLGNV+ L++W +A+ HIE DI IC KI H+QGEAKG+INL Sbjct: 194 CDEEEVREYDAARSRLHHNLGNVFMALRSWDEAKKHIEMDINICHKINHVQGEAKGYINL 253 Query: 412 GELHYRVQKYDNA 450 ELH + QKY +A Sbjct: 254 AELHNKTQKYIDA 266 Score = 23.5 bits (49), Expect(2) = 4e-43 Identities = 10/19 (52%), Positives = 13/19 (67%) Frame = +3 Query: 3 YHEILLRSENDHSAIGMQK 59 YHE+ L+SE+D AI K Sbjct: 116 YHEMFLKSEDDCEAIQSAK 134 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,216,382 Number of Sequences: 27288 Number of extensions: 220266 Number of successful extensions: 925 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 877 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 552701236 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18964413|gb|BM660991.1|BM660991 952043E06.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (611 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19490.1 putative protein / probable membrane protein YDR0... 205 2e-53 >At4g19490.1 putative protein / probable membrane protein YDR027c, Saccharomyces cerevisiae, PIR2:S50934 Length = 939 Score = 205 bits (521), Expect = 2e-53 Identities = 110/216 (50%), Positives = 149/216 (68%), Gaps = 13/216 (6%) Frame = +3 Query: 3 KASIKTTVGELLPVLTARPIDSDSVTGDRATDADA---------GGQSLANKLRSLSSEG 155 K +IK V +LLP+L AR ++SD G+R+ D + GG SLA+KLR+LSSE Sbjct: 420 KNAIKKAVADLLPILVARSLESDFSHGERSVDDETILTPSAYTGGGLSLASKLRTLSSEA 479 Query: 156 FVQLLSAIFRIVQVHLQQAAEVKRIVEWVMGNLDGTLGVDASNPTLQHGGTVIPDTQEND 335 FV LL+AIF+IVQ HL +A+EVK+ +EW++ N+DG D+ + G QE Sbjct: 480 FVNLLTAIFKIVQAHLVRASEVKKAIEWILCNIDGHYAADSVAAAIAVGAVAAETAQEIG 539 Query: 336 SSRGS---NTLTRSTSKIPFVQGKTNDFS-IINSLKNVRADVLRENTEAVFAACDAAHGR 503 GS + L ++TSK P +QGK++D S ++N +N RADVLRENTEAVFAAC+ HGR Sbjct: 540 FQGGSLVSSPLGKATSKAPPLQGKSSDASSLMNMSRNFRADVLRENTEAVFAACEVTHGR 599 Query: 504 WAKLLGVRSALHPRLRLQEFLIIYNITEEFIAATEK 611 WAKLLGVR+ LHP+L+LQEF+ IY++T+EFI +TEK Sbjct: 600 WAKLLGVRALLHPKLKLQEFMSIYDLTQEFITSTEK 635 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,826,708 Number of Sequences: 27288 Number of extensions: 262902 Number of successful extensions: 696 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 681 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 693 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 963817488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18964362|gb|BM660962.1|BM660962 952043C09.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (465 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72550.1 putative phenylalanyl-tRNA synthetase beta-subunit; ... 167 2e-42 >At1g72550.1 putative phenylalanyl-tRNA synthetase beta-subunit; PheHB / similar to phenylalanyl-tRNA synthetase beta-subunit (PheHB) GB:5032011 [Homo sapiens]; supported by cDNA: gi_17065261 Length = 598 Score = 167 bits (423), Expect = 2e-42 Identities = 85/137 (62%), Positives = 102/137 (74%), Gaps = 1/137 (0%) Frame = +2 Query: 2 RNVFIECTATDLTKANIVLNTMVTMFSEYCETKFEVEPVEVIHHDGRKTVYPDLSCYKMD 181 +NVFIECTATDLTKA IVLNTMVT FSE+C KFE+EPVEV + DG+ +YPDL+ Y M+ Sbjct: 250 KNVFIECTATDLTKAKIVLNTMVTTFSEFCARKFEIEPVEVTYDDGKSYIYPDLAVYDME 309 Query: 182 VLLSDILGPIGISQDEKQVVCLLNKMQLQAE-SHSLKGEARISVSVPPTRSDILHARDLS 358 V LS I IG+S +QV LL +MQLQAE + S + I V VPP+RSD+LH D+ Sbjct: 310 VPLSFITDSIGVSLKVEQVTSLLTRMQLQAEQAKSSDNQCAIKVHVPPSRSDVLHPCDVM 369 Query: 359 EDVAIAYGFNNVPKSKP 409 EDVAIAYGFNN+P KP Sbjct: 370 EDVAIAYGFNNIPTRKP 386 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,298,075 Number of Sequences: 27288 Number of extensions: 217118 Number of successful extensions: 577 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 576 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 569103444 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18964171|gb|BM660851.1|BM660851 952042D07.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (488 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26780.1 unknown protein / similar to GP|522127|gnl|PID|e3... 193 9e-58 >At2g26780.1 unknown protein / similar to GP|522127|gnl|PID|e349073|Z35639 and GP|2224677|gnl|PID|d1021664|AB002366; supported by cDNA: gi_20466505 Length = 1208 Score = 193 bits (491), Expect(2) = 9e-58 Identities = 94/131 (71%), Positives = 114/131 (86%) Frame = -1 Query: 482 CRALADIIQGRRYSQVCKHLRKIWTTTFRAMDDIKETVRTAGDSLCRAVSSLTIRLCDIS 303 C ALADIIQGR++ QV +HL+K+W FRAMDDIKETVR AGD LCRAV+SLTIR+CD++ Sbjct: 539 CLALADIIQGRKFDQVKEHLKKLWIAAFRAMDDIKETVRNAGDKLCRAVTSLTIRICDVT 598 Query: 302 LTSTSEANETMNIVLPYLLSEGILSKVSSVQKAAISLVMKLAKGAGPALRPHLPELVSCM 123 LT ++A + M+IVLP+LLSEGI+SKV+SV+KA+I +VMKLAKGAG ALRPHL +LV CM Sbjct: 599 LTELADAKQAMDIVLPFLLSEGIMSKVNSVRKASIGVVMKLAKGAGVALRPHLSDLVCCM 658 Query: 122 LECLSSLEDQG 90 LE LSSLEDQG Sbjct: 659 LESLSSLEDQG 669 Score = 47.0 bits (110), Expect(2) = 9e-58 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = -3 Query: 90 LNYVEMHAGNAGIKTDKLETLRIAVAKDSP 1 LNYVE+HA N GI+T+KLE LRI+++K SP Sbjct: 670 LNYVELHAANIGIETEKLENLRISISKGSP 699 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,137,028 Number of Sequences: 27288 Number of extensions: 197537 Number of successful extensions: 504 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 630427000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18964079|gb|BM660797.1|BM660797 952042A04.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (521 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g25720.1 glutamine cyclotransferase precursor - like protein ... 241 2e-64 >At4g25720.1 glutamine cyclotransferase precursor - like protein / glutamine cyclotransferase precursor, Carica papaya, AF061240;supported by full-length cDNA: Ceres:114197. Length = 320 Score = 241 bits (615), Expect = 2e-64 Identities = 114/173 (65%), Positives = 136/173 (77%) Frame = +1 Query: 1 STRFFSFDLVREYPHDPAAFTQGILYAGNDTLFESTGLYGRSSVRKVELQTGKVLVNHQM 180 S R ++V E+PHDP AFTQG+LYAGNDTLFESTGLYG+SSVRKV+L+TGKV + +M Sbjct: 71 SHRINEIEVVAEFPHDPDAFTQGLLYAGNDTLFESTGLYGKSSVRKVDLRTGKVEILEKM 130 Query: 181 DGDVFGEGLTLLGDRLFQVTWLKNDGFIYDRHNFSKRTSFTHKMRDGWGLATDGKVLFGS 360 D FGEGLTLLG+RLFQV WL N GF YD N SK F H M+DGWGLATDGK LFGS Sbjct: 131 DNTYFGEGLTLLGERLFQVAWLTNTGFTYDLRNLSKVKPFKHHMKDGWGLATDGKALFGS 190 Query: 361 HGTSMLYKLDSKSLEVMKVVTVKYHGNQVPYLNELEYIDGEVWANVWQTDCIA 519 GTS LY++D ++++V V+Y+G +V YLNELEYI+ EVWANVWQ+DCIA Sbjct: 191 DGTSTLYRMDPQTMKVTDKHIVRYNGREVRYLNELEYINNEVWANVWQSDCIA 243 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,753,109 Number of Sequences: 27288 Number of extensions: 296353 Number of successful extensions: 866 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 825 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 729494100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18963998|gb|BM660749.1|BM660749 952041E11.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (537 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g22770.1 putative gigantea protein / strong similarity to ... 250 4e-67 >At1g22770.1 putative gigantea protein / strong similarity to GB:CAB56039 from [Arabidopsis thaliana]; supported by cDNA: gi_6002679_gb_AF105064.1_AF105064 Length = 1173 Score = 250 bits (638), Expect = 4e-67 Identities = 127/167 (76%), Positives = 139/167 (83%) Frame = +3 Query: 36 ALACGEILRVLTHYNRPIFKVERQHTEAECSSTSDQATSSDSTDKRSNNSPGNESDWKPL 215 ALACGEILR+LTHYNRPI+K E+Q+ + E + S TS T + SP + + KPL Sbjct: 129 ALACGEILRILTHYNRPIYKTEQQNGDTERNCLSKATTSGSPTSEPKAGSP-TQHERKPL 187 Query: 216 RPLTPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTACSRGSGKHPQLMPST 395 RPL+PWI+DILLAAPLGIRSDYFRWC GVMGKYAAG ELKPPT A SRGSGKHPQLMPST Sbjct: 188 RPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAG-ELKPPTIA-SRGSGKHPQLMPST 245 Query: 396 PRWAVANGAGVILSVCDEEVARYETANLTAAAVPALLLPPPTTPLDE 536 PRWAVANGAGVILSVCD+EVARYETA LTA AVPALLLPPPTT LDE Sbjct: 246 PRWAVANGAGVILSVCDDEVARYETATLTAVAVPALLLPPPTTSLDE 292 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,023,559 Number of Sequences: 27288 Number of extensions: 305956 Number of successful extensions: 1147 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1072 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1140 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 763199020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18963928|gb|BM660709.1|BM660709 952041B06.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (551 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g38840.1 putative guanylate binding protein / 146 8e-36 At5g46070.1 putative protein / contains similarity to guanyla... 57 5e-09 >At2g38840.1 putative guanylate binding protein / Length = 217 Score = 146 bits (368), Expect = 8e-36 Identities = 66/76 (86%), Positives = 73/76 (95%) Frame = +3 Query: 297 VIGPYRSGKSFLLNQLLSLSCDKGFGVGHMRDTKTKGIWIWGTPVEMDVDGSKVSVLYLD 476 VIGPYRSGKSFLLNQLLSLSC +GFGVGHMRDTKTKGIW+WGTP+E+++DG K SV+YLD Sbjct: 51 VIGPYRSGKSFLLNQLLSLSCYEGFGVGHMRDTKTKGIWVWGTPLELEIDGVKTSVIYLD 110 Query: 477 TEGFESVGKSNVYDDR 524 TEGFESVGKSNVYDDR Sbjct: 111 TEGFESVGKSNVYDDR 126 >At5g46070.1 putative protein / contains similarity to guanylate binding protein Length = 1060 Score = 57.4 bits (137), Expect = 5e-09 Identities = 29/70 (41%), Positives = 44/70 (62%), Gaps = 1/70 (1%) Frame = +3 Query: 288 LTQVIGPYRSGKSFLLNQLLSLSCDKGFGVGHMRDTKTKGIWIWGTPVEMD-VDGSKVSV 464 + V G R GKSF+LNQLL S GF V TKG+W+W +P++ +DG++ ++ Sbjct: 72 VVSVCGRARQGKSFILNQLLGRS--NGFQVASTHKPCTKGLWLWSSPIKRTALDGTEYNL 129 Query: 465 LYLDTEGFES 494 L LD+EG ++ Sbjct: 130 LLLDSEGIDA 139 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,373,511 Number of Sequences: 27288 Number of extensions: 315486 Number of successful extensions: 1631 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1550 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 808093080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18963911|gb|BM660700.1|BM660700 952041A10.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (629 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g20050.1 C-8,7 sterol isomerase / identical to GB:AAD03489... 249 8e-67 >At1g20050.1 C-8,7 sterol isomerase / identical to GB:AAD03489 from [Arabidopsis thaliana] (Plant Mol. Biol. 38 (5), 807-815 (1998));supported by full-length cDNA: Ceres:2121. Length = 223 Score = 249 bits (636), Expect = 8e-67 Identities = 114/195 (58%), Positives = 150/195 (76%) Frame = +3 Query: 45 MGHPYAPAELDLPGFVPLKLSQVEILVSYLGASVFVFLAVWLVSGRCVRLSKTDRLLMCW 224 + HPY P +L+LPG+VP+ +S I+ YLG+S+ V VWL+ GR + +K D+LLMCW Sbjct: 4 LAHPYVPRDLNLPGYVPISMSMSSIVSIYLGSSLLVVSLVWLLFGR--KKAKLDKLLMCW 61 Query: 225 WAFTGLTHIMIEGPFVFTPDFFKKENPNFFDEVWKEYSKGDSRYVARDTATVTVEGITAV 404 W FTGLTH+++EG FVF+P+FFK + EVWKEYSKGDSRYV RD+A V+VEGITAV Sbjct: 62 WTFTGLTHVILEGYFVFSPEFFKDNTSAYLAEVWKEYSKGDSRYVGRDSAVVSVEGITAV 121 Query: 405 LEGPASLLVVYAIASRKSFSHILQFAVCLGQLYGCLVYFITAYLDGFNFWVGPFYFWAYF 584 + GPASLL +YAIA KS+S++LQ A+ + QLYGCLVYFITA L+G NF FY+++Y+ Sbjct: 122 IVGPASLLAIYAIAKEKSYSYVLQLAISVCQLYGCLVYFITAILEGDNFATNSFYYYSYY 181 Query: 585 IGANSFWIWIPMLIA 629 IGAN +W+ IP LI+ Sbjct: 182 IGANCWWVLIPSLIS 196 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,613,808 Number of Sequences: 27288 Number of extensions: 378031 Number of successful extensions: 1974 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1945 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1017362904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18963872|gb|BM660677.1|BM660677 952040G08.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (454 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48470.1 expressed protein / ;supported by full-length cD... 211 1e-55 >At5g48470.1 expressed protein / ;supported by full-length cDNA: Ceres:25275. Length = 397 Score = 211 bits (537), Expect = 1e-55 Identities = 103/135 (76%), Positives = 121/135 (89%) Frame = +1 Query: 46 KWDPAECDALLRGGEQVASVLQEMVTLMEDMEMDGAFEQVAVELVAQGVIGKRVDEMESG 225 K DPAE +ALL+GGEQV SVL+EM+TL+EDM+M+ A E VAVEL AQGVIGKRVDEMESG Sbjct: 82 KLDPAEYEALLKGGEQVTSVLEEMITLLEDMKMNEASENVAVELAAQGVIGKRVDEMESG 141 Query: 226 FLMALDYMIQLAQKDTDDERKSILEVIKQTGLDHLTKKCPPHVQVVGLLCQTEKKESRHE 405 F+MALDYMIQLA KD D++RKS+LEV+K+T L HLTKKCPPHVQV+GLLC+T KKESRHE Sbjct: 142 FMMALDYMIQLADKDQDEKRKSLLEVVKETVLSHLTKKCPPHVQVIGLLCRTPKKESRHE 201 Query: 406 SLRRVAAGGGVFKND 450 LRRVAAGGG F+++ Sbjct: 202 LLRRVAAGGGAFESE 216 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.315 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,148,993 Number of Sequences: 27288 Number of extensions: 333342 Number of successful extensions: 2865 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2529 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 543640560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18963710|gb|BM660587.1|BM660587 952039G02.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (539 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63420.1 putative protein / similar to unknown protein (sp... 292 8e-80 >At5g63420.1 putative protein / similar to unknown protein (sp|P54122) Length = 528 Score = 292 bits (747), Expect = 8e-80 Identities = 146/178 (82%), Positives = 167/178 (93%) Frame = +2 Query: 5 DGIIFHTGDWKIDESPVDGKNFDRQALEELSKEGVTLMMSDSTNVLSPGRSISEILVVAG 184 DG I HTGDWKIDE+P+DGK FDR+ALEELSKEGVTLMMSDSTNVLSPGR+ISE VVA Sbjct: 259 DGNILHTGDWKIDEAPLDGKVFDREALEELSKEGVTLMMSDSTNVLSPGRTISE-KVVAD 317 Query: 185 SLLRHISEAKGRVITTQFASNIHRIGSIKAAADLTGRKMVFVGMSLRTYLEAAFKDGKAP 364 +L+R++ AKGRVITTQFASNIHR+GSIKAAAD+TGRK+VFVGMSLRTYLEAA++DGKAP Sbjct: 318 ALVRNVMAAKGRVITTQFASNIHRLGSIKAAADITGRKLVFVGMSLRTYLEAAWRDGKAP 377 Query: 365 LDPSTLIKVEDMDAYAPKDLLVVTTGSQGEPRAALNLASYGGSHALKLSKEDVLLYSA 538 +DPS+LIKVED++AYAPKDLL+VTTGSQ EPRAALNLASYG SHA KL+KED++LYSA Sbjct: 378 IDPSSLIKVEDIEAYAPKDLLIVTTGSQAEPRAALNLASYGSSHAFKLTKEDIILYSA 435 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,870,102 Number of Sequences: 27288 Number of extensions: 295490 Number of successful extensions: 754 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 772177832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18963336|gb|BM660378.1|BM660378 952037C03.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (576 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05520.1 alpha subunit of F-actin capping protein / suppor... 258 2e-69 >At3g05520.1 alpha subunit of F-actin capping protein / supported by full-length cDNA: Ceres:33531. Length = 308 Score = 258 bits (659), Expect = 2e-69 Identities = 120/184 (65%), Positives = 145/184 (78%) Frame = +1 Query: 25 ELPSAYIEEFRCALDVELSKYVAEAYPKGTCAVYCTSGKDIEGPGADFSFAAVISATKRS 204 ELPS YIEE+R ALD E+ +YV+E+YPKG AV C GKD EGPG+DF +I+A + S Sbjct: 120 ELPSLYIEEYRYALDAEIQRYVSESYPKGMSAVNCVKGKDNEGPGSDFELVVIITAMRLS 179 Query: 205 PQNFCNGSWRSIWTMEFNYELQFVDIKGNIQVDAHYFEEGNVQLDTNIDRKDSTIMQSPD 384 PQNFCNGSWRS+W ++F E Q +DIKG +QV AHYFEEGNV+LD D +DSTI QS D Sbjct: 180 PQNFCNGSWRSVWNIDFQDESQVLDIKGKLQVGAHYFEEGNVELDAKKDFQDSTIFQSAD 239 Query: 385 DCAVSITSIIRHHESEYLSSLEESYLNLSDATFKDLRRKLPVTRTLFPWHNTLAVSLTRD 564 DCA++I +IIRHHE+EYL+SLE +Y L D TFKDLRRKLPVTRTLFPW NTL SLTR+ Sbjct: 240 DCAIAIANIIRHHETEYLASLEVAYSKLPDNTFKDLRRKLPVTRTLFPWQNTLQFSLTRE 299 Query: 565 LAKQ 576 + K+ Sbjct: 300 VEKE 303 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,364,616 Number of Sequences: 27288 Number of extensions: 252248 Number of successful extensions: 656 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 656 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 868297828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18963330|gb|BM660374.1|BM660374 952037B12.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (616 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80410.1 putative N-terminal acetyltransferase / similar t... 347 2e-96 >At1g80410.1 putative N-terminal acetyltransferase / similar to N-TERMINAL ACETYLTRANSFERASE GB:P12945 from (Saccharomyces cerevisiae); supported by cDNA: gi_17381117 Length = 897 Score = 347 bits (891), Expect = 2e-96 Identities = 165/205 (80%), Positives = 185/205 (89%) Frame = +2 Query: 2 NCMDRKSEAYELVRRGLKNDLKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEI 181 NCMDRK+EAYELVR G+KND+KSHVCWHV GLLYRSDREYREAIKCYRNALRIDPDN+EI Sbjct: 54 NCMDRKTEAYELVRLGVKNDIKSHVCWHVLGLLYRSDREYREAIKCYRNALRIDPDNLEI 113 Query: 182 LRDLSLLQAQMRDLSGFVETRQQLLSLKPNHRMNWIGFAVAHHLNSNSSKAVEVLEAYEG 361 LRDLSLLQAQMRDLSGFVETRQQLL+LKPNHRMNWIGFAV+ HLN+N+SKAVE+LEAYEG Sbjct: 114 LRDLSLLQAQMRDLSGFVETRQQLLTLKPNHRMNWIGFAVSQHLNANASKAVEILEAYEG 173 Query: 362 TLEDDYPPENERYEHNEMLLYKISLFEECGMLDRALEEMQKKESKIVDKLSFKEQMASVL 541 TLEDDYPPENE EH EM+LYK+SL EE G D+ALEE+ KKE KIVDKLS+KEQ S+L Sbjct: 174 TLEDDYPPENELIEHTEMILYKVSLLEESGSFDKALEELHKKEPKIVDKLSYKEQEVSLL 233 Query: 542 FKLGRFDESESIYRSLLFMNPDNYK 616 K+GR +E+ +YR LL MNPDNY+ Sbjct: 234 SKVGRLEEANKLYRVLLSMNPDNYR 258 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,425,711 Number of Sequences: 27288 Number of extensions: 289258 Number of successful extensions: 1126 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1058 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1121 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 972741724 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18963293|gb|BM660353.1|BM660353 952037A09.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (599 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74260.1 putative phosphoribosylformylglycinamidine synthase ... 308 1e-84 >At1g74260.1 putative phosphoribosylformylglycinamidine synthase / similar to GB:KIAA0361 from [Homo sapiens] Length = 1387 Score = 308 bits (790), Expect = 1e-84 Identities = 155/199 (77%), Positives = 169/199 (84%) Frame = -3 Query: 597 ASPLQILVDASDGASDYGNKFGEPLIQGYTRTFGMRLLNGERREWLKPIMFSGAIGQIDH 418 ASPLQIL+DAS+GASDYGNKFGEP+IQGYTRTFGMRL +G+RREWLKPIMFS IGQIDH Sbjct: 441 ASPLQILIDASNGASDYGNKFGEPMIQGYTRTFGMRLPSGDRREWLKPIMFSAGIGQIDH 500 Query: 417 AHISKGDPEIGMLVVKIGGPAYRIGMGGGAASSMVSGQNDAELDFNAVQRGDAEMAQKLY 238 HI+KG+PE+GMLVVKIGGPAYRIGMGGGAASSMVSGQNDAELDFNAVQRGDAEM+QKLY Sbjct: 501 THITKGEPEVGMLVVKIGGPAYRIGMGGGAASSMVSGQNDAELDFNAVQRGDAEMSQKLY 560 Query: 237 RVVRACAEMGESNPIISIHDQGAGGNCNVVKEIIYPKGAEIDMPFNCCW*SYIVGLRDMG 58 RVVRAC EMGE NPIISIHDQGAGGNCNVVKEIIYP+GAEID+ + L G Sbjct: 561 RVVRACIEMGEKNPIISIHDQGAGGNCNVVKEIIYPQGAEIDIRAVVVGDHTMSVLEIWG 620 Query: 57 C*VPGTGCLLVKLESRSLL 1 +LVK ESR +L Sbjct: 621 AEYQEQDAILVKAESREIL 639 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,311,049 Number of Sequences: 27288 Number of extensions: 338666 Number of successful extensions: 1333 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1032 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1320 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 939910020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18963266|gb|BM660337.1|BM660337 952036H03.x3 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (589 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g42990.1 bZIP family transcription factor / contains Pfam ... 103 7e-23 At3g56660.1 bZIP family transcription factor / similar to Atb... 59 1e-09 At2g40950.1 bZIP family transcription factor / similar to Atb... 55 3e-08 At3g10800.1 bZIP family transcription factor / contains Pfam ... 54 8e-08 At3g17610.1 bZIP family transcription factor / similar to TGA... 50 7e-07 At5g11260.1 bZIP protein HY5 / identical to HY5 protein GI:22... 49 2e-06 >At1g42990.1 bZIP family transcription factor / contains Pfam profile: PF00170: bZIP transcription factor; supported by cDNA: gi_15028322_gb_AY045964.1_ Length = 295 Score = 103 bits (257), Expect = 7e-23 Identities = 66/144 (45%), Positives = 95/144 (65%), Gaps = 13/144 (9%) Frame = +1 Query: 46 EAGASADVDSGRDD---VLEVVTPEAGTV------EVDGDDPISKKKMRQMRNRDSAMKS 198 ++ A+AD DSG+++ V+E + ++G+ E DD ++KK+ R++RNRD+A++S Sbjct: 99 DSPAAAD-DSGKENSDLVVEKKSNDSGSEIHDDDDEEGDDDAVAKKRRRRVRNRDAAVRS 157 Query: 199 RERKKSYIKDLETKSKHLEAECRRLSYALQCYAAENMALRQSLLKDRPLGAP-TATQESA 375 RERKK Y++DLE KSK+LE EC RL L+C+ AEN +LR L K + QESA Sbjct: 158 RERKKEYVQDLEKKSKYLERECLRLGRMLECFVAENQSLRYCLQKGNGNNTTMMSKQESA 217 Query: 376 V-LTETLPLVSLLWL--VSIVCLF 438 V L E+L L SLLWL V+ +CLF Sbjct: 218 VLLLESLLLGSLLWLLGVNFICLF 241 >At3g56660.1 bZIP family transcription factor / similar to AtbZIP transcription factor GI:17065880 from [Arabidopsis thaliana]; contains Pfam profile: PF00170 bZIP transcription factor Length = 620 Score = 59.3 bits (142), Expect = 1e-09 Identities = 30/73 (41%), Positives = 48/73 (65%), Gaps = 1/73 (1%) Frame = +1 Query: 112 AGTVEVDGDDPISKKK-MRQMRNRDSAMKSRERKKSYIKDLETKSKHLEAECRRLSYALQ 288 A ++V G++ KKK +R +RNR+SA SR+RKK Y+++LE K K++ + LS + Sbjct: 160 ASVIKVGGEEDDEKKKNVRLVRNRESAHLSRQRKKHYVEELEDKVKNMHSTISELSSKMS 219 Query: 289 CYAAENMALRQSL 327 + AEN+ LRQ + Sbjct: 220 YFVAENVTLRQQM 232 >At2g40950.1 bZIP family transcription factor / similar to AtbZIP transcription factor GI:17065880 from [Arabidopsis thaliana]; contains Pfam profile: bZIP transcription factor PF00170 Length = 721 Score = 55.1 bits (131), Expect = 3e-08 Identities = 31/86 (36%), Positives = 48/86 (55%) Frame = +1 Query: 70 DSGRDDVLEVVTPEAGTVEVDGDDPISKKKMRQMRNRDSAMKSRERKKSYIKDLETKSKH 249 D R+ +A V G++ KK+ R MRNR+SA SR+RKK Y+++LE K ++ Sbjct: 204 DESRNSKYRRSGEDADASAVTGEED-EKKRARLMRNRESAQLSRQRKKHYVEELEEKVRN 262 Query: 250 LEAECRRLSYALQCYAAENMALRQSL 327 + + L+ + + AEN LRQ L Sbjct: 263 MHSTITDLNGKISYFMAENATLRQQL 288 >At3g10800.1 bZIP family transcription factor / contains Pfam profile: PF00170 bZIP transcription factor; contains similarity to TGACG-sequence specific DNA-binding protein TGA-1B (HSBF) GB:P14233 [Nicotiana tabacum] Length = 675 Score = 53.5 bits (127), Expect = 8e-08 Identities = 30/67 (44%), Positives = 42/67 (61%), Gaps = 1/67 (1%) Frame = +1 Query: 130 DGDDPISKKKM-RQMRNRDSAMKSRERKKSYIKDLETKSKHLEAECRRLSYALQCYAAEN 306 +GDD K+K+ RQ+RNR+SA SR RKK ++LE K K + A L+ + AEN Sbjct: 184 EGDDDDDKRKLIRQIRNRESAQLSRLRKKQQTEELERKVKSMNATIAELNGKIAYVMAEN 243 Query: 307 MALRQSL 327 +ALRQ + Sbjct: 244 VALRQQM 250 >At3g17610.1 bZIP family transcription factor / similar to TGACG-motif binding factor GI:2934884 from [Glycine max]; contains Pfam profile: PF00170 bZIP transcription factor; supported by full-length cDNA: Ceres: 35429. Length = 135 Score = 50.4 bits (119), Expect = 7e-07 Identities = 36/114 (31%), Positives = 56/114 (48%), Gaps = 11/114 (9%) Frame = +1 Query: 34 KGEREAGASADVDSGRDDVLEVVTPEAGTVEVD--------GDDPISKKKM---RQMRNR 180 K + AG++ + S DD V PE + G +P+ K+ R +RNR Sbjct: 18 KHKTAAGSTCVLSSSADD--GVNNPELDQTQNGVSTAKRRRGRNPVDKEYRSLKRLLRNR 75 Query: 181 DSAMKSRERKKSYIKDLETKSKHLEAECRRLSYALQCYAAENMALRQSLLKDRP 342 SA ++RERKK Y+ DLE+++ L+ +L + EN LR+ L+ RP Sbjct: 76 VSAQQARERKKVYVSDLESRANELQNNNDQLEEKISTLTNENTMLRKMLINTRP 129 >At5g11260.1 bZIP protein HY5 / identical to HY5 protein GI:2251085 from [Arabidopsis thaliana] Length = 168 Score = 48.5 bits (114), Expect = 2e-06 Identities = 32/102 (31%), Positives = 49/102 (47%) Frame = +1 Query: 22 GEEAKGEREAGASADVDSGRDDVLEVVTPEAGTVEVDGDDPISKKKMRQMRNRDSAMKSR 201 G EA G+ +G + +G++ V + +K+ R +RNR SA ++R Sbjct: 47 GGEAVGKETSGRESGSATGQERTQATVGESQRKRGRTPAEKENKRLKRLLRNRVSAQQAR 106 Query: 202 ERKKSYIKDLETKSKHLEAECRRLSYALQCYAAENMALRQSL 327 ERKK+Y+ +LE + K LE + L L EN LR L Sbjct: 107 ERKKAYLSELENRVKDLENKNSELEERLSTLQNENQMLRHIL 148 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,692,159 Number of Sequences: 27288 Number of extensions: 447507 Number of successful extensions: 7493 Number of sequences better than 1.0e-05: 12 Number of HSP's better than 0.0 without gapping: 2866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5793 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 904103924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18662057|gb|BM501722.1|BM501722 952035B09.x3 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (583 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g20850.1 putative protein / tripeptidyl-peptidase II, Homo... 155 2e-69 >At4g20850.1 putative protein / tripeptidyl-peptidase II, Homo sapiens, Pir:S54376 Length = 1396 Score = 155 bits (392), Expect(2) = 2e-69 Identities = 67/103 (65%), Positives = 86/103 (83%) Frame = +2 Query: 2 ERRFINVPFGASWAEVTMRTSAFDTPRRFFLDTVQICPLKRPVKWEAVVTFSSPSSKNFS 181 ERR+I VP GA+WAE TMRTS FDT RRF++DT+Q+CPL+RP+KWE+ TF+SPS+K+F Sbjct: 799 ERRYIEVPHGATWAEATMRTSGFDTTRRFYIDTLQVCPLRRPIKWESAPTFASPSAKSFV 858 Query: 182 FPVEGGLTLELSIAQFWSSGIASHEPTCVDFEIVLHGISIDQK 310 FPV G T+EL+IAQFWSSG+ S EPT VDFEI HG+ +D++ Sbjct: 859 FPVVSGQTMELAIAQFWSSGLGSREPTIVDFEIEFHGVGVDKE 901 Score = 124 bits (312), Expect(2) = 2e-69 Identities = 59/87 (67%), Positives = 75/87 (85%), Gaps = 1/87 (1%) Frame = +3 Query: 321 LDG-ESPLLIVARSLLASEKLVPVGTLNKIRIPYRPVECNLSSLPTDRDKLPSGKQIIAL 497 LDG E+P+ + A +LLASEKLVP+ LNKIR+PY+P++ L +L T RD+L SGKQI+AL Sbjct: 905 LDGSEAPIKVEAEALLASEKLVPIAVLNKIRVPYQPIDAQLKTLSTGRDRLLSGKQILAL 964 Query: 498 TLTYKFKLEDNAEIKPHVPLLNNRIYD 578 TLTYKFKLED+AE+KP++PLLNNRIYD Sbjct: 965 TLTYKFKLEDSAEVKPYIPLLNNRIYD 991 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,654,516 Number of Sequences: 27288 Number of extensions: 266193 Number of successful extensions: 652 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 631 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 652 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 886200876 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18661994|gb|BM501687.1|BM501687 952034G11.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (546 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49510.1 von Hippel-Lindau binding protein (VHL binding prote... 281 2e-76 >At5g49510.1 von Hippel-Lindau binding protein (VHL binding protein; VBP) like / ; supported by cDNA: gi_13878182_gb_AF370354.1_AF370354 Length = 195 Score = 281 bits (719), Expect = 2e-76 Identities = 143/179 (79%), Positives = 158/179 (87%), Gaps = 4/179 (2%) Frame = +3 Query: 9 SASTPQG----VAERRGIPAAAFVEDVEAYLRQVGLDVNSALAFLQERLQQYKIVEMKLL 176 S+S+P G + ERRGIPAA F++DVE YL Q GLD NSALAF QERLQQYK+VEMKLL Sbjct: 2 SSSSPSGSGSDLTERRGIPAAKFIQDVETYLSQSGLDPNSALAFHQERLQQYKVVEMKLL 61 Query: 177 AQQRDLQAKIPDIEKCLDIVTTLQAKKDLGEALIADFELSEGIYSRAKIEDTDSVCLWLG 356 AQQRDLQAKIPDIEKCL++V TL+AKK GEAL+ADFE+SEGIYSRA IEDTDSVCLWLG Sbjct: 62 AQQRDLQAKIPDIEKCLEVVATLEAKKGTGEALLADFEVSEGIYSRACIEDTDSVCLWLG 121 Query: 357 ANVMLEYSCDEANALLKKNLENAKASLEVLVADLHFLRDQQTITQVTXARVFNWDVHHR 533 ANVMLEYSC+EA+ALLK NLENAKASLEVLVADL FLRDQ T+TQVT ARV+NWDVH R Sbjct: 122 ANVMLEYSCEEASALLKNNLENAKASLEVLVADLQFLRDQVTVTQVTIARVYNWDVHQR 180 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,127,495 Number of Sequences: 27288 Number of extensions: 307028 Number of successful extensions: 2143 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2056 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 790135456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18661819|gb|BM501595.1|BM501595 952033C11.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (708 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54440.1 unknown protein / ; supported by cDNA: gi_20259378 352 8e-98 >At5g54440.1 unknown protein / ; supported by cDNA: gi_20259378 Length = 829 Score = 352 bits (904), Expect = 8e-98 Identities = 170/230 (73%), Positives = 204/230 (87%) Frame = +2 Query: 17 SYEKVCALYSAEGWEELLADVLPDLAECQKILNDEAGYLASCVKLLSLDSGLFSSKERQG 196 SYEKVCALY+ EGW++LLA+VLP+LA+CQKIL+D+AGY++SCV+LLSLD GLFSSKERQ Sbjct: 181 SYEKVCALYAGEGWQDLLAEVLPNLAQCQKILDDQAGYMSSCVRLLSLDKGLFSSKERQA 240 Query: 197 FQSEVVRLAHSEMKHLVPLDVSSLITFAGNAGPPLELCDGDPGTLSVAVWNGFPDDITLE 376 FQSEVV LAHSEMK+ VPLDVSSLITF+GN GPPL+LCDGDPG LSV VW+GFPDDITL+ Sbjct: 241 FQSEVVTLAHSEMKNPVPLDVSSLITFSGNTGPPLQLCDGDPGNLSVTVWSGFPDDITLD 300 Query: 377 SLSLRLSASSSADEGIKAIKSSDSHVLVPGRNIISFDIPRQKPGSYVLGALTGQIGKLSF 556 SLSL L A+++ DEG +A+KSS + VL PGRN I+F +P QKPGSYVLG +TGQIG+L F Sbjct: 301 SLSLTLVATNNTDEGGQALKSSAATVLNPGRNTITFALPPQKPGSYVLGVVTGQIGRLRF 360 Query: 557 RSHGFSQDGPVETDEFMSFEKPTRPVLKVRKPRALVDITPAVSSALLMNE 706 RSH FS+ GP ++D+FMS+EKPTRP+LKV KPRALVD+ AVSSALL+NE Sbjct: 361 RSHSFSKGGPADSDDFMSYEKPTRPILKVSKPRALVDLAAAVSSALLINE 410 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,553,903 Number of Sequences: 27288 Number of extensions: 337357 Number of successful extensions: 1011 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1010 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1236675772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18661770|gb|BM501570.1|BM501570 952033A03.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (573 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58100.1 putative protein / 163 5e-41 >At5g58100.1 putative protein / Length = 945 Score = 163 bits (413), Expect = 5e-41 Identities = 79/137 (57%), Positives = 101/137 (73%) Frame = +1 Query: 160 LLLLLLQAPSPEAAESTPGTRTRKIGSSGASSVFSLFNLKDKSKFWTESIIRKEFDDLEG 339 + + +L PS S +T K SSVFSLFNL+DKS+FW+ES+ R +FDDLE Sbjct: 18 ICVAILFIPSLSYGASQGNRKTAK------SSVFSLFNLRDKSRFWSESVFRTDFDDLES 71 Query: 340 SASRDSSKNGLLNFTRAGNIANYLSLAEVDSIYLPIPVNFIFIGFDGNGRHEFKLGPEEL 519 S S +G+LN+T++GNIA+YL L EVDS+YLP+PVNFIFIGF+G G +FKL PEEL Sbjct: 72 SVH---SNSGVLNYTKSGNIASYLELMEVDSVYLPVPVNFIFIGFEGKGNQDFKLRPEEL 128 Query: 520 ERWFTKIDHIFEHTRIP 570 ERWF K+DH+FEHTR+P Sbjct: 129 ERWFNKLDHMFEHTRVP 145 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,359,668 Number of Sequences: 27288 Number of extensions: 362428 Number of successful extensions: 1966 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1929 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 859346304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18661628|gb|BM501498.1|BM501498 PAC000000001390 Pioneer AF-1 array Zea mays cDNA, mRNA sequence (429 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g10180.1 Deetiolated1 (DET1) light signal transduction protei... 115 1e-26 >At4g10180.1 Deetiolated1 (DET1) light signal transduction protein / Length = 541 Score = 115 bits (287), Expect = 1e-26 Identities = 62/128 (48%), Positives = 89/128 (69%), Gaps = 4/128 (3%) Frame = +1 Query: 1 QNSSEDIYALFEQFYDHFHANPQASSHGKFISSHSNDIHALDQLRVIKNKASSSSQFVKK 180 QNS+ED+Y LFEQF DHF + ++ F++SHSN+++AL+QL+ KNK++S SQFVKK Sbjct: 376 QNSAEDLYQLFEQFSDHFTVS-SSTPFMNFVTSHSNNVYALEQLKYTKNKSNSFSQFVKK 434 Query: 181 MMTSLPYTCQSQSPSPYFDLSLFRYG*EAGFQQLIGIG----IGTEHPIKFMSSGGQNVV 348 M+ SLP++CQSQSPSPYFD SLFR+ ++LI +++PIKF+S + Sbjct: 435 MLLSLPFSCQSQSPSPYFDQSLFRFD-----EKLISAADRHRQSSDNPIKFISRRQPQTL 489 Query: 349 QI*RXKPG 372 + + KPG Sbjct: 490 KF-KIKPG 496 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,104,420 Number of Sequences: 27288 Number of extensions: 215121 Number of successful extensions: 543 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 541 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 481662092 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18661405|gb|BM501260.1|BM501260 PAC000000000685 Pioneer AF-1 array Zea mays cDNA, mRNA sequence (435 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60590.1 putative protein / various predicted proteins fro... 112 6e-26 >At5g60590.1 putative protein / various predicted proteins from prokaryotic and eukaryotic species; supported by cDNA: gi_14190378_gb_AF378867.1_AF378867 Length = 164 Score = 112 bits (281), Expect = 6e-26 Identities = 54/69 (78%), Positives = 58/69 (83%) Frame = +1 Query: 4 DTIYGFACDACSAGAVNRIYEIKGRIQTRPLAICVGDVSDISRFALVDHLPHGLLDSLLP 183 DT+YGFACDACS AV+RIYEIKGR T PLAICVGDV DI R A HLPHGLLDSLLP Sbjct: 94 DTLYGFACDACSLEAVSRIYEIKGRKLTSPLAICVGDVLDIKRVATTSHLPHGLLDSLLP 153 Query: 184 GPVTIVLKR 210 GPVT+VL+R Sbjct: 154 GPVTLVLQR 162 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,369,875 Number of Sequences: 27288 Number of extensions: 220031 Number of successful extensions: 570 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 570 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 489276504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18661210|gb|BM501290.1|BM501290 PAC000000001019 Pioneer AF-1 array Zea mays cDNA, mRNA sequence (464 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g16440.1 LET1 like protein / 196 5e-51 >At4g16440.1 LET1 like protein / Length = 451 Score = 196 bits (498), Expect = 5e-51 Identities = 97/155 (62%), Positives = 120/155 (76%), Gaps = 6/155 (3%) Frame = +1 Query: 1 LSLIEACNEFVSRYQKNHSCSGQEAGANLPMISSACPGWICYAEKTLGSYILPYISSVKS 180 L LIE+CNEFVSRY++ +S G+ + + LP++SSACPGWICYAEK LGSY+LPY+SSVKS Sbjct: 119 LVLIESCNEFVSRYKQANSDDGENSQSPLPVLSSACPGWICYAEKQLGSYVLPYVSSVKS 178 Query: 181 PQQAIGAAIKHHVVDKLGLKPYDVYHVTVMPCYDKKLEAVRDDFTFSVDGKE------VK 342 PQQAIGAAIKHH+ LGL+ ++VYHVTVMPCYDKKLEA RDDF F DG + + Sbjct: 179 PQQAIGAAIKHHLCQALGLRLHEVYHVTVMPCYDKKLEAARDDFVFD-DGTQDNGDLKLT 237 Query: 343 EVDSVLTTGEVLDLIQSKSTXSRQ*RNPSLDRIVT 447 EVDSVLTTGE++DLI+ K + LDR++T Sbjct: 238 EVDSVLTTGEIMDLIKLKGVDFKDLEESPLDRVLT 272 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,971,093 Number of Sequences: 27288 Number of extensions: 201347 Number of successful extensions: 488 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 486 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 569103444 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18661200|gb|BM501285.1|BM501285 PAC000000001092 Pioneer AF-1 array Zea mays cDNA, mRNA sequence (390 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67320.1 expressed protein / contains similarity to DNA pr... 169 4e-43 >At1g67320.1 expressed protein / contains similarity to DNA primase large subunit GI:172234 from [Saccharomyces cerevisiae]; supported by full-length cDNA: Ceres: 116252. Length = 454 Score = 169 bits (428), Expect = 4e-43 Identities = 85/129 (65%), Positives = 109/129 (83%), Gaps = 1/129 (0%) Frame = +3 Query: 3 HFVLRLVYCRTEELRKWFLSMETTLFRYRFRLESPETQRMLMTEFQLPYKALPYSEFEAV 182 HFVLRLVYCR++EL+KWFLSMET LFR+RFRL+ E QR ++ EF LPYKA+ +E E++ Sbjct: 92 HFVLRLVYCRSDELKKWFLSMETALFRHRFRLKKIEEQRAIVGEFGLPYKAVIGAELESL 151 Query: 183 KDKLSQVARSIGQ-SASVEHVFFKVPFEEVPDLVAGRRVFLSKGYAYVAMSQVVSLVVTQ 359 K++L VARS GQ S+ VE++++KVPFEEVPDLVA RRV L KG+A+VA +Q+VSLVVTQ Sbjct: 152 KERLGLVARSHGQISSDVENIYYKVPFEEVPDLVASRRVLLQKGFAFVAGTQLVSLVVTQ 211 Query: 360 FRCNISKAL 386 FR ++SKAL Sbjct: 212 FRSHLSKAL 220 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,523,376 Number of Sequences: 27288 Number of extensions: 170077 Number of successful extensions: 515 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 373725332 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18660821|gb|BM501066.1|BM501066 PAC000000000940 Pioneer AF-1 array Zea mays cDNA, mRNA sequence (467 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g12370.1 expressed protein / ; supported by cDNA: gi_14334... 83 6e-17 >At1g12370.1 expressed protein / ; supported by cDNA: gi_14334575_gb_AY034961.1_ Length = 490 Score = 83.2 bits (204), Expect = 6e-17 Identities = 38/79 (48%), Positives = 54/79 (68%), Gaps = 2/79 (2%) Frame = +1 Query: 1 VNKVINEYLVEYPEV-PQWAPWC-MEQPKSVDWDALINSIFSEAENVPEINWCEPGESSA 174 +NK++ +YL+E+P++ P W M K VDWD+LI+ + E VPEI WC PGE + Sbjct: 178 INKLLPDYLIEFPKLEPPKKKWTGMMDKKLVDWDSLIDKVVREGAEVPEIEWCVPGEDAG 237 Query: 175 MEVLLGSKDXVLTKKXKNY 231 +EVL+G+KD LTK+ KNY Sbjct: 238 IEVLMGNKDGFLTKRLKNY 256 Score = 48.9 bits (115), Expect = 1e-06 Identities = 30/86 (34%), Positives = 44/86 (50%) Frame = +2 Query: 188 LGVRXGS*RRRXRTMTLGRNYSTKPHCIXXXSPTXTFWAHFCTKVCS*KQKNAVNLSPKS 367 +G + G +R + + RN KP + SP F + C+ + + + SP++ Sbjct: 242 MGNKDGFLTKRLKNYSTDRNNPIKPKALSGLSPYLHF-GQVSAQRCALEARKVRSTSPQA 300 Query: 368 VDTFLXELIIRRELS*QFGNTQLHND 445 VDTFL ELI+RRELS F Q H D Sbjct: 301 VDTFLEELIVRRELSDNFCYYQPHYD 326 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,890,994 Number of Sequences: 27288 Number of extensions: 186651 Number of successful extensions: 565 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 532 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 557 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 578136832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18660609|gb|BM500954.1|BM500954 PAC000000000805 Pioneer AF-1 array Zea mays cDNA, mRNA sequence (419 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41010.1 putative protein / contains similarity to metallo... 99 8e-22 At1g53690.1 RNA polymerase II, putative / similar to GI:71718... 70 3e-13 >At5g41010.1 putative protein / contains similarity to metallothionein-I gene transcription activator; supported by cDNA: gi_19310614 Length = 51 Score = 99.0 bits (245), Expect = 8e-22 Identities = 45/52 (86%), Positives = 48/52 (91%) Frame = +1 Query: 70 MDPQQPEPVSYLCGDCGAENTLKPGDVIQCRECGYRILYKKRTRRIVQYEAR 225 MDP PEPV+Y+CGDCG ENTLK GDVIQCRECGYRILYKKRTRR+VQYEAR Sbjct: 1 MDPA-PEPVTYVCGDCGQENTLKSGDVIQCRECGYRILYKKRTRRVVQYEAR 51 >At1g53690.1 RNA polymerase II, putative / similar to GI:717186 from [Homo sapiens] (Mol. Cell. Biol. 15 (9), 4702-4710 (1995)) Length = 61 Score = 70.5 bits (171), Expect = 3e-13 Identities = 32/48 (66%), Positives = 38/48 (78%), Gaps = 1/48 (2%) Frame = +1 Query: 55 LERSTMDPQQPEP-VSYLCGDCGAENTLKPGDVIQCRECGYRILYKKR 195 L++S D +QPE V Y+CGDCG EN LK GDV QCR+CG+RILYKKR Sbjct: 3 LQQSETDDKQPEQLVIYVCGDCGQENILKRGDVFQCRDCGFRILYKKR 50 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,508,143 Number of Sequences: 27288 Number of extensions: 204850 Number of successful extensions: 579 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 454398200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18660581|gb|BM500939.1|BM500939 PAC000000001329 Pioneer AF-1 array Zea mays cDNA, mRNA sequence (362 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g33410.1 unknown protein / 86 4e-18 >At1g33410.1 unknown protein / Length = 1459 Score = 85.5 bits (210), Expect = 4e-18 Identities = 39/72 (54%), Positives = 54/72 (74%) Frame = +2 Query: 5 ASSRPVDVLHRKKMSAVWXPYTAVERLWCQLGEMQRAGHSVDQCDRLKKLLHGALMSHLQ 184 ASS+P +VL RKK+S VW PYT VERLW +L + +G V+QC +LK+ LH AL++HL+ Sbjct: 1385 ASSKPAEVLKRKKVSGVWFPYTTVERLWWELEKTMNSGRMVEQCHKLKEQLHHALLNHLK 1444 Query: 185 QVVVDSDDVLSS 220 + VDS+D +SS Sbjct: 1445 LLKVDSNDAVSS 1456 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,623,425 Number of Sequences: 27288 Number of extensions: 221433 Number of successful extensions: 797 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 760 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 796 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 213526752 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18660419|gb|BM500851.1|BM500851 PAC000000000890 Pioneer AF-1 array Zea mays cDNA, mRNA sequence (424 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g16970.1 expressed protein / ; supported by cDNA: gi_12006... 180 2e-46 >At1g16970.1 expressed protein / ; supported by cDNA: gi_12006423_gb_AF283759.1_AF283759 Length = 621 Score = 180 bits (457), Expect = 2e-46 Identities = 83/132 (62%), Positives = 106/132 (79%) Frame = +2 Query: 14 IEVNTYALVRPTTTGTITWLDSLSNLPLKVERSFICNDTGALLQDXQTRFQMYNDTIVKF 193 IE+N YAL+RP G+ITWLDS +NLP+KVERS+IC DTGA++QD R Q Y + + F Sbjct: 280 IELNGYALLRPAIPGSITWLDSTTNLPVKVERSYICTDTGAIMQDPIQRIQPYKNQNIMF 339 Query: 194 SVRELSEVKRVASHHLRLIGFKPLDCLKDYHNLRPSTFIYPSDERIFGSTCVFXALHSSM 373 +V ELS+VKR+++ HLRL+GFKPL CLKDYHNL+PSTF+YPSD+ + GST F ALH SM Sbjct: 340 TVEELSQVKRISTGHLRLLGFKPLSCLKDYHNLKPSTFLYPSDKEVIGSTRAFIALHRSM 399 Query: 374 LRLGRXALAFYG 409 ++L R A+AFYG Sbjct: 400 IQLERFAVAFYG 411 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,040,695 Number of Sequences: 27288 Number of extensions: 172771 Number of successful extensions: 418 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 463486164 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18659892|gb|BM500577.1|BM500577 PAC000000001211 Pioneer AF-1 array Zea mays cDNA, mRNA sequence (461 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g18640.1 3-phosphoserine phosphatase / identical to 3-phos... 218 9e-58 >At1g18640.1 3-phosphoserine phosphatase / identical to 3-phosphoserine phosphatase GI:3759177 from [Arabidopsis thaliana];supported by full-length cDNA: Ceres:34821. Length = 295 Score = 218 bits (556), Expect = 9e-58 Identities = 106/146 (72%), Positives = 123/146 (83%) Frame = +1 Query: 1 LEKRPPRISPGMADLVKKLKSNNIDVFLVSGGFRQMIKPVAFELGIPPENITANQLLFGT 180 L+KRPPR+SPG+ +LVKKL++NNIDV+L+SGGFRQMI PVA LGIP ENI AN LLFG Sbjct: 149 LDKRPPRLSPGIEELVKKLRANNIDVYLISGGFRQMINPVASILGIPRENIFANNLLFGN 208 Query: 181 LGEYARFDPTEPTSRSGGKAKAVQQIKQDHGYKTVVMIGDGATDLEARQPGGADLFICYA 360 GE+ FD EPTSRSGGKAKAVQQI++ YKT+ MIGDGATDLEAR+PGGADLFICYA Sbjct: 209 SGEFLGFDENEPTSRSGGKAKAVQQIRKGRLYKTMAMIGDGATDLEARKPGGADLFICYA 268 Query: 361 GVQMREPVAAQADWVVFDFQELITKL 438 GVQ+RE VAA ADW++F F+ LI L Sbjct: 269 GVQLREAVAANADWLIFKFESLINSL 294 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,253,747 Number of Sequences: 27288 Number of extensions: 250125 Number of successful extensions: 687 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 668 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 687 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 560070056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18659878|gb|BM500569.1|BM500569 PAC000000001202 Pioneer AF-1 array Zea mays cDNA, mRNA sequence (447 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41880.1 DNA polymerase alpha subunit IV (primase)-like prote... 185 8e-48 >At5g41880.1 DNA polymerase alpha subunit IV (primase)-like protein / Length = 407 Score = 185 bits (470), Expect = 8e-48 Identities = 86/150 (57%), Positives = 115/150 (76%), Gaps = 1/150 (0%) Frame = +1 Query: 1 HCWVCDSRARKLSNEQRAAIADYFRVYKGGENALKKVSLAGPVLHPFLARSYMDVLKTFF 180 HCWVCD++AR+L+NEQR+A+A+YFRVYKG EN KKV L G LHPFLARSY+D +K+FF Sbjct: 176 HCWVCDAKARRLTNEQRSAVAEYFRVYKGNENNAKKVDLMGHSLHPFLARSYVDFIKSFF 235 Query: 181 EDRLLLNQQLFASEERCRKILDLIPDESVASEVHDKWQGNRRSSISKEDVNATRWEQLKM 360 E L Q +F+S+E+ KIL +I DE + +++ KW+ + RSS+S+E + RWEQLK Sbjct: 236 EGELQATQSIFSSKEKYEKILGMITDEDIQADLRGKWENSARSSLSEEATSLLRWEQLKK 295 Query: 361 TLQSGK-KAQGLRRCVEEIVFSYTYPRLDM 447 LQS + KA LR CVEEIVF++TYPR+D+ Sbjct: 296 ALQSKRNKALSLRTCVEEIVFTFTYPRIDL 325 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,983,596 Number of Sequences: 27288 Number of extensions: 208993 Number of successful extensions: 669 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 525519208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18659719|gb|BM500487.1|BM500487 PAC000000000818 Pioneer AF-1 array Zea mays cDNA, mRNA sequence (394 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g25070.1 putative protein / ; supported by cDNA: gi_20466... 110 3e-25 >At5g25070.1 putative protein / ; supported by cDNA: gi_20466599 Length = 736 Score = 110 bits (274), Expect = 3e-25 Identities = 59/121 (48%), Positives = 84/121 (68%) Frame = +2 Query: 14 IQMQRQKITDARSTLQEVSSRRTSIQQETEALKQKLSFIDKRGPELEAEKKVAAASRNFK 193 +Q +++++ R L+E SS+++ IQQ + K+ FI+KR PELEAEKKVAA++RNFK Sbjct: 526 VQKLQEEVSSTRELLKERSSKKSIIQQNITSFMDKIMFIEKRMPELEAEKKVAASTRNFK 585 Query: 194 EAGRIAAEAKALNSEKDELYGKLEKAATDLETIEKDIVATTNKIQECEGLIELKGRESAL 373 EAGRIAAEAK+LN EKD+ + KA +LE E +I T ++QE E LI K +E A+ Sbjct: 586 EAGRIAAEAKSLNLEKDKTQMETGKANAELEKAEHEIEETIKRLQEIEKLILSKEKELAI 645 Query: 374 T 376 + Sbjct: 646 S 646 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,756,633 Number of Sequences: 27288 Number of extensions: 146262 Number of successful extensions: 686 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 681 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 382840584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18659711|gb|BM500483.1|BM500483 PAC000000000820 Pioneer AF-1 array Zea mays cDNA, mRNA sequence (400 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15770.1 acetyltransferase-like protein / Glucosamine-6-ph... 77 2e-18 At4g18670.1 extensin-like protein / extensin-like protein - m... 45 9e-06 >At5g15770.1 acetyltransferase-like protein / Glucosamine-6-phosphate acetyltransferase EMeg32 protein - Mus musculus, EMBL:AJ001006 Length = 149 Score = 77.0 bits (188), Expect(2) = 2e-18 Identities = 38/84 (45%), Positives = 54/84 (64%) Frame = +1 Query: 88 DTIHIRRLECSDHERGFVALLSQLSPCPDLTTSVFATRFAELAAQGDDHIILVAEDPSAS 267 +T IR+LE SD +GF+ LL QL+ +T F RF E+ + GDDH+I V E+ ++ Sbjct: 3 ETFKIRKLEISDKRKGFIELLGQLTVTGSVTDEEFDRRFEEIRSYGDDHVICVIEEETSG 62 Query: 268 DRRILATGCLFVERKFLRGCGKWG 339 +I ATG + +E+KFLR CGK G Sbjct: 63 --KIAATGSVMIEKKFLRNCGKAG 84 Score = 31.2 bits (69), Expect(2) = 2e-18 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = +3 Query: 330 QVGHVEDVVVDAAARGRGLGLRI 398 + GH+EDVVVD+ RG+ LG ++ Sbjct: 82 KAGHIEDVVVDSRFRGKQLGKKV 104 >At4g18670.1 extensin-like protein / extensin-like protein - maize, PIR2:S49915 Length = 839 Score = 45.4 bits (106), Expect = 9e-06 Identities = 33/88 (37%), Positives = 41/88 (46%), Gaps = 7/88 (7%) Frame = +2 Query: 38 PKWHPPRRNPPPPTKLSTPSTSVA*SVPTTRGA--SSPFSPSSPPARTSPHPCSPRASPS 211 P PP P S PS S++ S P T + S+P SP SPP+ +SP P SP SP Sbjct: 503 PGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPP 562 Query: 212 SRRRATTTSSSWPRTP-----PPRTGGS 280 + T S +P PP TG S Sbjct: 563 TPSTPPTPISPGQNSPPIIPSPPFTGPS 590 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,716,314 Number of Sequences: 27288 Number of extensions: 338966 Number of successful extensions: 4626 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 2098 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3492 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 401071088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18659611|gb|BM500428.1|BM500428 PAC000000000918 Pioneer AF-1 array Zea mays cDNA, mRNA sequence (461 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13690.1 alpha-N-acetylglucosaminidase / ; supported by c... 248 1e-66 >At5g13690.1 alpha-N-acetylglucosaminidase / ; supported by cDNA: gi_19423947 Length = 806 Score = 248 bits (632), Expect = 1e-66 Identities = 105/153 (68%), Positives = 129/153 (83%) Frame = -3 Query: 459 GSLPRVPDGGVLIQRPIDWSYSQNAVTSSYSLAWWDWDRWEKEIDWMALQGINLPLAFTG 280 G LPR+ + I+RP+ W+Y QN VTSSYS WW W+RWE+EIDWMALQGINLPLAFTG Sbjct: 138 GHLPRIDSKRIFIRRPVPWNYYQNVVTSSYSYVWWGWERWEREIDWMALQGINLPLAFTG 197 Query: 279 QESIWQRIFQRYNISKSDLDDFFGGPAFLAWSRMANMHGWGGPLPQTWLDDQLVLQKKIL 100 QE+IWQ++F+R+NISK DLDD+FGGPAFLAW+RM N+H WGGPL + WLDDQL+LQK+IL Sbjct: 198 QEAIWQKVFKRFNISKEDLDDYFGGPAFLAWARMGNLHAWGGPLSKNWLDDQLLLQKQIL 257 Query: 99 SRMYSFGMFPVLPAFSGNIPAALKSKFPSAKVT 1 SRM FGM PVLP+FSGN+P+AL+ +P A +T Sbjct: 258 SRMLKFGMTPVLPSFSGNVPSALRKIYPEANIT 290 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,785,267 Number of Sequences: 27288 Number of extensions: 283573 Number of successful extensions: 893 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 832 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 893 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 560070056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18659594|gb|BM500419.1|BM500419 PAC000000000906 Pioneer AF-1 array Zea mays cDNA, mRNA sequence (457 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g72050.1 C2H2-type zinc finger protein, putative / contain... 86 7e-18 At3g48430.1 similar to zinc finger protein - like / temporary... 49 1e-06 >At1g72050.1 C2H2-type zinc finger protein, putative / contains multiple zinc finger domains: PF00096: Zinc finger, C2H2 type; supported by cDNA: gi_15809914_gb_AY054225.1_ Length = 324 Score = 86.3 bits (212), Expect = 7e-18 Identities = 52/169 (30%), Positives = 76/169 (44%), Gaps = 55/169 (32%) Frame = +1 Query: 94 KRPFSCTVDGCPFSYSRKDHLNRHLLTHEGKLFVCPVEGCGRKFNIKGNMQRHVQEIHK- 270 +R F+C VD C SY RKDHLNRHLLTH+GKLF CP E C +F+++GN+ RHV++ H Sbjct: 3 ERSFTCYVDDCAASYRRKDHLNRHLLTHKGKLFKCPKENCKSEFSVQGNVGRHVKKYHSN 62 Query: 271 ---------------------------------------------------DVPPCE--- 288 D P E Sbjct: 63 DNRDKDNTGLGDGDKDNTCKGDDDKEKSGSGGCEKENEGNGGSGKDNNGNGDSQPAECST 122 Query: 289 SKKEFICPKVNCGEGFQICF*VKEA*RITCXAGNTPEVMCCEPGCMKSF 435 +K+ +C ++ CG+ F+ +++ + + ++ E C EPGCMK F Sbjct: 123 GQKQVVCKEIGCGKAFKYPSQLQKH-QDSHVKLDSVEAFCSEPGCMKYF 170 Score = 46.2 bits (108), Expect = 8e-06 Identities = 24/69 (34%), Positives = 37/69 (52%), Gaps = 5/69 (7%) Frame = +1 Query: 145 KDHLNRHLLTHE-----GKLFVCPVEGCGRKFNIKGNMQRHVQEIHKDVPPCESKKEFIC 309 K ++ RHL TH+ G++ C VEGC F+ N+Q+H++ +H D+ P F+C Sbjct: 198 KKNIKRHLRTHDEDSSPGEI-KCEVEGCSSTFSKASNLQKHMKAVHDDIRP------FVC 250 Query: 310 PKVNCGEGF 336 CG F Sbjct: 251 GFPGCGMRF 259 >At3g48430.1 similar to zinc finger protein - like / temporary automated functional assignment Length = 1354 Score = 48.9 bits (115), Expect = 1e-06 Identities = 33/112 (29%), Positives = 51/112 (45%) Frame = +1 Query: 103 FSCTVDGCPFSYSRKDHLNRHLLTHEGKLFVCPVEGCGRKFNIKGNMQRHVQEIHKDVPP 282 + C ++GC S+S + L H K +CP++GCG+ F + +H Q +H D P Sbjct: 1237 YQCNMEGCTMSFSSEKQLMLH------KRNICPIKGCGKNFFSHKYLVQH-QRVHSDDRP 1289 Query: 283 CESKKEFICPKVNCGEGFQICF*VKEA*RITCXAGNTPEVMCCEPGCMKSFQ 438 + CP C F+ + E I G P V C EP C ++F+ Sbjct: 1290 LK------CPWKGCKMTFKWAWSRTE--HIRVHTGARPYV-CAEPDCGQTFR 1332 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,478,886 Number of Sequences: 27288 Number of extensions: 225413 Number of successful extensions: 480 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 475 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 552701236 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18659504|gb|BM500373.1|BM500373 PAC000000000489 Pioneer AF-1 array Zea mays cDNA, mRNA sequence (457 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g48850.1 chorismate synthase, putative / similar to choris... 205 1e-58 >At1g48850.1 chorismate synthase, putative / similar to chorismate synthase GI:452796 from [Synechocystis sp.]; supported by cDNA: gi_15982823_gb_AY057519.1_ Length = 436 Score = 205 bits (521), Expect(2) = 1e-58 Identities = 98/125 (78%), Positives = 109/125 (86%) Frame = +3 Query: 6 IESNIVRCPDPEYAEKMIAAIDTVRVRGDSIGGVVTCIARNVPRGLGSPVFDKLEAELAK 185 IE+NIVRCP+PEYAEKMIAAID VR +G+S+GGVVTCI RN PRGLG+PVFDKLEAELAK Sbjct: 229 IENNIVRCPNPEYAEKMIAAIDAVRTKGNSVGGVVTCIVRNAPRGLGTPVFDKLEAELAK 288 Query: 186 AMLSLPASKGFEIGSGFAGTDFTGSEHNDEFYMDEAGNVRTRTNRSGGVQGGISNGEIIY 365 A +SLPA+KGFE GSGFAGT TG EHNDEFY DE G +RTRTNRSGG+QGGISNGEII Sbjct: 289 ACMSLPATKGFEFGSGFAGTFLTGLEHNDEFYTDENGRIRTRTNRSGGIQGGISNGEIIN 348 Query: 366 FQSGF 380 + F Sbjct: 349 MRVAF 353 Score = 38.1 bits (87), Expect(2) = 1e-58 Identities = 16/34 (47%), Positives = 25/34 (73%) Frame = +1 Query: 355 KLFTSKVAFKPTATIXKKPNTVSREHEDVELXAR 456 ++ +VAFKPT+TI +K NTV+R+ + E+ AR Sbjct: 345 EIINMRVAFKPTSTIGRKQNTVTRDKVETEMIAR 378 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,565,994 Number of Sequences: 27288 Number of extensions: 237193 Number of successful extensions: 816 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 815 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 552701236 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18659090|gb|BM500149.1|BM500149 PAC000000000269 Pioneer AF-1 array Zea mays cDNA, mRNA sequence (423 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g12200.1 dihydropyrimidinase / ; supported by cDNA: gi_13... 163 3e-41 >At5g12200.1 dihydropyrimidinase / ; supported by cDNA: gi_13878036_gb_AF370281.1_AF370281 Length = 248 Score = 163 bits (413), Expect = 3e-41 Identities = 77/90 (85%), Positives = 83/90 (91%) Frame = +1 Query: 154 MSIDAMDEIAKAKREGQRVIGEPVVSGLVLDDSWLWDPDFTIASKYVMSPPIREAGHGKA 333 MS+DAMDEIAKA++ GQ+VIGEPVVSGL+LDD WLWDPDFTIASKYVMSPPIR GHGKA Sbjct: 1 MSVDAMDEIAKARKSGQKVIGEPVVSGLILDDHWLWDPDFTIASKYVMSPPIRPVGHGKA 60 Query: 334 LQAALSSGILQLVGTDHCTFNSTQKAFGSD 423 LQ ALS+GILQLVGTDHCTFNSTQKA G D Sbjct: 61 LQDALSTGILQLVGTDHCTFNSTQKALGLD 90 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,469,912 Number of Sequences: 27288 Number of extensions: 190105 Number of successful extensions: 530 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 529 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 463486164 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18655245|gb|BM500050.1|BM500050 952036D04.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (501 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09180.1 expressed protein / ; supported by full-length cD... 217 3e-57 >At3g09180.1 expressed protein / ; supported by full-length cDNA: Ceres: 119803. Length = 402 Score = 217 bits (552), Expect = 3e-57 Identities = 108/149 (72%), Positives = 125/149 (83%) Frame = +1 Query: 52 DAPPKQVAQAMERLGRAGRLIADIRLGADRLLEALFVSGDAPPYSVRQHVDRMEHIIXKE 231 DAPPKQVAQAMERL +A R+IADIRLGADR+LEA+FV+ S +H D + +E Sbjct: 24 DAPPKQVAQAMERLNQAARVIADIRLGADRILEAMFVA------SQPRHTDMPLQLFLRE 77 Query: 232 DAAMRLHFQDLRALGRQLEESGVLNGALKARGNLWGLHMPLVCPDGAVVAYAWKRQLAGQ 411 DA+MR H QDLR +G++LEESGVL +L++R N WGLHMPLVCPDGAVVAYAWKRQLAGQ Sbjct: 78 DASMRQHLQDLRLIGKKLEESGVLTESLRSRSNSWGLHMPLVCPDGAVVAYAWKRQLAGQ 137 Query: 412 AGASAVDRTRLALKAFTDQKRRFFPHLED 498 AGASAVDRTRLALKAFTDQKRRFFPH++D Sbjct: 138 AGASAVDRTRLALKAFTDQKRRFFPHIDD 166 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,656,572 Number of Sequences: 27288 Number of extensions: 314372 Number of successful extensions: 2796 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2606 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 666451400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18655202|gb|BM500007.1|BM500007 952036A04.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (519 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g16860.1 Expressed protein / ; supported by full-length cD... 251 2e-67 >At2g16860.1 Expressed protein / ; supported by full-length cDNA: Ceres: 34622. ; supported by cDNA: gi_20466269 Length = 298 Score = 251 bits (641), Expect = 2e-67 Identities = 119/170 (70%), Positives = 141/170 (82%) Frame = -1 Query: 519 ELRLKMNEARKASQQAMVAEKKRMEPRGESRGVSKQKWLADRKKKIGKLLDSNGLDMKMA 340 ELRLKMNEARK++Q + +EKK+ME E++G+SKQKWL RKKKIGKLLD+NGLDM A Sbjct: 92 ELRLKMNEARKSNQTDVGSEKKKMEAPTETKGISKQKWLEGRKKKIGKLLDANGLDMTQA 151 Query: 339 YMLDTQEXAEAKYKKWEKEPAPYGWDVFNQKTLYDAYKKRTKNIEVDMESYNKAKEADPE 160 YMLDTQE AE+KYKKWEKEP P GWDVFNQKTLY+AYKKRTKNI+VD+E YN+ + ADPE Sbjct: 152 YMLDTQEAAESKYKKWEKEPTPAGWDVFNQKTLYNAYKKRTKNIQVDLEEYNRMRAADPE 211 Query: 159 FYRNASSLQYGKVSNVPEENIDKMVKELREREEKRKSFSRRRKFNEARTL 10 FYR ASSLQYGK ++ IDKM KEL +RE+KR+ FSRRRKF E + + Sbjct: 212 FYREASSLQYGKAPKTSQDKIDKMAKELLDREQKRQEFSRRRKFREEKDI 261 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,721,087 Number of Sequences: 27288 Number of extensions: 309511 Number of successful extensions: 1355 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1298 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1352 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 720488000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18655109|gb|BM499914.1|BM499914 952035E06.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (532 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20410.1 expressed protein / ;supported by full-length cDN... 253 2e-69 >At2g20410.1 expressed protein / ;supported by full-length cDNA: Ceres:13277. Length = 339 Score = 253 bits (646), Expect(2) = 2e-69 Identities = 114/153 (74%), Positives = 131/153 (85%) Frame = +1 Query: 73 HGIKRVEGRSWPSPITGRLWIHAASKVPDPDTIKAMEDFYREIYAVDGITGIKFPDHYPV 252 HGIKR+EGRSWPSPI GRLWIHAASKVPD TIKAME+FY++IYAVDGIT I+FP HYPV Sbjct: 23 HGIKRIEGRSWPSPIRGRLWIHAASKVPDEATIKAMEEFYQQIYAVDGITDIQFPQHYPV 82 Query: 253 SRLLGCVEVVGCLRSEELVCWEHVPESVRLEGLTDFXWLCENPQKLVVPFEMRGYQGVYN 432 SRL+GCVEVVGC+ S+EL W+ +P+ VRLEG T+F WLCE PQKL++PFEMRGYQGVYN Sbjct: 83 SRLIGCVEVVGCVTSDELQNWDALPQGVRLEGQTNFCWLCEKPQKLIIPFEMRGYQGVYN 142 Query: 433 LERRIYDGAVRGLLPVQGPLPVKFPLPDPRDPF 531 LE +IY A RGL+P Q VKFPLPDP+DPF Sbjct: 143 LENKIYVAAARGLMPSQNSFKVKFPLPDPKDPF 175 Score = 26.6 bits (57), Expect(2) = 2e-69 Identities = 10/16 (62%), Positives = 12/16 (74%) Frame = +3 Query: 9 LSAGIPREPCLTMHQP 56 +S G + PCLTMHQP Sbjct: 1 MSRGNYKNPCLTMHQP 16 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,897,999 Number of Sequences: 27288 Number of extensions: 338371 Number of successful extensions: 1028 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 975 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1026 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 745241396 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18654958|gb|BM499763.1|BM499763 952034F08.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (561 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g65540.1 unknown protein / 125 1e-29 At1g30330.1 auxin response transcription factor(ARF6) / ident... 47 5e-06 >At5g65540.1 unknown protein / Length = 595 Score = 125 bits (315), Expect = 1e-29 Identities = 81/185 (43%), Positives = 111/185 (59%) Frame = -2 Query: 557 VSIDVLSEIIIKPICKLGRNLKLLTDSYRKQFSSIELLKMFLQTVGYSNIGSLMEITKMG 378 V IDV S+++ + + KLGR LKLLTDSY+K+ S+++L+KMFL T GYSN+GSL EI K G Sbjct: 350 VPIDVFSQLVSRHMSKLGRILKLLTDSYKKECSAMQLIKMFLNTTGYSNLGSLAEIVKDG 409 Query: 377 NRVANYPIHQDAQVLQTQNAISIHAQQLPRQFPPQMLQNLTPQQQQQLQNLTPQQQQLLQ 198 R P + QVLQ Q +H QQ PQ +Q Q QQ+ N PQ Q Q Sbjct: 410 TRNHPPPNQKQPQVLQQQ----LHLQQQASLRLPQQIQRQMHPQMQQMVN--PQNFQQQQ 463 Query: 197 QQQWLRRNQLCSPRGPLTMADKNQPMVNVKVENTMDSQIDVPYGSFTRQQQFNIRQQQQL 18 Q + +RR + SPR + M +K++P+V VK+EN S++ V +F + +Q QQ Sbjct: 464 QLERMRRRPVTSPRPNMDM-EKDRPLVQVKLEN--PSEMAVDGNAFNPMNPRHQQQLQQQ 520 Query: 17 LHQQQ 3 L QQQ Sbjct: 521 LRQQQ 525 >At1g30330.1 auxin response transcription factor(ARF6) / identical to ARF6 [Arabidopsis thaliana] GI:4102600 (Science 276 (5320), 1865-1868 (1997)); supported by cDNA: gi_4102599_gb_AF013467.1_AF013467 Length = 933 Score = 47.4 bits (111), Expect = 5e-06 Identities = 39/116 (33%), Positives = 51/116 (43%), Gaps = 3/116 (2%) Frame = -2 Query: 359 PIHQDAQVLQTQNAISIHAQQLPRQFPPQMLQNLTPQQQQQLQNLTPQQQQLLQQQQW-- 186 P A +LQ QN+ + Q P PQMLQ QQQQQL QQQQL QQQQ Sbjct: 453 PAKAAASLLQFQNSPGF-SMQSPSLVQPQMLQQQLSQQQQQLSQQQQQQQQLSQQQQQQL 511 Query: 185 -LRRNQLCSPRGPLTMADKNQPMVNVKVENTMDSQIDVPYGSFTRQQQFNIRQQQQ 21 ++ Q S + ++ + Q + V T P Q ++ QQQQ Sbjct: 512 SQQQQQQLSQQQQQQLSQQQQQQAYLGVPETHQ-----PQSQAQSQSNNHLSQQQQ 562 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,705,619 Number of Sequences: 27288 Number of extensions: 290908 Number of successful extensions: 2047 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1495 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 835029516 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18654809|gb|BM499614.1|BM499614 952033C09.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (562 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16300.1 low density lipoprotein B-like protein / 168 2e-42 >At5g16300.1 low density lipoprotein B-like protein / Length = 1068 Score = 168 bits (426), Expect = 2e-42 Identities = 82/165 (49%), Positives = 114/165 (68%) Frame = -2 Query: 561 GGGFWFSESKIKKGGVLAHLKPIADENDFHSCLTLYFGPEVSRIRSAIDSKCKNILDDLL 382 GGG WF E KK G+++ K +E+DF SCLT YFGPEVS++R A+D +C ++L+DLL Sbjct: 485 GGGVWFIEPNSKKVGLISGNKSSPEESDFQSCLTAYFGPEVSQMRDAVDRRCHSVLEDLL 544 Query: 381 SFVESHNSAPRLKELVPYLQEKCYRTISGVLKELEAELRKLSALLGTKKEGNDIPAASII 202 SF ES + PRLK+L PY+Q KCY ++S +L +++ EL L A + + + ++ +II Sbjct: 545 SFFESEKAGPRLKDLAPYVQNKCYDSVSALLADVDKELEFLCAAVKKENKDSEAIPPAII 604 Query: 201 AERSLFIGRILFALRYYSSHVPLILGSPREWVEEAGGAAFARLSS 67 E+SLF+GR+LFAL +S HVPLILGSPR W E A +LSS Sbjct: 605 IEKSLFMGRLLFALLNHSKHVPLILGSPRLWCRETMTAVSDKLSS 649 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,308,711 Number of Sequences: 27288 Number of extensions: 304327 Number of successful extensions: 926 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 898 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 926 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 835029516 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18650404|gb|BM499223.1|BM499223 947043H10.x1 947 - 2 week shoot from Barkan lab Zea mays cDNA, mRNA sequence (540 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g52120.1 gamma response I protein / ; supported by cDNA: ... 184 2e-47 At5g26605.1 putative protein / ;supported by full-length cDN... 50 1e-06 At3g57910.1 putative protein / hypothetical protein YLR271w -... 47 6e-06 At5g08535.2 expressed protein / ; supported by full-length cD... 47 8e-06 At5g08535.1 expressed protein / ; supported by full-length cD... 47 8e-06 >At3g52120.1 gamma response I protein / ; supported by cDNA: gi_14335159_gb_AY037259.1_ Length = 443 Score = 184 bits (468), Expect = 2e-47 Identities = 84/105 (80%), Positives = 96/105 (91%) Frame = -2 Query: 539 RCNDAAAQRATKEAAEKVKIQADNIGHKLLSKMGWREGEGLGSERRGRADPVMAGDVKKD 360 +CNDAAAQ+ATKEAAEK KIQADN+GHKLLSKMGW+EGEG+GS R+G ADP+MAGDVK + Sbjct: 339 KCNDAAAQKATKEAAEKAKIQADNVGHKLLSKMGWKEGEGIGSSRKGMADPIMAGDVKTN 398 Query: 359 HLGVGAVQPGEVTSEDDIYEQYKKRMMLGYRYRPNPLNNPRKSYY 225 +LGVGA PGEV EDDIYEQYKKRMMLGY++RPNPL NPRK+YY Sbjct: 399 NLGVGASAPGEVKPEDDIYEQYKKRMMLGYKHRPNPLGNPRKAYY 443 >At5g26605.1 putative protein / ;supported by full-length cDNA: Ceres:108509. Length = 301 Score = 49.7 bits (117), Expect = 1e-06 Identities = 25/68 (36%), Positives = 46/68 (66%), Gaps = 1/68 (1%) Frame = -2 Query: 506 KEAAEKVKIQADNIGHKLLSKMGWREGEGLGSERRGRADPVMAGDVKKDHLGVGAVQPGE 327 ++A+ VKI + N+G +LL KMGW+ G+GLG + +G +P+ +G ++ LG+G + + Sbjct: 56 EQASLDVKISSSNVGFRLLQKMGWK-GKGLGKQEQGITEPIKSG-IRDRRLGLGKQEEDD 113 Query: 326 -VTSEDDI 306 T+E++I Sbjct: 114 YFTAEENI 121 >At3g57910.1 putative protein / hypothetical protein YLR271w - Saccharomyces cerevisiae, PIR:S51407 Length = 265 Score = 47.0 bits (110), Expect = 6e-06 Identities = 26/67 (38%), Positives = 39/67 (57%), Gaps = 1/67 (1%) Frame = -2 Query: 482 IQADNIGHKLLSKMGWREGEGLGSERRGRADPVMAGDVKKDHLGVGAVQP-GEVTSEDDI 306 I NIG KLL +MG++ G LG + GRA+PV D+++ GVG P E +++I Sbjct: 91 IGESNIGFKLLKQMGYKPGSALGKQGSGRAEPVTM-DIRRSRAGVGREDPHKEKKKKEEI 149 Query: 305 YEQYKKR 285 + +KR Sbjct: 150 EAENEKR 156 >At5g08535.2 expressed protein / ; supported by full-length cDNA: Ceres: 17241. Contains a 2nt micro-exon, as identified using GeneSeqer. Length = 116 Score = 46.6 bits (109), Expect = 8e-06 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 6/71 (8%) Frame = -2 Query: 482 IQADNIGHKLLSKMGWREGEGLGSERRGRADPVMAGDVKKDHLGVGAVQPGE------VT 321 I + NIG +LL K GW+EG GLG +G P+ A + K + GVGA QP + Sbjct: 14 INSSNIGFQLLKKHGWKEGTGLGIAEQGILVPLQA-EPKHNKRGVGAKQPAKRKVAQPQA 72 Query: 320 SEDDIYEQYKK 288 ++++ +Q KK Sbjct: 73 KDEEVSKQSKK 83 >At5g08535.1 expressed protein / ; supported by full-length cDNA: Ceres: 17241. Contains a 2nt micro-exon, as identified using GeneSeqer. Length = 141 Score = 46.6 bits (109), Expect = 8e-06 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 6/71 (8%) Frame = -2 Query: 482 IQADNIGHKLLSKMGWREGEGLGSERRGRADPVMAGDVKKDHLGVGAVQPGE------VT 321 I + NIG +LL K GW+EG GLG +G P+ A + K + GVGA QP + Sbjct: 39 INSSNIGFQLLKKHGWKEGTGLGIAEQGILVPLQA-EPKHNKRGVGAKQPAKRKVAQPQA 97 Query: 320 SEDDIYEQYKK 288 ++++ +Q KK Sbjct: 98 KDEEVSKQSKK 108 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,144,601 Number of Sequences: 27288 Number of extensions: 320277 Number of successful extensions: 936 Number of sequences better than 1.0e-05: 10 Number of HSP's better than 0.0 without gapping: 888 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 935 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 772177832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18650345|gb|BM499164.1|BM499164 947043A12.x1 947 - 2 week shoot from Barkan lab Zea mays cDNA, mRNA sequence (616 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g22660.1 putative tRNA adenylyltransferase / Similar to tR... 130 7e-31 >At1g22660.1 putative tRNA adenylyltransferase / Similar to tRNA adenylyltransferase gb|U15930 from Lupinus albus. EST gb|AA721797 comes from this gene; supported by cDNA: gi_13877576_gb_AF370489.1_AF370489 Length = 605 Score = 130 bits (326), Expect = 7e-31 Identities = 62/139 (44%), Positives = 93/139 (66%), Gaps = 6/139 (4%) Frame = -3 Query: 611 IPGDSVKRVFAGLILREIKEFWRVALLLSILFYRETGTPAGTLDEQD------ELRRRKE 450 IP S RV G +LR+IK+FWRV+LL S+L + T G+ D QD +L R +E Sbjct: 470 IPATSKIRVLTGFLLRDIKDFWRVSLLTSLLL---SATVDGSNDHQDIGQLDFQLERMRE 526 Query: 449 KYIRAERSITDLDLDGVWKLKPILDGKSIMGVMQVKSGGPLIGKWQQRVLKWQLAHPDGT 270 Y+ E +I +L LD +W KP+++G+ IM + ++K G LI +WQQ++L WQLA+P+GT Sbjct: 527 TYLTVEATIHELGLDKIWDAKPLVNGREIMQIAELKGGSRLIREWQQKLLTWQLAYPNGT 586 Query: 269 VDECVEWMKQSQSKRQKVE 213 +EC EWM+ ++KRQ++E Sbjct: 587 AEECKEWMRDIKAKRQRIE 605 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,139,414 Number of Sequences: 27288 Number of extensions: 320098 Number of successful extensions: 1018 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1017 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 972741724 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18650250|gb|BM499069.1|BM499069 949015G11.x1 949 - Juvenile leaf and shoot cDNA from Steve Moose Zea mays cDNA, mRNA sequence (428 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g12340.2 FKBP-type peptidyl-prolyl cis-trans isomerase, putat... 100 3e-22 >At3g12340.2 FKBP-type peptidyl-prolyl cis-trans isomerase, putative / contains Pfam profile: PF00254, FKBP-type peptidyl-prolyl cis-trans isomerases Length = 186 Score = 100 bits (249), Expect = 3e-22 Identities = 59/126 (46%), Positives = 83/126 (65%), Gaps = 6/126 (4%) Frame = -3 Query: 426 FEERV--LRIKSRVGP-KKRGARKKKAAASASASAVT---LPPVPLREPRSALGAPVELG 265 FE R+ +R++ R G KK RK K +S S S T LPPV L+E S G VE G Sbjct: 60 FESRLSNIRLRYRSGTGKKAEVRKSKKGSSGSPSKGTGIYLPPVSLKEAVSG-GLKVEPG 118 Query: 264 FTAYSERLIGALAALGLAAVLLVELGSGQALVKNNQPATLFLQAYTVAAAAALFIKYEKE 85 F+ +SER+ G +A LGL A+LLVEL +G++++ + P+ +FLQ Y VAA +A+F+K EKE Sbjct: 119 FSPFSERINGRIAGLGLTALLLVELATGKSVLNYHTPSVVFLQIYFVAAVSAMFVKIEKE 178 Query: 84 RISTWP 67 ++S WP Sbjct: 179 KVSVWP 184 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,793,216 Number of Sequences: 27288 Number of extensions: 232382 Number of successful extensions: 1910 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1809 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 481662092 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18649854|gb|BM498673.1|BM498673 952019G08.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (546 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g18380.1 unknown protein / ; supported by cDNA: gi_20260285 224 2e-59 >At3g18380.1 unknown protein / ; supported by cDNA: gi_20260285 Length = 348 Score = 224 bits (571), Expect = 2e-59 Identities = 105/127 (82%), Positives = 114/127 (89%) Frame = -3 Query: 421 YDVAAFLSHRLFESGDPEVRVRFSGFGAEEDEWINFRKCVRQRSLPCEATECVAVLPGDL 242 YDV AFL+HR E GDPEV+VRF+GF EEDEWIN +K VRQRSLPCEA+ECVAVL GDL Sbjct: 156 YDVQAFLAHRNLEIGDPEVQVRFAGFEVEEDEWINVKKHVRQRSLPCEASECVAVLAGDL 215 Query: 241 ILCFQEGKDQALYYDAHVLDAQRRRHDVRGCRCRFLVRYDHDSSEEIVPLRKVCRRPETD 62 +LCFQEGKDQALY+DA VLDAQRRRHDVRGCRCRFLVRY HD SEEIVPLRK+CRRPETD Sbjct: 216 VLCFQEGKDQALYFDAIVLDAQRRRHDVRGCRCRFLVRYSHDQSEEIVPLRKICRRPETD 275 Query: 61 YRLQKNH 41 YRLQ+ H Sbjct: 276 YRLQQLH 282 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,895,481 Number of Sequences: 27288 Number of extensions: 301586 Number of successful extensions: 1024 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 942 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1023 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 790135456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18649795|gb|BM498614.1|BM498614 952019C12.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (616 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13235.1 Expressed protein / ; supported by full-length cD... 275 1e-74 >At3g13235.1 Expressed protein / ; supported by full-length cDNA: Ceres: 12734. Length = 414 Score = 275 bits (703), Expect = 1e-74 Identities = 142/202 (70%), Positives = 160/202 (78%), Gaps = 3/202 (1%) Frame = -2 Query: 615 PEAFARVVMLYVDMEVNGVPLKAFVDSGAQSTIISKSCAERCGLLRLLDRRFRGIAVGVG 436 PE FARV+MLYVDMEVNGVPLKAFVDSGAQSTIISKSCAERCGLLRL+D+R++GIA GVG Sbjct: 193 PEGFARVIMLYVDMEVNGVPLKAFVDSGAQSTIISKSCAERCGLLRLMDQRYKGIAHGVG 252 Query: 435 QSEILGRIHVAPIKIGNIFYPCSFTVLDAPNMEFLFGLDMLRKHQCMIDLKDNVLRVGGG 256 Q+EILGRIHVAPIKIGN FYPCSF VLD+PNMEFLFGLDMLRKHQC IDLK+NV+ VGGG Sbjct: 253 QTEILGRIHVAPIKIGNNFYPCSFVVLDSPNMEFLFGLDMLRKHQCTIDLKENVMTVGGG 312 Query: 255 EVSVPFLQEKDIPAHIHNEEKLSKLGSLSQAT---GESSRTREGTPNAPQQTPPPGAPAA 85 EVSVPFLQEKDIP+ +EE++ S S AT G + + N Q P Sbjct: 313 EVSVPFLQEKDIPSRFLDEERVPNDASSSGATVPSGFTEKKNNTVANPTSQQP----KRQ 368 Query: 84 NPPQGGDFEAKVTKLVELGFDR 19 N +G +FEAK+ KLVELGF R Sbjct: 369 NTSEGPEFEAKIAKLVELGFSR 390 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,809,030 Number of Sequences: 27288 Number of extensions: 345834 Number of successful extensions: 1679 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1646 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 972741724 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18649776|gb|BM498595.1|BM498595 952019A07.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (369 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g40740.1 putative protein / ; supported by cDNA: gi_14532... 114 4e-28 >At5g40740.1 putative protein / ; supported by cDNA: gi_14532693_gb_AY039971.1_ Length = 741 Score = 114 bits (286), Expect(2) = 4e-28 Identities = 61/124 (49%), Positives = 81/124 (65%), Gaps = 17/124 (13%) Frame = -3 Query: 367 AAMDMSSSVPHSELLSSKAGETSIILEKQEEFSQLF-----------------QEKEEAL 239 AAMD SS VP +ELLS+ + +++ + + +E + Q +E L Sbjct: 298 AAMDQSSQVPRAELLSAHSDDSASLADDKELSDGSYTNMHDHSLVDSFETASSQASDETL 357 Query: 238 TRSDDRNGRTQQTVDVAEILRRWTHALQRIHKQSLHLAKANDGEGPELLRSASSGEASTH 59 +R DDR G+ QTVDVAE++RRWTHALQRIHKQSL LAKANDG+GP++LR+AS G S H Sbjct: 358 SRVDDRGGKINQTVDVAEVIRRWTHALQRIHKQSLLLAKANDGDGPDILRTASDGGTSGH 417 Query: 58 SDSL 47 +SL Sbjct: 418 VESL 421 Score = 25.4 bits (54), Expect(2) = 4e-28 Identities = 10/16 (62%), Positives = 12/16 (74%) Frame = -2 Query: 50 VTATLAEHRQHLVSIQ 3 + ATL EH+QHL S Q Sbjct: 421 LAATLTEHQQHLASFQ 436 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,681,067 Number of Sequences: 27288 Number of extensions: 149252 Number of successful extensions: 480 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 478 length of database: 11,516,596 effective HSP length: 87 effective length of database: 9,142,540 effective search space used: 319988900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18649725|gb|BM498544.1|BM498544 952032C11.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (627 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g65260.1 expressed protein / contains similarity to chloro... 243 4e-65 >At1g65260.1 expressed protein / contains similarity to chloroplast membrane-associated protein IM30 GI:169106 from [Pisum sativum];supported by full-length cDNA: Ceres:32284. Length = 330 Score = 243 bits (621), Expect = 4e-65 Identities = 129/181 (71%), Positives = 153/181 (84%), Gaps = 3/181 (1%) Frame = +3 Query: 93 SFRRTPLRTSFL-RGSVSLKVVQVRQSNVNRFKCNS--IRSNLFDRLTRVVRSYANAVLS 263 S R PLRTSF S +L+V +R + NR +CN NLF+R +RVV+SYANA++S Sbjct: 32 SLRILPLRTSFFGNSSGALRVNVLRLACDNRLRCNGHGATMNLFERFSRVVKSYANALIS 91 Query: 264 SFEDPEKILDQAVLEMNDDLTKMRQATAQVLASQKRLENKYKAAEQASADWYRRAQLALQ 443 SFEDPEKIL+Q V+EMN DLTKMRQATAQVLASQK+L+NKYKAA+Q+S DWY+RAQLAL Sbjct: 92 SFEDPEKILEQTVIEMNSDLTKMRQATAQVLASQKQLQNKYKAAQQSSDDWYKRAQLALA 151 Query: 444 KGDEDLAREALKRRKSYADNASSLRSQLDQQKGVVENLISNTRLLESKISEAKQKKDTLK 623 KGDEDLAREALKRRKS+ADNA++L++QLDQQKGVV+NL+SNTRLLESKI EAK KKDTL Sbjct: 152 KGDEDLAREALKRRKSFADNATALKTQLDQQKGVVDNLVSNTRLLESKIQEAKAKKDTLL 211 Query: 624 A 626 A Sbjct: 212 A 212 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,267,339 Number of Sequences: 27288 Number of extensions: 296561 Number of successful extensions: 1622 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1272 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1591 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1008438668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18649611|gb|BM498430.1|BM498430 952026C01.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (533 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05760.1 expressed protein / ; supported by cDNA: gi_14517... 161 6e-42 >At3g05760.1 expressed protein / ; supported by cDNA: gi_14517382_gb_AY039526.1_ Length = 202 Score = 161 bits (407), Expect(2) = 6e-42 Identities = 75/104 (72%), Positives = 88/104 (84%) Frame = -1 Query: 353 SGNPVGVDNTSRRKFXKEEYLERARQREQREKDEARKGKERGPPVQRQPLKHRDYEVDLD 174 S GVDNT R+KF EE+ ERAR+RE++E D + K + +GPPVQR PLKHRDY VDL+ Sbjct: 4 SNTTTGVDNTFRKKFDVEEFKERAREREKKESDRS-KSRSKGPPVQRAPLKHRDYHVDLE 62 Query: 173 SRLGKTQVVTPIAPLNQQAGYYCSVCECVVKDSANYLDHINGKK 42 SRLGKTQVVTP+APL+QQAGY+C VC+CVVKDSANYLDHINGKK Sbjct: 63 SRLGKTQVVTPVAPLSQQAGYFCRVCDCVVKDSANYLDHINGKK 106 Score = 26.6 bits (57), Expect(2) = 6e-42 Identities = 12/13 (92%), Positives = 13/13 (99%) Frame = -2 Query: 40 RALGMSMRVERAS 2 RALGMSMRVER+S Sbjct: 109 RALGMSMRVERSS 121 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,984,017 Number of Sequences: 27288 Number of extensions: 313235 Number of successful extensions: 1346 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1199 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1313 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 754220208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18649562|gb|BM498381.1|BM498381 952024C01.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (573 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g35400.1 putative protein / 153 1e-40 >At5g35400.1 putative protein / Length = 411 Score = 153 bits (387), Expect(2) = 1e-40 Identities = 80/159 (50%), Positives = 102/159 (63%), Gaps = 2/159 (1%) Frame = -2 Query: 500 HVHYKHTDACHQLRWTAKESYEYMYARPWSRVVDFYAELVRAGAGAAGLAKLFGNDEKDY 321 +VHY H DAC + RW A+E++ +MY RPW V+DFY+ V G + LF K Sbjct: 6 YVHYHHADACSKARWNARETFRFMYDRPWQHVLDFYSNAVE---GNLSVLSLF--QPKKS 60 Query: 320 TLYTAG--ENYLTPSEKPTTTTFSKGRGGRWERVTFKVVISYHGGSFDGWQKQPGLNTVQ 147 ++ G E L SE P T+T GR GRWERV FK+V+SY+G SFDGWQKQP L+TVQ Sbjct: 61 LVHDDGITEEMLLESE-PETSTRKDGRSGRWERVNFKIVLSYNGASFDGWQKQPDLHTVQ 119 Query: 146 GLVEKHLGQFVDERKAKQLEARSLPIEGCALMLDALTKG 30 G+VEK LG FVDERKA+ L+ + P+EG L+ KG Sbjct: 120 GVVEKSLGGFVDERKAQLLKKKCKPLEGRVLVAGRTDKG 158 Score = 30.4 bits (67), Expect(2) = 1e-40 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -1 Query: 51 AGRTDKGVTALQQVC 7 AGRTDKGV+AL Q+C Sbjct: 152 AGRTDKGVSALNQIC 166 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,467,571 Number of Sequences: 27288 Number of extensions: 380383 Number of successful extensions: 5845 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4680 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 859346304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18649446|gb|BM498265.1|BM498265 952028H03.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (609 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26460.1 unknown protein / 215 1e-56 >At2g26460.1 unknown protein / Length = 585 Score = 215 bits (548), Expect = 1e-56 Identities = 106/147 (72%), Positives = 123/147 (83%), Gaps = 1/147 (0%) Frame = +3 Query: 171 MSSKKNYYKEKLMRRKEEKKEEPETPRYRDRAKERREDQNPDYEPTELGSFHAVAPPGN- 347 M K+++KEK RR+EEK EE + P+YRDRAKERRE+QNPDY+P+EL SFHAVAPPG Sbjct: 1 MKPSKSHHKEKTARRREEKLEESDNPKYRDRAKERRENQNPDYDPSELSSFHAVAPPGAV 60 Query: 348 DLRLADAHKISIEKSKYLGGDLEHTHLVKGLDYALLHKVRSEIEKKPEAEDGKDTKSRAA 527 D+R ADA KISIE SKYLGGD+EHTHLVKGLDYALL+KVRSEI KKP+ EDG K+ A Sbjct: 61 DIRAADALKISIENSKYLGGDVEHTHLVKGLDYALLNKVRSEIVKKPDGEDGDGGKTSAP 120 Query: 528 KEDQAVSFRTATAKSVYQWIIKPQSII 608 KEDQ V+FRT AKSVYQWI+KPQ+II Sbjct: 121 KEDQRVTFRTIAAKSVYQWIVKPQTII 147 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,078,172 Number of Sequences: 27288 Number of extensions: 382228 Number of successful extensions: 3450 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3208 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 966764592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18649284|gb|BM498103.1|BM498103 952022F10.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (568 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g47610.1 putative protein / activating signal cointegrator... 261 2e-70 >At3g47610.1 putative protein / activating signal cointegrator 1 - Homo sapiens, EMBL:AF168418; supported by full-length cDNA: Ceres:13265. Length = 408 Score = 261 bits (667), Expect = 2e-70 Identities = 123/181 (67%), Positives = 158/181 (86%) Frame = -2 Query: 567 KKGAKVISLAEAAKGSIVFKQGKPCSCQARQHDLVSSCLSCGKIVCEQEGEGPCSFCGAL 388 KKG KVISLAEAAKGSIVF+QGKPC+CQAR+H LVS+CLSCGKIVCEQEGEGPCSFCGAL Sbjct: 136 KKGGKVISLAEAAKGSIVFQQGKPCACQARRHHLVSNCLSCGKIVCEQEGEGPCSFCGAL 195 Query: 387 VLKEGSTYAGLSDVGLPLSEAETAAEAYAKRLVDYDRNAAARTKVYDDQSDYYEMEGNSW 208 VLKEGSTYAGL P+S+A+ AAEAYAKRLV+YDRN+AART V DDQSDYYE E ++W Sbjct: 196 VLKEGSTYAGLEVGYTPVSDADVAAEAYAKRLVEYDRNSAARTTVIDDQSDYYESESSTW 255 Query: 207 LSSKERSVLKQQQEEAEEAAKIQKGKVIVTFDLVGRKVILNKDGSTEVETEHPIMRRPKR 28 LS++E+ ++++++EE EEA +++K KV++TFDL+GRKV+LN+D +E+E+ + I+ P+ Sbjct: 256 LSAEEKELVRKKREEIEEAERVKKSKVVMTFDLIGRKVLLNEDDISELESGNRILGPPET 315 Query: 27 R 25 + Sbjct: 316 K 316 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,158,579 Number of Sequences: 27288 Number of extensions: 289847 Number of successful extensions: 1044 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 964 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1042 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 841443256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18450668|gb|BM428946.1|BM428946 952026B02.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (573 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g35630.1 similar to ch-TOG protein from Homo sapiens / ; ... 291 2e-79 >At2g35630.1 similar to ch-TOG protein from Homo sapiens / ; supported by cDNA: gi_14317952_gb_AF367246.1_AF367246 Length = 1611 Score = 291 bits (745), Expect = 2e-79 Identities = 143/176 (81%), Positives = 158/176 (89%) Frame = -3 Query: 571 FVVLINLLRPLDPSRWPSPTPMESLAVKNQKFSDLVVKCLIKLPKVLQSXIYEVDLDRIL 392 FVVLI+LLRPLDPSRWPSP E AV+NQKFSDLVVKCLIKL K+LQS IYEVDLDR+L Sbjct: 1241 FVVLISLLRPLDPSRWPSPATAEVYAVRNQKFSDLVVKCLIKLTKLLQSTIYEVDLDRLL 1300 Query: 391 QSIHIYLQELGMEEIRRRAGADDKPLRMVKTVLHELVKLRGTAIKGHLSMVPIDAEPQPI 212 QSIH+YLQ+LGMEEIRRRAGADDKPLRMVKTVLHELVKLRG AIKGHLS+VPID PQPI Sbjct: 1301 QSIHVYLQDLGMEEIRRRAGADDKPLRMVKTVLHELVKLRGAAIKGHLSLVPIDMRPQPI 1360 Query: 211 ILAYIDLNLQTLAAARMLMPSGPMGQTHWGDAASNNPNPSTHSADAQLKQELAAVF 44 ILAYIDLNL+TLAAARML +GP+GQTHW D+ +NNP+P +SAD QLKQEL A+F Sbjct: 1361 ILAYIDLNLETLAAARMLTATGPVGQTHWTDSTANNPSPPANSADVQLKQELGAIF 1416 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,482,181 Number of Sequences: 27288 Number of extensions: 266188 Number of successful extensions: 700 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 699 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 859346304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18385249|gb|BM418448.1|BM418448 952016F11.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (525 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49550.1 Expressed protein / ; supported by full-length cD... 138 2e-33 >At5g49550.1 Expressed protein / ; supported by full-length cDNA: Ceres: 31276. Length = 127 Score = 138 bits (347), Expect = 2e-33 Identities = 66/110 (60%), Positives = 90/110 (81%) Frame = +2 Query: 80 AGRRDELSESLAELFTNVSLMVRGELQGTNNQLALLEKMNDRVSQEYSNYGDIAAGLRVF 259 A RD+L+ESL LFT+VS MV+ ELQGTNN L LLEKMN RV+ EY + GD+AAGLRVF Sbjct: 2 ADSRDDLAESLQNLFTSVSSMVKSELQGTNNHLDLLEKMNLRVASEYDDMGDVAAGLRVF 61 Query: 260 VEQLNEKNRGFDDYVSQIDAIDQQVTEFEAVVSMLDKHVALLEKKVKSAY 409 EQ+ K+ G D++V Q+DAI++QV+EFEAV+S+LD++V++LE K+++ Y Sbjct: 62 AEQMKSKSGGLDEFVGQMDAIEKQVSEFEAVISVLDRYVSVLESKIRAEY 111 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,698,070 Number of Sequences: 27288 Number of extensions: 309015 Number of successful extensions: 6708 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2210 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5203 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 727283772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18385146|gb|BM418345.1|BM418345 952014G06.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (286 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58450.1 putative protein / predicted proteins from D.mela... 113 2e-30 >At5g58450.1 putative protein / predicted proteins from D.melanogaster, C.elegans and S.pombe Length = 1035 Score = 113 bits (283), Expect(2) = 2e-30 Identities = 59/77 (76%), Positives = 66/77 (85%) Frame = +2 Query: 56 PIWDAVDSRQYKPALKLCTALLAKHPTSPYALALKALILERMGKPDEALSGPLNAKELLY 235 PIWDA+DSRQ+K ALKL T+LLAK+P SPYALALKALI ERMGK DEALS L+AKELLY Sbjct: 81 PIWDAIDSRQFKNALKLVTSLLAKYPKSPYALALKALIHERMGKTDEALSVCLDAKELLY 140 Query: 236 SDNIFHFDDLTLSTLQI 286 D++ DDLTLSTLQI Sbjct: 141 KDDLALMDDLTLSTLQI 157 Score = 34.3 bits (77), Expect(2) = 2e-30 Identities = 15/16 (93%), Positives = 16/16 (99%) Frame = +1 Query: 4 MASKFGLAGGIPERRV 51 M+SKFGLAGGIPERRV Sbjct: 64 MSSKFGLAGGIPERRV 79 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,364,739 Number of Sequences: 27288 Number of extensions: 121942 Number of successful extensions: 624 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 11,516,596 effective HSP length: 70 effective length of database: 9,606,436 effective search space used: 230554464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18385136|gb|BM418335.1|BM418335 952014E12.x1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (615 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g31340.1 unknown protein / 125 2e-29 >At2g31340.1 unknown protein / Length = 258 Score = 125 bits (313), Expect = 2e-29 Identities = 60/123 (48%), Positives = 81/123 (65%) Frame = -2 Query: 614 SVVNPAMEKALKMLQEFASDVREGKVPKIRSSFGAPWRHPPRDDNPDLSYKWAKIQLMDF 435 +VVNPAM+KAL LQ +A+DVR+G +P + FGA WRHPP+ ++P + +WAKIQLMDF Sbjct: 62 AVVNPAMDKALLRLQRYATDVRKGSIPYEKLRFGASWRHPPQTEDPTQNSEWAKIQLMDF 121 Query: 434 IQSFVNTEFGVNYLADDSLEILDDPAAVAMMEVGLLYQQREPSFMRPITRGIQRCLARWL 255 +Q+ VNTEF VG+LY QR+PSF RPI++GI+RCL RW Sbjct: 122 VQALVNTEFA----------------------VGILYTQRDPSFFRPISQGIKRCLVRWN 159 Query: 254 AEQ 246 ++ Sbjct: 160 VDE 162 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,217,959 Number of Sequences: 27288 Number of extensions: 304914 Number of successful extensions: 865 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 972741724 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18384602|gb|BM417801.1|BM417801 952005G08.x8 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (477 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20990.1 MOLYBDOPTERIN BIOSYNTHESIS CNX1 PROTEIN / ; supp... 204 2e-53 At2g29210.1 putative proline-rich protein / 47 4e-06 >At5g20990.1 MOLYBDOPTERIN BIOSYNTHESIS CNX1 PROTEIN / ; supported by cDNA: gi_1263313_gb_L47323.1_ATHCNX1R Length = 670 Score = 204 bits (519), Expect = 2e-53 Identities = 103/145 (71%), Positives = 118/145 (81%) Frame = +1 Query: 43 PHAVPLQGALGLVLAEDVCAPDPLPPFRASIKDGYAVVASDGPGEYPVVTESRAGDDALG 222 P V L ALG VLAED+ APDPLPP+ AS+KDGYAVVASDGPGEYPV+TESRAG+D LG Sbjct: 35 PVIVSLYEALGKVLAEDIRAPDPLPPYPASVKDGYAVVASDGPGEYPVITESRAGNDGLG 94 Query: 223 VVVVPGTVAYVTTGGPVPDGADAVVQVEDTEQLPGGADGSKRVRILARASQRQDIRSVGC 402 V V PGTVAYVTTGGP+PDGADAVVQVEDT+ + + SKRV+IL + + DIR VGC Sbjct: 95 VTVTPGTVAYVTTGGPIPDGADAVVQVEDTKVIGDVSTESKRVKILIQTKKGTDIRRVGC 154 Query: 403 DIEKDSIVLKSGEHIGPAEIGLLAT 477 DIEKD+ VL +GE IG +EIGLLAT Sbjct: 155 DIEKDATVLTTGERIGASEIGLLAT 179 >At2g29210.1 putative proline-rich protein / Length = 891 Score = 47.4 bits (111), Expect = 4e-06 Identities = 45/128 (35%), Positives = 52/128 (40%), Gaps = 13/128 (10%) Frame = +2 Query: 8 RRCCPRRRA------TRSRTPCRCRARSGSSSRRTSARPIRSL--PSAPPSRTDTPSWPP 163 R PRRR +RSR+P R R RR S P R PS P R +PS P Sbjct: 281 RSLSPRRRRIHSPFRSRSRSPIRRHRRPTHEGRRQSPAPSRRRRSPSPPARRRRSPSPPA 340 Query: 164 MGQGSILWSRSRGRATTPSEWL----SSPARSPTSPPEGRFPMAPMPSC-RWRTPSSSLA 328 + S R R+ TP S PAR SPP R +P P R R+PS Sbjct: 341 RRRRSPSPPARRHRSPTPPARQRRSPSPPARRHRSPPPARRRRSPSPPARRRRSPSPPAR 400 Query: 329 ERMGPRGL 352 R P L Sbjct: 401 RRRSPSPL 408 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.314 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,591,891 Number of Sequences: 27288 Number of extensions: 400649 Number of successful extensions: 2477 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2248 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 605236996 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18384108|gb|BM417308.1|BM417308 952008F09.x4 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (573 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54855.1 Expressed protein / ; supported by full-length cD... 201 2e-52 >At5g54855.1 Expressed protein / ; supported by full-length cDNA: Ceres: 9159. Length = 146 Score = 201 bits (511), Expect = 2e-52 Identities = 91/121 (75%), Positives = 103/121 (84%) Frame = -1 Query: 528 AWTGEIRGRVVCDVCGDAAIGPEXHALEGAEVAVLCITKSGEVINYQAFTNSKGVYTVAE 349 AWTGEIRGRVVCDVC D++IGPE H LEGAEVAVLCITKSGEV+NYQAFTNSKGVYTVAE Sbjct: 26 AWTGEIRGRVVCDVCADSSIGPEDHVLEGAEVAVLCITKSGEVVNYQAFTNSKGVYTVAE 85 Query: 348 TMPESDRWDSCLARPMSSFHLHCTRRGDAHSGVKFTYNKSSGNPHTVKPFLYKPATVPLY 169 TMPES+RWD+CLARP+SSFH C R ++G+KFTYN+ SG H VKPF+Y+P P Y Sbjct: 86 TMPESERWDACLARPISSFHTPCNRLHQTNTGIKFTYNRPSGFFHAVKPFVYRPQYAPSY 145 Query: 168 C 166 C Sbjct: 146 C 146 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,356,335 Number of Sequences: 27288 Number of extensions: 353704 Number of successful extensions: 1192 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1186 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 859346304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18383990|gb|BM417190.1|BM417190 952007B07.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (457 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g51270.1 putative protein / several hypothetical proteins ... 208 1e-54 >At3g51270.1 putative protein / several hypothetical proteins of different species Length = 472 Score = 208 bits (529), Expect = 1e-54 Identities = 111/143 (77%), Positives = 120/143 (83%), Gaps = 11/143 (7%) Frame = +2 Query: 62 MKLDVNALRYLAKDDFRVLTAVEMGMRNHEIVPAELVDRIARLKHGGTYKVLRNLLKN-- 235 MKLDVN LRYL+KDDFRVLTAVEMGMRNHEIVP+ELV+RIA LKHGGTYKVL+NLLK Sbjct: 1 MKLDVNVLRYLSKDDFRVLTAVEMGMRNHEIVPSELVERIACLKHGGTYKVLKNLLKIGS 60 Query: 236 --KLVHHDATKY-------DGYRLTYLGYDFLAIKTLXNRGVFASVGRQIGVGKESDIFE 388 KL + A + DG+RLTYLGYDFLAIKTL NRG+F VGRQIGVGKESDIFE Sbjct: 61 LVKLQNLIAIAFFVYICLDDGFRLTYLGYDFLAIKTLVNRGIFTGVGRQIGVGKESDIFE 120 Query: 389 VATEDGTVLAMKLHRLGRTSFRA 457 VA EDGT+LAMKLHRLGRTSFRA Sbjct: 121 VAQEDGTILAMKLHRLGRTSFRA 143 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,500,694 Number of Sequences: 27288 Number of extensions: 223455 Number of successful extensions: 720 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 552701236 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18383981|gb|BM417181.1|BM417181 952007A05.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (343 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g21140.1 hypothetical protein / predicted by genscan+ 152 2e-38 >At5g21140.1 hypothetical protein / predicted by genscan+ Length = 287 Score = 152 bits (385), Expect = 2e-38 Identities = 67/113 (59%), Positives = 93/113 (82%) Frame = +1 Query: 4 RHHTLLQALLHRGPLSERDFHAVFAGVSGKNPATHHQLFNDTLLKINNDLAYLQFELRAC 183 +HHTL+QAL+ RGPL E++FH++F V+G+NP T ++F+ LL+IN +L+Y+ FEL+AC Sbjct: 7 KHHTLIQALISRGPLKEKEFHSIFTAVTGRNPVTVKKIFDKYLLEINKELSYVHFELKAC 66 Query: 184 INQYDGMVYYGVVNNIADEESKLGTKYSVPQIAFYKGLLEAIVQEAGNDGSIT 342 +QYDG V YGVVNN+AD++SKLGTKYSVPQIAF+KG++EAI Q+ G I+ Sbjct: 67 RDQYDGQVCYGVVNNVADDQSKLGTKYSVPQIAFFKGIIEAIAQDEAAQGCIS 119 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,146,137 Number of Sequences: 27288 Number of extensions: 171021 Number of successful extensions: 819 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 808 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 218111136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18383975|gb|BM417175.1|BM417175 952005H09.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (537 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g63660.1 GMP synthase / similar to GMP synthase GB:6323873... 277 3e-75 >At1g63660.1 GMP synthase / similar to GMP synthase GB:6323873 [Saccharomyces cerevisiae] Length = 534 Score = 277 bits (708), Expect = 3e-75 Identities = 134/161 (83%), Positives = 148/161 (91%) Frame = +3 Query: 54 GGLPKDMKLKLIEPLKLLFKDEVRKLGGILNVPDSFLKRHPFPGPGLAVRVLGDVTQGNA 233 GGLPKDMKLKLIEPLKLLFKDEVR+LG ILNVP FLKRHPFPGPGLAVRVLGDVTQGNA Sbjct: 370 GGLPKDMKLKLIEPLKLLFKDEVRELGRILNVPVGFLKRHPFPGPGLAVRVLGDVTQGNA 429 Query: 234 LEVLRQVDEIFVQSIKDAGLYDKIWQAFAVFLPVQTVGVQGDQRTHSNAVVLRAITSEDG 413 LEVLRQVDEIF+QSI+DAGLYD IWQAFAVFLPV++VGVQGD+RTHS+ V LRA+TS+DG Sbjct: 430 LEVLRQVDEIFIQSIRDAGLYDSIWQAFAVFLPVRSVGVQGDKRTHSHVVALRAVTSQDG 489 Query: 414 MTADWYYFEHAFLVDVVNKICNNVRGINRVCQDITSKPPAT 536 MTADW+ FEH FL DV KICN+V+G+NRV DITSKPP+T Sbjct: 490 MTADWFNFEHKFLDDVSRKICNSVQGVNRVVLDITSKPPST 530 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,472,678 Number of Sequences: 27288 Number of extensions: 317356 Number of successful extensions: 821 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 820 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 763199020 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18383971|gb|BM417171.1|BM417171 952005H01.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (355 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g17050.1 hypothetical protein / 84 1e-17 >At4g17050.1 hypothetical protein / Length = 298 Score = 84.3 bits (207), Expect = 1e-17 Identities = 37/39 (94%), Positives = 38/39 (96%) Frame = +3 Query: 3 PVQAGDTIWMAPFVPQWYAALGKTRTRYLLYKDVNRNPL 119 PVQAGD IWMAPFVPQWYAALGKTR+RYLLYKDVNRNPL Sbjct: 260 PVQAGDVIWMAPFVPQWYAALGKTRSRYLLYKDVNRNPL 298 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,294,554 Number of Sequences: 27288 Number of extensions: 172368 Number of successful extensions: 403 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 403 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 215491488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18383923|gb|BM417123.1|BM417123 952005A06.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (360 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g50410.1 unknown protein / 102 4e-23 >At5g50410.1 unknown protein / Length = 259 Score = 102 bits (253), Expect = 4e-23 Identities = 53/135 (39%), Positives = 79/135 (58%), Gaps = 16/135 (11%) Frame = +1 Query: 4 PPHPWEISARAWLESFPDGRPPTEP-EVDAYIDVHRPELPS----LPRSQLHQRLLALR- 165 P WE ARAW+ +FPD + EV+ +I + LP+ +PRS++ RLL+++ Sbjct: 34 PSQEWETMARAWVSAFPDAKAVVSAGEVETWIGTNLDSLPADLRHMPRSEIVDRLLSIQH 93 Query: 166 ----------GDQVLDADQSAFPYRFQRTDLWKPVYQWLESLELDSLVATQQISDWLTSN 315 +Q ++ADQ P RFQRTD W PVY WLESL+ LV ++ IS+WL +N Sbjct: 94 YMRPTPSSDQNEQNVEADQQ-HPARFQRTDQWLPVYSWLESLDNGELVKSKDISEWLDAN 152 Query: 316 PKIMDRMVEKHSKYH 360 P++ + +HS+YH Sbjct: 153 PEVKQELSSRHSRYH 167 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,149,437 Number of Sequences: 27288 Number of extensions: 290344 Number of successful extensions: 9205 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6260 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 214181664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18383893|gb|BM417093.1|BM417093 952003E04.y1 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (625 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03380.1 DegP protease / contains similarity to degP GI:26... 328 2e-90 >At3g03380.1 DegP protease / contains similarity to degP GI:2623992 from [Bradyrhizobium japonicum] Length = 627 Score = 328 bits (840), Expect = 2e-90 Identities = 165/201 (82%), Positives = 180/201 (89%) Frame = -3 Query: 623 DFGFFRYDPGAIKFLKYDEIPLAPEAASVGLEIRVVGNDSGEKVSILAGTLARLDREAPY 444 DFGFF YDP A++FL Y EIPLAPEAASVGLEIRVVGNDSGEKVSILAGTLARLDR+AP+ Sbjct: 109 DFGFFCYDPSAVQFLTYQEIPLAPEAASVGLEIRVVGNDSGEKVSILAGTLARLDRDAPH 168 Query: 443 YKKDGYNDFNTFYMQAASGTKGGSSGSPVVDCQGRAVALNAGSKSSSASAFFLPLERVVR 264 YKKDGYNDFNTFYMQAASGTKGGSSGSPV+D QGRAVALNAGSKSSSASAFFLPL+RVVR Sbjct: 169 YKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWQGRAVALNAGSKSSSASAFFLPLQRVVR 228 Query: 263 ALDLIRDSWDAFGTKTESVYIPRGTLQATFQHKGFEETRRLGLRNETEQMVRVVSPEGET 84 AL ++ S D+ K ++V+IPRGTLQ TF HKGF+E RRLGLR+ETEQ+VR SP GET Sbjct: 229 ALSFLQKSIDSRTDKPKAVHIPRGTLQMTFLHKGFDEIRRLGLRSETEQVVRHASPTGET 288 Query: 83 GMLVVDSVVPKGPAHKHLEPG 21 GMLVVDSVVP GPA KHLEPG Sbjct: 289 GMLVVDSVVPSGPADKHLEPG 309 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,562,046 Number of Sequences: 27288 Number of extensions: 333028 Number of successful extensions: 1003 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 974 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 999 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 999514432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18181500|gb|BM382710.1|BM382710 MEST553-F08.univ ISUM6 Zea mays cDNA clone MEST553-F08 3', mRNA sequence (491 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g16070.1 expressed protein / ;supported by full-length cDN... 65 1e-11 >At2g16070.1 expressed protein / ;supported by full-length cDNA: Ceres:95679. Length = 307 Score = 65.5 bits (158), Expect = 1e-11 Identities = 27/46 (58%), Positives = 36/46 (77%) Frame = -3 Query: 474 RRAPLRCPPGKAMVVENGRARCVVKERVEVPFDAVLAPPSSRYGLG 337 +R P +CPPGK +V+E+G ARC+VKERVE+PFD+V+A YG G Sbjct: 262 KRTPNQCPPGKVLVIEDGEARCLVKERVEIPFDSVVAKRDVTYGYG 307 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,196,161 Number of Sequences: 27288 Number of extensions: 287489 Number of successful extensions: 989 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 914 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 981 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 639433100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18181281|gb|BM382491.1|BM382491 MEST550-D12.univ ISUM6 Zea mays cDNA clone MEST550-D12 3', mRNA sequence (640 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g45760.1 G-protein beta family / ;supported by full-lengt... 204 4e-53 >At5g45760.1 G-protein beta family / ;supported by full-length cDNA: Ceres:104220. Length = 360 Score = 204 bits (518), Expect = 4e-53 Identities = 108/209 (51%), Positives = 140/209 (66%) Frame = -3 Query: 635 LREAHTSICSSVQFIPWRPWTAITGGLDSKLAAWDFSKGRTLFSIDYGSPELQNGSSSGS 456 LR HTSICSSVQFIPWRPW ITGGLDSKL WDFSKGR+ ID+GS ++ + Sbjct: 143 LRAGHTSICSSVQFIPWRPWEVITGGLDSKLVLWDFSKGRSQKIIDFGS------DTNNN 196 Query: 455 AGQCFNPAFVHSVAVSEEGILGGLYKVCAVARGDGAVDVVDLEYELAPAKSKGPPRAAIL 276 +GQC NPAFVHS+A+ E ++ L K+CAVARGDG V+++++E EL+ KG Sbjct: 197 SGQCLNPAFVHSIAIPEMDMVDKLDKICAVARGDGIVNLINIESELS---RKG------- 246 Query: 275 TTRSKGAELGDGSCNQSRAKRIHLDYTMGGHTAAVSCVAFSAFGEKGKFLISGGNDASVK 96 T SKG+ S + + KR+ LDY++GGH +AVSCVAFS F EKG+FLISGGND +VK Sbjct: 247 -TSSKGS---SSSSSNNVVKRVCLDYSVGGHNSAVSCVAFSLFQEKGRFLISGGNDKTVK 302 Query: 95 LWDWSKGFYSETNSKVDLVLDIDVKKKKK 9 +WD K N+ +L +++ KK Sbjct: 303 IWDCFKCLDPNNNNNNSDLLHLNINLSKK 331 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,346,688 Number of Sequences: 27288 Number of extensions: 360472 Number of successful extensions: 1572 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1558 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1044135612 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18180917|gb|BM382127.1|BM382127 MEST545-A07.univ ISUM6 Zea mays cDNA clone MEST545-A07 3', mRNA sequence (423 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g01300.1 putative protein / several hypothetical proteins ... 106 5e-24 >At5g01300.1 putative protein / several hypothetical proteins - different bacteria; supported by cDNA: gi_20465384 Length = 162 Score = 106 bits (264), Expect = 5e-24 Identities = 51/88 (57%), Positives = 65/88 (72%) Frame = -2 Query: 422 IPPATRGLPEGFSGAAGAGPGRDQLGGLQEGVNDWKQPGWRGPVPPSHGHRIQFKLYALD 243 IPP +GLPEG+SG DQ G++EG ND K PGWRGP+ PSHGHR QFKL+ALD Sbjct: 77 IPPEMKGLPEGYSG------NEDQTTGIREGNNDHKIPGWRGPLLPSHGHRFQFKLFALD 130 Query: 242 DEVHLGNKVTRDKLMEAIDGHVLEEAEL 159 D+ +G+ VT+++L+ AI+GHVL EA L Sbjct: 131 DKPKIGHTVTKERLLIAIEGHVLGEAIL 158 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,764,399 Number of Sequences: 27288 Number of extensions: 310375 Number of successful extensions: 2519 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2352 length of database: 11,516,596 effective HSP length: 89 effective length of database: 9,087,964 effective search space used: 463486164 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18180736|gb|BM381946.1|BM381946 MEST542-D01.univ ISUM6 Zea mays cDNA clone MEST542-D01 3', mRNA sequence (493 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13070.1 putative protein / CGI-107 protein - Homo sapiens... 124 3e-29 At3g09000.1 expressed protein / identical to hypothetical pro... 47 7e-06 >At5g13070.1 putative protein / CGI-107 protein - Homo sapiens, EMBL:AF151865 Length = 183 Score = 124 bits (311), Expect = 3e-29 Identities = 57/89 (64%), Positives = 73/89 (81%) Frame = -3 Query: 488 RAMDVVVRNVSLRGLIEVEERASYRPHPDRPDDWTQFRQETTIRCRPLAALAAVAEKVET 309 R+M + +N+SL+ IEVEER Y PHPD P WT QET+IR +PL+ALA++AEKVE Sbjct: 93 RSMQLTTKNISLKKFIEVEERIRYDPHPDNPSAWTVCSQETSIRIKPLSALASMAEKVEQ 152 Query: 308 RCAERFLQNSAKGREVVERICRYLEAESA 222 +CAE+F+QNSAKGREV+ERIC+Y+EAESA Sbjct: 153 KCAEKFMQNSAKGREVMERICKYMEAESA 181 >At3g09000.1 expressed protein / identical to hypothetical protein GB:AAD56316 [Arabidopsis thaliana]; supported by cDNA: gi_16226224_gb_AF428276.1_AF428276 Length = 541 Score = 46.6 bits (109), Expect = 7e-06 Identities = 38/98 (38%), Positives = 50/98 (50%), Gaps = 6/98 (6%) Frame = -1 Query: 484 PWTSSCATS-----ASGASSRSRSAPPTDHIR-TGPTTGRSSGRRPRSGAARSRPSPPSL 323 P TSS + + +S SSRS S P T R T PTT S+ R + A+ SR S P+ Sbjct: 134 PQTSSSSVAGLRRPSSSGSSRSTSRPATPTRRSTTPTT--STSRPVTTRASNSRSSTPTS 191 Query: 322 RRSRPGAPRGFCRIAPRGGRSSSGSAGTSRPSPPAPRP 209 R + A APR +SSGSA ++ P+ PRP Sbjct: 192 RATLTAARATTSTAAPRTTTTSSGSARSATPTRSNPRP 229 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,038,778 Number of Sequences: 27288 Number of extensions: 308263 Number of successful extensions: 2058 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1923 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 639433100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18180489|gb|BM381699.1|BM381699 MEST538-G12.univ ISUM6 Zea mays cDNA clone MEST538-G12 3', mRNA sequence (566 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g52780.1 putative protein / similar to unknown protein (pi... 110 5e-25 >At5g52780.1 putative protein / similar to unknown protein (pir||T04431);supported by full-length cDNA: Ceres:26264. Length = 168 Score = 110 bits (275), Expect = 5e-25 Identities = 54/117 (46%), Positives = 76/117 (64%) Frame = -2 Query: 523 EASLAKQDGGGSNGEVDDDDELPQPVFDRILRRIAFTVGLPMASGVALLNVYDALKRGQG 344 ++S + G + + +DD +PQ VF+R++ RI +VG P+ GVA+L V + LK Sbjct: 51 QSSRTSEKPGRPDPDPEDDPPIPQEVFERMMGRIVVSVGTPLGLGVAILKVLEVLKDRNV 110 Query: 343 VVVPSWVPLLTILVAFGTSALGIAYGTLSASWDPDKEGSLLGIDEARANWPVLWQEE 173 VP WVP LT LV FG+SALGIAYG+LS + DP K SL G+ EA+ NW +W+E+ Sbjct: 111 WDVPLWVPYLTTLVTFGSSALGIAYGSLSTNLDPAKTNSLFGLKEAKENWVEMWKED 167 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,671,883 Number of Sequences: 27288 Number of extensions: 379755 Number of successful extensions: 2200 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1921 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2148 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 841443256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18180308|gb|BM381518.1|BM381518 MEST535-G11.univ ISUM6 Zea mays cDNA clone MEST535-G11 3', mRNA sequence (591 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66090.1 expressed protein / ;supported by full-length cD... 215 1e-56 >At5g66090.1 expressed protein / ;supported by full-length cDNA: Ceres:124621. Length = 210 Score = 215 bits (548), Expect = 1e-56 Identities = 104/130 (80%), Positives = 120/130 (92%) Frame = -2 Query: 587 VKHVLLPVLDRNPYLSEGTRQAAATTASLAKKYGADITVVVIDDKPKESVPEHDTQMSSI 408 VKH+LLPV+DRNPYLSEGTRQAAATT SLAKKYGADITVVVID++ +ES EH+TQ+S+I Sbjct: 81 VKHLLLPVIDRNPYLSEGTRQAAATTTSLAKKYGADITVVVIDEEKRESSSEHETQVSNI 140 Query: 407 RWHLSEGGFSEFRLMERLGEGQKPTVIIGEVADEWDLDLVVLSMEAIHSKHVDGNLLAEF 228 RWHLSEGGF EF+L+ERLGEG+K T IIGEVADE ++LVV+SMEAIHSK++D NLLAEF Sbjct: 141 RWHLSEGGFEEFKLLERLGEGKKATAIIGEVADELKMELVVMSMEAIHSKYIDANLLAEF 200 Query: 227 IPCPVLLLPL 198 IPCPVLLLPL Sbjct: 201 IPCPVLLLPL 210 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,853,352 Number of Sequences: 27288 Number of extensions: 315887 Number of successful extensions: 987 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 980 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 913055448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18179945|gb|BM381155.1|BM381155 MEST530-F06.univ ISUM6 Zea mays cDNA clone MEST530-F06 3', mRNA sequence (533 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14615.1 Expressed protein / ; supported by full-length cD... 99 1e-21 >At4g14615.1 Expressed protein / ; supported by full-length cDNA: Ceres: 42223. Length = 76 Score = 99.4 bits (246), Expect = 1e-21 Identities = 46/69 (66%), Positives = 54/69 (77%) Frame = -2 Query: 532 GTSKGILEIAKFGVYVSVPVALTYLVATDSKTLKKLMGLRPYVVYPPEGPRPPPPEELRE 353 GTSKG+LEI KFGVYV+VP+ L Y A +S +KK MG R YVVYP E PRPP P+ELRE Sbjct: 5 GTSKGVLEIVKFGVYVAVPIVLMYTFANNSTNIKKFMGNRSYVVYPEEAPRPPSPDELRE 64 Query: 352 RAREIARKR 326 ARE+ARK+ Sbjct: 65 MARELARKK 73 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,992,117 Number of Sequences: 27288 Number of extensions: 360139 Number of successful extensions: 2787 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1832 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2680 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 754220208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18179906|gb|BM381116.1|BM381116 MEST530-B06.univ ISUM6 Zea mays cDNA clone MEST530-B06 3', mRNA sequence (461 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g57540.1 hypothetical protein / contains similarity to T-b... 148 1e-36 >At1g57540.1 hypothetical protein / contains similarity to T-box domain GI:5931592 from (Cynops pyrrhogaster) Length = 103 Score = 148 bits (374), Expect = 1e-36 Identities = 66/84 (78%), Positives = 78/84 (92%) Frame = -2 Query: 460 SEGEVMRPESKPCSRLMRQTAGIFSVGGGLAFWVLCRLHYGPRITVPRSLRWASCGAVSM 281 SEG++MR ++KPCSRLM+QTA IF+VGG L FWVLCRLHYGPRITVPRSLRWA CGA+S+ Sbjct: 10 SEGDLMRSDAKPCSRLMKQTAAIFTVGGALGFWVLCRLHYGPRITVPRSLRWAGCGALSV 69 Query: 280 SATSALLVRLFSPECEPQNIAAFD 209 S ++A+LVRLFSPECEPQNIAA+D Sbjct: 70 STSTAMLVRLFSPECEPQNIAAYD 93 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,146,971 Number of Sequences: 27288 Number of extensions: 237599 Number of successful extensions: 637 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 632 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 560070056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18179790|gb|BM381000.1|BM381000 MEST528-D06.univ ISUM6 Zea mays cDNA clone MEST528-D06 3', mRNA sequence (481 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08170.1 putative protein / hypothetical bacterial proteins 80 5e-16 >At5g08170.1 putative protein / hypothetical bacterial proteins Length = 383 Score = 80.1 bits (196), Expect = 5e-16 Identities = 40/61 (65%), Positives = 43/61 (69%), Gaps = 1/61 (1%) Frame = -1 Query: 481 IANGGIIAPSFGDRW-DEEAYAVLQKAFPDHEVVMVEGGREIALGGGNIHCITQQQPVRP 305 IANGGIIAP FGD D+EA VL FP H VV +E REI L GGNIHCITQQQP P Sbjct: 316 IANGGIIAPQFGDPIRDKEAIRVLSDTFPHHSVVGIENAREIVLAGGNIHCITQQQPAEP 375 Query: 304 S 302 + Sbjct: 376 T 376 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,956,908 Number of Sequences: 27288 Number of extensions: 279626 Number of successful extensions: 1291 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1072 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1276 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 614270384 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18179784|gb|BM380994.1|BM380994 MEST528-C08.univ ISUM6 Zea mays cDNA clone MEST528-C08 3', mRNA sequence (579 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g40500.1 hypothetical protein / ; supported by cDNA: gi_1... 142 2e-34 >At5g40500.1 hypothetical protein / ; supported by cDNA: gi_17644174 Length = 123 Score = 142 bits (357), Expect = 2e-34 Identities = 65/104 (62%), Positives = 78/104 (74%) Frame = -2 Query: 542 RFAVVCRKNRDGRDRERDGKEHKHPFKVVEITPPPRCLGVRCFPTNIHCGESVTIEGQAY 363 R + CRK GRD+ +P+KV+EITPPP+ LG+RC P N+ CGE+V IEGQ Y Sbjct: 26 RLQINCRKKEKGRDQSH------YPYKVIEITPPPKSLGIRCLPHNLQCGENVMIEGQTY 79 Query: 362 TVSAVTHRYQLRKGRYEPSEKRLDVLSTGRYILNLYLQNLLDQS 231 T+SAVTHRYQLRKG+YEPSE+RLDVLS RY+LNLY NLL S Sbjct: 80 TISAVTHRYQLRKGKYEPSERRLDVLSAARYVLNLYFDNLLQNS 123 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,682,162 Number of Sequences: 27288 Number of extensions: 359293 Number of successful extensions: 2057 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1994 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 877249352 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18179731|gb|BM380941.1|BM380941 MEST527-E07.univ ISUM6 Zea mays cDNA clone MEST527-E07 3', mRNA sequence (568 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20180.1 ribosomal protein L36-like / ribosomal protein L3... 74 4e-14 >At5g20180.1 ribosomal protein L36-like / ribosomal protein L36 - Synechocystis sp., PIR:S77481;supported by full-length cDNA: Ceres:28109. Length = 103 Score = 74.3 bits (181), Expect = 4e-14 Identities = 47/109 (43%), Positives = 60/109 (54%), Gaps = 13/109 (11%) Frame = -2 Query: 525 MKVRAAVKRLCRFCKVVKRRGIVFVQCTANAKHKQRQGFSTIA------------EAAAV 382 MKVR++VK++C FCK VKRRG V+V C++N KHKQRQGFS+ A A+ Sbjct: 1 MKVRSSVKKMCEFCKTVKRRGRVYVICSSNPKHKQRQGFSSFAYEGITPSPLFAEPIASQ 60 Query: 381 SCVHLPPPPPASGSASAAAFAETSKVARQEMSMKFNWRLGLAA-LFKNG 238 V LP ++G AS R + F WR GLA+ LFK G Sbjct: 61 ELVRLPGQGVSAGLASLLH-------KRPMPTAYFGWRSGLASILFKQG 102 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,310,214 Number of Sequences: 27288 Number of extensions: 365605 Number of successful extensions: 2973 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1915 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2756 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 841443256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18179710|gb|BM380920.1|BM380920 MEST527-B09.univ ISUM6 Zea mays cDNA clone MEST527-B09 3', mRNA sequence (655 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g09620.1 putative protein / hypothetical protein F6E13.15 ... 195 2e-50 >At4g09620.1 putative protein / hypothetical protein F6E13.15 - Arabidopsis thaliana,PIR2:T00682 Length = 210 Score = 195 bits (496), Expect = 2e-50 Identities = 87/133 (65%), Positives = 109/133 (81%) Frame = -1 Query: 625 EECKRVLTPLGFSSEDAEKMLKKAFGWTHSPYWSEEREKEVPTAEAVAGVLDYIRSLGLS 446 EECK L+ FS E+ +K+L KAFG HSPYW+EER KE P E + +L+++RSLGLS Sbjct: 78 EECKEALSCFDFSVEEKDKILGKAFGHIHSPYWTEERVKENPKVETLNQILEFLRSLGLS 137 Query: 445 DEDLGRLLKKFPEVLGCDLDGEVRPNVGKLDSDWGINGKTLRSLLLRNPKVLGYNVDCRG 266 DEDL +++KKFPEVLGC L+ E++PN+G L++ WGI GK LR+LLLRNPKVLGYNVDC+G Sbjct: 138 DEDLHKVMKKFPEVLGCSLEEEMKPNIGILENQWGITGKQLRNLLLRNPKVLGYNVDCKG 197 Query: 265 DCMAQCTRCWVRF 227 DC+AQCTRCWVRF Sbjct: 198 DCVAQCTRCWVRF 210 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,565,023 Number of Sequences: 27288 Number of extensions: 421462 Number of successful extensions: 2366 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1948 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2274 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1088756792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18179688|gb|BM380898.1|BM380898 MEST526-G09.univ ISUM6 Zea mays cDNA clone MEST526-G09 3', mRNA sequence (580 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g02530.1 chloroplast thylakoid lumen protein / SP:022773 ;... 122 2e-28 >At4g02530.1 chloroplast thylakoid lumen protein / SP:022773 ;TL16_ARATH; supported by full-length cDNA: Ceres: 8114. Length = 216 Score = 122 bits (305), Expect = 2e-28 Identities = 63/98 (64%), Positives = 76/98 (77%) Frame = -1 Query: 580 RLSKVGQAIDNDDLPAASSVLGPSSDAQWVQNINAAFSKLSSSPEQRNVVDSFNSSLATL 401 +LSKVGQAI+N+DLPAA VLG D +WV+ +N AF+KLS+SPE+ V++FNSSLA+L Sbjct: 118 KLSKVGQAIENNDLPAAGLVLGKGIDTEWVKTVNLAFTKLSTSPEENTEVEAFNSSLASL 177 Query: 400 FTSVSKLDPESSKSAFVSSATALEKWIALAGLGGQLKG 287 TSV+K D ESSK AFVSSA A EKW L GL QLKG Sbjct: 178 ITSVNKNDIESSKLAFVSSAGAFEKWTTLTGLLEQLKG 215 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,470,219 Number of Sequences: 27288 Number of extensions: 304407 Number of successful extensions: 1843 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1090 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1402 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 877249352 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|18179661|gb|BM380871.1|BM380871 MEST526-C12.univ ISUM6 Zea mays cDNA clone MEST526-C12 3', mRNA sequence (546 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60190.1 putative protein / predicted proteins, C.elegans ... 109 8e-25 At4g35800.1 DNA-directed RNA polymerase (EC 2.7.7.6) II largest ... 62 2e-10 At4g18670.1 extensin-like protein / extensin-like protein - m... 55 2e-08 At3g24550.1 protein kinase, putative / similar to GB:BAA24694... 54 5e-08 At1g68725.1 arabinogalactan-protein, putative (AGP19) / non-c... 53 9e-08 At1g36150.1 non-specific lipid transfer protein, putative / s... 52 2e-07 At2g14890.1 arabinogalactan-protein (AGP9) / identical to gi|... 52 3e-07 At3g50580.1 proline-rich protein / 51 4e-07 At3g24400.1 protein kinase, putative / similar to protein kin... 51 4e-07 At1g26150.1 Pto kinase interactor, putative / similar to Pto ... 49 1e-06 At1g62763.1 hypothetical protein / 49 2e-06 At3g60280.1 uclacyanin 3 / ; supported by cDNA: gi_1518058_g... 49 2e-06 At2g42840.1 En/Spm-like transposon protein / related to En/Sp... 47 5e-06 >At5g60190.1 putative protein / predicted proteins, C.elegans and D.melanogaster Length = 226 Score = 109 bits (273), Expect = 8e-25 Identities = 60/141 (42%), Positives = 84/141 (59%) Frame = +1 Query: 121 EERVLFHGDVVLIRSDLAILRGPCFINDRIIAFYFAHLSASLQDDDLLLLPPFIPYLLSN 300 ++++L + DVVL RSDL IL GP F+NDR+I FY + LS + L+PP I + +SN Sbjct: 7 DDKILSYEDVVLRRSDLDILNGPIFLNDRVIEFYLSFLSTVHSSTTISLIPPSIAFWISN 66 Query: 301 LPDSAAVAAVAEPLRLASRRLGLLPVNDNADASIAEGGSHWTLLILDNITSPSVPRFVHH 480 PD+ + +PL L + L +LPVNDN++ +AEGG HW+LL+ FVHH Sbjct: 67 CPDTEYLKDFMKPLNLRDKDLLILPVNDNSNVEVAEGGLHWSLLVY----YKEANTFVHH 122 Query: 481 DSIAGAPNLPIAARLADALRP 543 DS G N A +L A+ P Sbjct: 123 DSYMGV-NRWSAKQLFKAVSP 142 >At4g35800.1 DNA-directed RNA polymerase (EC 2.7.7.6) II largest chain / Length = 1840 Score = 62.0 bits (149), Expect = 2e-10 Identities = 57/169 (33%), Positives = 81/169 (47%), Gaps = 7/169 (4%) Frame = +2 Query: 53 SSSSPSSSKRRLGWALDPTPRRERSGCFSTVTWCSFAPTSQSFAVPALSTTASLPSTSHT 232 S +SP+ S G++ S +S T S++PTS S++ + S + + PS S T Sbjct: 1574 SPTSPTYSPSSPGYSPTSPAYSPTSPSYSP-TSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1632 Query: 233 SPPASRTTTCFCFRPSSPTFSPTSLTRPP-----SPPSPSRSDSPPAASGCFLSTTMPMP 397 SP S T+ + P+SP +SPTS P SP SPS S + P+ S P Sbjct: 1633 SPSYSPTSPAYS--PTSPAYSPTSPAYSPTSPSYSPTSPSYSPTSPSYS----------P 1680 Query: 398 PSPRAVPTGP-YSSLITSLAPPCPALCTTTASLERPTSQSL-PGSPTHS 538 SP PT P YS + +P P T+ S PTS S P SP+++ Sbjct: 1681 TSPSYSPTSPSYSPTSPAYSPTSPGYSPTSPSYS-PTSPSYGPTSPSYN 1728 Score = 60.1 bits (144), Expect = 7e-10 Identities = 57/185 (30%), Positives = 88/185 (46%), Gaps = 11/185 (5%) Frame = +2 Query: 17 FFLGPQFRIAI*SSSSPSSSKRRLGWALDPTPRRERSGCFSTVTWCSFAPTSQSFAVPAL 196 + L P R++ S + S + ++ +P S + T ++PTS ++ + Sbjct: 1512 YLLSPNMRLSPMSDAQFSPYVGGMAFSPSSSPGYSPSSPGYSPTSPGYSPTSPGYSPTSP 1571 Query: 197 STTASLPSTSHTSPPASRTTTCFCFRPSSPTFSPTSLTRPP-----SPPSPSRSDSPPAA 361 + + P+ S +SP S T+ + P+SP++SPTS + P SP SPS S + P+ Sbjct: 1572 GYSPTSPTYSPSSPGYSPTSP--AYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1629 Query: 362 S--GCFLSTTMP--MPPSPRAVPTGP-YSSLITSLAPPCPALCTTTASLERPTSQSL-PG 523 S S T P P SP PT P YS S +P P+ T+ S PTS S P Sbjct: 1630 SPTSPSYSPTSPAYSPTSPAYSPTSPAYSPTSPSYSPTSPSYSPTSPSYS-PTSPSYSPT 1688 Query: 524 SPTHS 538 SP++S Sbjct: 1689 SPSYS 1693 Score = 57.8 bits (138), Expect = 4e-09 Identities = 48/167 (28%), Positives = 77/167 (45%), Gaps = 5/167 (2%) Frame = +2 Query: 53 SSSSPSSSKRRLGWALDPTPRRERSGCFSTVTWCSFAPTSQSFAVPALSTTASLPSTSHT 232 S +SPS S ++ S +S T S++PTS S++ + S + + PS S T Sbjct: 1630 SPTSPSYSPTSPAYSPTSPAYSPTSPAYSP-TSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1688 Query: 233 SPPASRTTTCFC-----FRPSSPTFSPTSLTRPPSPPSPSRSDSPPAASGCFLSTTMPMP 397 SP S T+ + + P+SP++SPTS + P+ PS + + + S + P Sbjct: 1689 SPSYSPTSPAYSPTSPGYSPTSPSYSPTSPSYGPTSPSYNPQSAKYSPSIAY------SP 1742 Query: 398 PSPRAVPTGPYSSLITSLAPPCPALCTTTASLERPTSQSLPGSPTHS 538 + R P PYS + +P P+ T+ S P SPT+S Sbjct: 1743 SNARLSPASPYSPTSPNYSPTSPSYSPTSPSYS-------PSSPTYS 1782 >At4g18670.1 extensin-like protein / extensin-like protein - maize, PIR2:S49915 Length = 839 Score = 55.5 bits (132), Expect = 2e-08 Identities = 49/133 (36%), Positives = 64/133 (47%), Gaps = 10/133 (7%) Frame = +2 Query: 161 APTSQSFAVPALSTTAS--LPSTSHT------SPPASRTT-TCFCFRPSSPTFSPTSLTR 313 +P S S STT S P TS T SPP+S TT T PSSPT + Sbjct: 448 SPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSP 507 Query: 314 PPSPPSPSRSDSPPAASGCFLSTTMPMP-PSPRAVPTGPYSSLITSLAPPCPALCTTTAS 490 P SP +PS SPP+ S +S + P+ PSP + PT P S PP P+ T ++ Sbjct: 508 PSSPTTPSPGGSPPSPS---ISPSPPITVPSPPSTPTSPGS-------PPSPSSPTPSSP 557 Query: 491 LERPTSQSLPGSP 529 + P + S P +P Sbjct: 558 IPSPPTPSTPPTP 570 Score = 52.8 bits (125), Expect = 1e-07 Identities = 42/138 (30%), Positives = 61/138 (43%), Gaps = 23/138 (16%) Frame = +2 Query: 188 PALSTTASLPSTSHT------SPPASRTTTCFCFRPSSPTFSPTSLTRPPSPPS-PSRSD 346 P T P +S T SPP+S TT P SP+ SP+ PSPPS P+ Sbjct: 485 PTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPG 544 Query: 347 SPPAASGCFLSTTMPMPPSPRA--------------VPTGPYS--SLITSLAPPCPALCT 478 SPP+ S S+ +P PP+P +P+ P++ S +S +PP P + Sbjct: 545 SPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIP 604 Query: 479 TTASLERPTSQSLPGSPT 532 + + S P +PT Sbjct: 605 SPPIVGPTPSSPPPSTPT 622 Score = 51.2 bits (121), Expect = 3e-07 Identities = 43/122 (35%), Positives = 54/122 (44%), Gaps = 3/122 (2%) Frame = +2 Query: 188 PALSTTASLPSTSHT--SPPASRTT-TCFCFRPSSPTFSPTSLTRPPSPPSPSRSDSPPA 358 P+ S S PST+ + SPP S TT T PSSPT + P SP +P+ SPP+ Sbjct: 450 PSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPS 509 Query: 359 ASGCFLSTTMPMPPSPRAVPTGPYSSLITSLAPPCPALCTTTASLERPTSQSLPGSPTHS 538 + P PSP P P S + P P T+ P S P SPT S Sbjct: 510 S---------PTTPSPGGSPPSPSISPSPPITVPSPPSTPTS-----PGSPPSPSSPTPS 555 Query: 539 AP 544 +P Sbjct: 556 SP 557 Score = 50.1 bits (118), Expect = 7e-07 Identities = 39/122 (31%), Positives = 52/122 (41%), Gaps = 2/122 (1%) Frame = +2 Query: 161 APTSQSFAVPALSTTASLPST--SHTSPPASRTTTCFCFRPSSPTFSPTSLTRPPSPPSP 334 +P S S + T S PST S SPP+ + T PSSP SP + + PP+P SP Sbjct: 519 SPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPT-----PSSPIPSPPTPSTPPTPISP 573 Query: 335 SRSDSPPAASGCFLSTTMPMPPSPRAVPTGPYSSLITSLAPPCPALCTTTASLERPTSQS 514 ++ P S F + P PSP P P ++ P T +L P Sbjct: 574 GQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTPTPGTLLHPHHLL 633 Query: 515 LP 520 LP Sbjct: 634 LP 635 >At3g24550.1 protein kinase, putative / similar to GB:BAA24694 from [Arabidopsis thaliana] (Plant Cell Physiol. 38 (3), 248-258 (1997));supported by full-length cDNA: Ceres:17909. Length = 652 Score = 53.9 bits (128), Expect = 5e-08 Identities = 41/128 (32%), Positives = 58/128 (45%), Gaps = 2/128 (1%) Frame = +2 Query: 164 PTSQSFAVPALSTTASLPSTSHTSPPASRTTTCFCFRPSSPTFSPTSLTRPPS--PPSPS 337 PT+ + P + ++ P+T+ +SPP S +T PSSP PPS PPSP Sbjct: 19 PTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPL--------PPSLPPPSPP 70 Query: 338 RSDSPPAASGCFLSTTMPMPPSPRAVPTGPYSSLITSLAPPCPALCTTTASLERPTSQSL 517 S +PP + P PPSP P+ P S + PP T + S R S + Sbjct: 71 GSLTPPLPQPSPSAPITPSPPSP-TTPSNPRSPPSPNQGPP----NTPSGSTPRTPSNTK 125 Query: 518 PGSPTHSA 541 P P+ S+ Sbjct: 126 PSPPSDSS 133 Score = 52.4 bits (124), Expect = 2e-07 Identities = 47/116 (40%), Positives = 53/116 (45%), Gaps = 2/116 (1%) Frame = +2 Query: 188 PALSTTASLPSTSHTSPPASRTTTCFCFRPSSPTFSPTSLTRPPS-PPSPS-RSDSPPAA 361 P+ TT PS S SPP + TTT P SP T P S PPSPS S SPP + Sbjct: 5 PSPGTT---PSPSPPSPPTNSTTTT----PPPAASSPPPTTTPSSPPPSPSTNSTSPPPS 57 Query: 362 SGCFLSTTMPMPPSPRAVPTGPYSSLITSLAPPCPALCTTTASLERPTSQSLPGSP 529 S P+PPS P P SL L P P+ T S PT+ S P SP Sbjct: 58 S--------PLPPS--LPPPSPPGSLTPPLPQPSPS-APITPSPPSPTTPSNPRSP 102 Score = 47.8 bits (112), Expect = 4e-06 Identities = 34/93 (36%), Positives = 43/93 (45%), Gaps = 4/93 (4%) Frame = +2 Query: 278 SSPTFSPTSLTRPPSPPSPSRSDSPPAASGCFLSTTMPM--PPSPRAVPTG--PYSSLIT 445 ++P+ T PPSPP+ S + +PP A+ TT P PPSP T P S L Sbjct: 3 TAPSPGTTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPP 62 Query: 446 SLAPPCPALCTTTASLERPTSQSLPGSPTHSAP 544 SL PP P SL P Q P +P +P Sbjct: 63 SLPPPSP-----PGSLTPPLPQPSPSAPITPSP 90 >At1g68725.1 arabinogalactan-protein, putative (AGP19) / non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 53.1 bits (126), Expect = 9e-08 Identities = 42/139 (30%), Positives = 53/139 (37%), Gaps = 3/139 (2%) Frame = +2 Query: 137 STVTWCSFAPTSQSFAVPALST---TASLPSTSHTSPPASRTTTCFCFRPSSPTFSPTSL 307 S VT + AP + A P + T + P S PPAS T P+SP + Sbjct: 30 SPVTSTTTAPPPTTAAPPTTAAPPPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAP 89 Query: 308 TRPPSPPSPSRSDSPPAASGCFLSTTMPMPPSPRAVPTGPYSSLITSLAPPCPALCTTTA 487 P+ P P SPPA++ T P P SP PT P PP PA Sbjct: 90 VISPATPPPQPPQSPPASA----PTVSPPPVSPPPAPTSP---------PPTPASPPPAP 136 Query: 488 SLERPTSQSLPGSPTHSAP 544 + P S P +P P Sbjct: 137 ASPPPAPASPPPAPVSPPP 155 >At1g36150.1 non-specific lipid transfer protein, putative / similar to non-specific lipid transfer protein GI:2347087 from [Phaseolus vulgaris] Length = 256 Score = 52.0 bits (123), Expect = 2e-07 Identities = 47/160 (29%), Positives = 70/160 (43%) Frame = +2 Query: 62 SPSSSKRRLGWALDPTPRRERSGCFSTVTWCSFAPTSQSFAVPALSTTASLPSTSHTSPP 241 S S R +G+ LD T ++ + P + PA ST S P S T+ P Sbjct: 89 SALESSREMGFVLDDT----KALAMPKICNVPIDPNCD-VSTPAASTPVSPPVESPTTSP 143 Query: 242 ASRTTTCFCFRPSSPTFSPTSLTRPPSPPSPSRSDSPPAASGCFLSTTMPMPPSPRAVPT 421 +S SP +P+S SPP P R SPP + + PP+ R+ P Sbjct: 144 SSA---------KSPAITPSSPAVSHSPP-PVRHSSPPVSHSS-PPVSHSSPPTSRSSPA 192 Query: 422 GPYSSLITSLAPPCPALCTTTASLERPTSQSLPGSPTHSA 541 +SS + + + P A+ ++TAS R S S SP+ S+ Sbjct: 193 VSHSSPVVAASSPVKAVSSSTASSPRAASPSPSPSPSISS 232 >At2g14890.1 arabinogalactan-protein (AGP9) / identical to gi|10880495|gb|AAG24277; supported by cDNA: gi_13265425_gb_AF324669.2_AF324669 Length = 191 Score = 51.6 bits (122), Expect = 3e-07 Identities = 47/140 (33%), Positives = 56/140 (39%), Gaps = 12/140 (8%) Frame = +2 Query: 161 APTSQSFAVPALSTTASLPSTSHTSPPASR-----------TTTCFCFRPSSPTFSPTSL 307 APTS A PA T + P + T PP S TT P P SP Sbjct: 22 APTSPPTATPA-PPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPA 80 Query: 308 TRPPSPPSPSRSDSPPAASGCFLSTTMPMPPSPRAVPTGPYSSLITSLAP-PCPALCTTT 484 + PP+ P P S PP AS P P +P V T P + L + A P PA TT Sbjct: 81 SPPPATPPPVASPPPPVAS--------PPPATPPPVATPPPAPLASPPAQVPAPA-PTTK 131 Query: 485 ASLERPTSQSLPGSPTHSAP 544 P+ S P P+ AP Sbjct: 132 PDSPSPSPSSSPPLPSSDAP 151 >At3g50580.1 proline-rich protein / Length = 265 Score = 50.8 bits (120), Expect = 4e-07 Identities = 38/124 (30%), Positives = 53/124 (42%), Gaps = 1/124 (0%) Frame = +2 Query: 167 TSQSFAVPALSTTASLPSTSHTSPPASRTTTCFCFRPSSPTFSPTSLTRPPSPPSPSRSD 346 T + + PA+S + S P S PS+P+ P + + P PP+P +S Sbjct: 64 TYSNGSAPAISISPSTPIPS---------------TPSTPSPPPPAPKKSPPPPTPKKSP 108 Query: 347 SPPAASGCFLSTTMPMPPSPRAVPTGPYSSLITSLAPPCPALCTTTASLERPT-SQSLPG 523 SPP+ + T PSP P SL PP P +T SL PT +S P Sbjct: 109 SPPSLTPFVPHPTPKKSPSPPPTP---------SLPPPAPKKSPSTPSLPPPTPKKSPPP 159 Query: 524 SPTH 535 P+H Sbjct: 160 PPSH 163 >At3g24400.1 protein kinase, putative / similar to protein kinase GB:BAA24694 from [Arabidopsis thaliana] Length = 694 Score = 50.8 bits (120), Expect = 4e-07 Identities = 40/113 (35%), Positives = 50/113 (43%) Frame = +2 Query: 188 PALSTTASLPSTSHTSPPASRTTTCFCFRPSSPTFSPTSLTRPPSPPSPSRSDSPPAASG 367 P + T S P T PP+ T + P SP+ LT P P SP R SPP S Sbjct: 109 PPPAITPSPPLTPSPLPPSPTTPSP---PPPSPSIPSPPLTPSPPPSSPLRPSSPPPPSP 165 Query: 368 CFLSTTMPMPPSPRAVPTGPYSSLITSLAPPCPALCTTTASLERPTSQSLPGS 526 ST P P P + PT P + SL+PP PA + + T + PGS Sbjct: 166 ATPSTP-PRSPPPPSTPTPP--PRVGSLSPPPPA--SPSGGRSPSTPSTTPGS 213 Score = 50.1 bits (118), Expect = 7e-07 Identities = 43/127 (33%), Positives = 53/127 (40%), Gaps = 5/127 (3%) Frame = +2 Query: 164 PTSQSFAVPALSTTASLPSTSHTSPPA--SRTTTCFCFRPSSP---TFSPTSLTRPPSPP 328 P S P L+ + PS + SPP S TT PS P T SP LT P PP Sbjct: 68 PPSTPSPPPPLTPSPLPPSPTTPSPPLTPSPTTPSPPLTPSPPPAITPSPP-LTPSPLPP 126 Query: 329 SPSRSDSPPAASGCFLSTTMPMPPSPRAVPTGPYSSLITSLAPPCPALCTTTASLERPTS 508 SP+ PP + P PSP P+ P SS + +PP P+ T + P Sbjct: 127 SPTTPSPPPPS---------PSIPSPPLTPSPPPSSPLRPSSPPPPSPATPSTPPRSPPP 177 Q