BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208500|gb|BQ134589.1|BQ134589 1091015E05.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (452 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g56345.1 RNA pseudouridylate synthase, putative / contains... 65 1e-11 >At1g56345.1 RNA pseudouridylate synthase, putative / contains Pfam profile: PF00849: RNA pseudouridylate synthase Length = 254 Score = 65.5 bits (158), Expect = 1e-11 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -3 Query: 447 RRDVKYGGVIEWDGVECEGHALHAESLSFVHPITGLPITLRSPLPPWA 304 R DVKY GV EW+G EGH LHAE LS HP+TG I +R+PLP WA Sbjct: 204 RGDVKYHGVYEWNGRTFEGHELHAECLSLDHPVTGDSIVIRAPLPYWA 251 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,636,735 Number of Sequences: 27288 Number of extensions: 230072 Number of successful extensions: 642 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 642 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 543640560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208494|gb|BQ134583.1|BQ134583 1091015D05.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (508 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11800.1 expressed protein / EST gb|F14156 comes from this... 147 4e-36 >At1g11800.1 expressed protein / EST gb|F14156 comes from this gene;supported by full-length cDNA: Ceres:16491. Length = 426 Score = 147 bits (370), Expect = 4e-36 Identities = 66/101 (65%), Positives = 83/101 (81%) Frame = -2 Query: 507 GPFPLQDGWTDAWVELKPGEDGWTYDTKANGMLSGNRKLQKRLDRFVCKLADFKMDSIEM 328 G FPL D W D W LKPG+ G+TYDTKAN MLSGNR LQKRLDR +C+L D+K+ IEM Sbjct: 324 GKFPLPDKWVDVWEVLKPGDLGFTYDTKANPMLSGNRALQKRLDRILCRLDDYKLGGIEM 383 Query: 327 IGKEAIPGVSYFKEKKIRKENQRIELPVFPSDHFGLVLTIT 205 +GKEAIPG+SY KEKK+R + +++ELPV PSDHFGL++T++ Sbjct: 384 VGKEAIPGLSYVKEKKVRGDIKKLELPVLPSDHFGLLVTLS 424 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,962,896 Number of Sequences: 27288 Number of extensions: 292592 Number of successful extensions: 827 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 827 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 684463600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208471|gb|BQ134560.1|BQ134560 1091015A04.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (443 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20320.1 expressed protein / ;supported by full-length cD... 132 6e-32 >At3g20320.1 expressed protein / ;supported by full-length cDNA: Ceres:17362. Length = 381 Score = 132 bits (333), Expect = 6e-32 Identities = 65/95 (68%), Positives = 82/95 (85%) Frame = -3 Query: 441 AEEMQPLLSEVNDSDLLKDVETIAKGLADASGDLRRLKSSMLTPENTDLIKQSIFTLIFT 262 AE+ QPLLSE DS LLK+VE + + L AS DLR++ SS++TPENT+LI++SI+TL++T Sbjct: 287 AEDAQPLLSEFRDSGLLKEVECLTRSLTQASDDLRKVNSSIMTPENTELIQKSIYTLVYT 346 Query: 261 LKNIESISSDISGFTGDETTRRNIKLLIKSLSRLL 157 LKN+ESISSDI GFTGDE TR+N+KLLIKSLSRLL Sbjct: 347 LKNVESISSDILGFTGDEATRKNLKLLIKSLSRLL 381 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,168,351 Number of Sequences: 27288 Number of extensions: 243022 Number of successful extensions: 2061 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1879 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 516458532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208415|gb|BQ134504.1|BQ134504 1091014C01.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (391 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44620.1 protein-tyrosine-phosphatase-like protein / prote... 106 4e-24 At3g44420.1 putative protein / predicted protein, Arabidopsis... 55 1e-08 >At3g44620.1 protein-tyrosine-phosphatase-like protein / protein-tyrosine-phosphatase - Schizosaccharomyces pombe, PIR:A55446 Length = 177 Score = 106 bits (264), Expect = 4e-24 Identities = 49/76 (64%), Positives = 56/76 (73%) Frame = -3 Query: 350 EQYAEDILNSFERWRRKEPLPDSAPNKVKLMCSYCKHHTESEVPDPYYGGPQGFEKVLDL 171 +Q EDIL ++ W+ + P A KVKLMCSYCK H + VPDPYYGG QGFEKVLDL Sbjct: 102 DQNKEDILKAYNVWKARGNFPPDADKKVKLMCSYCKKHNDKFVPDPYYGGAQGFEKVLDL 161 Query: 170 LEDACESLLDSIVANN 123 LEDACESLLDSI A + Sbjct: 162 LEDACESLLDSITAQS 177 >At3g44420.1 putative protein / predicted protein, Arabidopsis thaliana Length = 235 Score = 55.1 bits (131), Expect = 1e-08 Identities = 27/58 (46%), Positives = 33/58 (56%) Frame = -3 Query: 344 YAEDILNSFERWRRKEPLPDSAPNKVKLMCSYCKHHTESEVPDPYYGGPQGFEKVLDL 171 +AEDIL ++ VKLMCSYCK H + V DPYYGG Q FEKV+ + Sbjct: 14 FAEDILKAYN---------------VKLMCSYCKKHNDKFVHDPYYGGAQSFEKVISI 56 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,871,441 Number of Sequences: 27288 Number of extensions: 187877 Number of successful extensions: 605 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 605 length of database: 11,516,596 effective HSP length: 88 effective length of database: 9,115,252 effective search space used: 373725332 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208391|gb|BQ134480.1|BQ134480 1091020H03.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (503 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48720.1 putative protein / similar to unknown protein (gb... 76 1e-14 >At5g48720.1 putative protein / similar to unknown protein (gb|AAD20092.1) Length = 286 Score = 75.9 bits (185), Expect = 1e-14 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 6/56 (10%) Frame = -1 Query: 503 QDINQRIRAPPKKA------PEILGTSAFSGKPVIGKTRIRTEGGKGSITILRTKG 354 +DINQ+IR PP K P ++ TSAFSGKPV+GKT+IRTEGGKGSITI+RT+G Sbjct: 231 KDINQKIRNPPAKPKAHIEEPAVIQTSAFSGKPVVGKTKIRTEGGKGSITIMRTRG 286 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,334,201 Number of Sequences: 27288 Number of extensions: 242014 Number of successful extensions: 636 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 632 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 675457500 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208320|gb|BQ134409.1|BQ134409 1091016H05.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (383 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g10050.1 lipase-like protein / monoglyceride lipase - Mus ... 153 2e-39 >At4g10050.1 lipase-like protein / monoglyceride lipase - Mus musculus, PID:e1184892;supported by full-length cDNA: Ceres:6822. Length = 350 Score = 153 bits (387), Expect(2) = 2e-39 Identities = 68/105 (64%), Positives = 92/105 (86%) Frame = +3 Query: 69 EERRVAIPDTDNVFNAYTTGSEGPVVFCLHGGGYSGFSFALAASQMKDKARVVAMDLRGH 248 +E ++I +D+VF+ Y G+EGPVVFCLHGGGYSG SF++ AS++K+KARVVAMDLRGH Sbjct: 56 KEDDISITGSDDVFHVYMAGNEGPVVFCLHGGGYSGLSFSIVASKIKEKARVVAMDLRGH 115 Query: 249 GKSTTNDDLDLSIETLTNDIIAVIRTMYGDLPPAIILVGHSMGGS 383 GKS + ++L+LS+ET++ND++AVI+ +YGD PPAI+LVGHSMGGS Sbjct: 116 GKSVSENELELSLETMSNDVLAVIKELYGDSPPAIVLVGHSMGGS 160 Score = 24.6 bits (52), Expect(2) = 2e-39 Identities = 7/16 (43%), Positives = 13/16 (80%) Frame = +2 Query: 17 SHSLHKYAPLDWSAYF 64 ++S KY+P++W +YF Sbjct: 39 TNSSEKYSPVEWKSYF 54 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,764,385 Number of Sequences: 27288 Number of extensions: 221167 Number of successful extensions: 666 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 662 length of database: 11,516,596 effective HSP length: 87 effective length of database: 9,142,540 effective search space used: 365701600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208269|gb|BQ134358.1|BQ134358 1091016B02.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (523 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g25120.1 putative protein / ATP-dependent DNA helicase Rep... 167 2e-42 >At4g25120.1 putative protein / ATP-dependent DNA helicase Rep, Escherichia coli, PIR1:HJECDR Length = 938 Score = 167 bits (424), Expect = 2e-42 Identities = 90/164 (54%), Positives = 109/164 (65%) Frame = +3 Query: 30 EGIPPPNILAMTFTTAAASEMRERIGTVAGNAVA*DIAISTFHSFCLQLCRTHAEKLGRT 209 +G+ P NILAMTFT AA SEMRERIG AG A DI ISTFHSF LQLCR HA+KL RT Sbjct: 273 KGLLPSNILAMTFTKAATSEMRERIGKSAGKKAAKDITISTFHSFSLQLCRMHADKLQRT 332 Query: 210 SEFIIYGHGQQRRALIETERLLENDKNNGVGDTTNQYDGDIKNSFKDKAKKWQKFITQAK 389 SEF +YGHGQQRRA+IE RL E +K NG + G+ N A K Sbjct: 333 SEFSVYGHGQQRRAIIEAVRLYEEEKKNGSKTSVPCESGEGLNGAGAGA---------GK 383 Query: 390 ASGRTPEDYEKKGDLTGASVLRHYNEILRSCNALDYHDFINSSI 521 ASG++PE K G+ GA +L +YN+IL++C+ALDYHD I+ S+ Sbjct: 384 ASGKSPEQCRKMGNEIGAKILGNYNDILKACDALDYHDLISCSV 427 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,578,157 Number of Sequences: 27288 Number of extensions: 252453 Number of successful extensions: 790 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 789 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 729494100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208255|gb|BQ134344.1|BQ134344 1091015H06.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (483 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g37290.1 putative protein / CG14881, Drosophila melanogast... 137 4e-33 >At5g37290.1 putative protein / CG14881, Drosophila melanogaster, EMBL:AE003713;supported by full-length cDNA: Ceres:9887. Length = 180 Score = 137 bits (344), Expect = 4e-33 Identities = 64/82 (78%), Positives = 75/82 (91%) Frame = +3 Query: 237 MSTNAQRQVERTGRSGTPRDQYLQDLVTQFQNATNEESKEKIVANLANFAYDPFNYAFMR 416 M TN QRQ ERTG+ GTPR QYLQ+LV+QFQNAT+EE+KE+IVANLANFAYDP+NY +R Sbjct: 1 MFTNNQRQEERTGKHGTPRLQYLQELVSQFQNATDEETKERIVANLANFAYDPYNYTILR 60 Query: 417 QLNVLELFLDCITEPNERLIEF 482 QLNVLELF+DCITEPNE+L+EF Sbjct: 61 QLNVLELFVDCITEPNEKLVEF 82 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,265,969 Number of Sequences: 27288 Number of extensions: 241890 Number of successful extensions: 701 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 623303772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208228|gb|BQ134317.1|BQ134317 1091015D06.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (554 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g22800.1 unknown protein / ESTs gb|Z34075, gb|Z34835 and g... 216 8e-57 >At1g22800.1 unknown protein / ESTs gb|Z34075, gb|Z34835 and gb|AA404888 come from this gene Length = 355 Score = 216 bits (549), Expect = 8e-57 Identities = 111/171 (64%), Positives = 134/171 (77%), Gaps = 5/171 (2%) Frame = +3 Query: 57 FSSSSAPDG---LDDGGGRVKIFDRDLKRRHRDRAAWAMFEIY-GLVDAVAENLLDRLED 224 FS+ A G +VKIFDRDLKR HRDRAAW + VDAVA+NLLDRLED Sbjct: 34 FSTEGAYGGDGEFQQNSSKVKIFDRDLKRIHRDRAAWLSRQKNDSFVDAVADNLLDRLED 93 Query: 225 CRKAFPSALCLGGSAGAVRRLLRGRGGIERLIMMDMSADMVKKWRESENATGDGP-ETHF 401 C+K+FP+A CLGGS GAV+RLLRGRGGIE+LIMMD S DM+K R++++ + D ET + Sbjct: 94 CKKSFPTAFCLGGSLGAVKRLLRGRGGIEKLIMMDTSYDMIKSCRDAQDDSLDNSIETSY 153 Query: 402 VIGDEEFLPIKESSQDLIMSCLGLHWTNDLPGAMIQCRLALQPDGLFLSAI 554 +GDEEFLP+KESS DLI+S LGLHWTNDLPG+MIQC+LAL+PDGLFL+AI Sbjct: 154 FVGDEEFLPVKESSVDLIISSLGLHWTNDLPGSMIQCKLALKPDGLFLAAI 204 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,706,528 Number of Sequences: 27288 Number of extensions: 409829 Number of successful extensions: 4761 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3990 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 817071892 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208215|gb|BQ134304.1|BQ134304 1091015B04.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (329 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32050.1 putative protein / norbin, Rattus norvegicus, PIR... 104 7e-24 >At4g32050.1 putative protein / norbin, Rattus norvegicus, PIR2:JC5812; supported by cDNA: gi_18086356 Length = 618 Score = 104 bits (260), Expect = 7e-24 Identities = 55/105 (52%), Positives = 75/105 (71%) Frame = +3 Query: 9 SQKESALHDFLRSIPASIWESHIRVGITAILQNRVVSSEKLHALLLAECMMSILGEDWLS 188 S+ LH+ LRS+P + W ++R G+ AILQNRV SEKLHAL+LAE MMSILGE WL Sbjct: 225 SEYSELLHEPLRSMPDNNWADYMRTGVVAILQNRVAPSEKLHALILAENMMSILGEKWLL 284 Query: 189 EDFEVQDNQNVLSVDKFVLLVLESARVEVAVLLNELAYLKYESSR 323 ++ + + D+ +LLVLES+ VE++VLLN+LAY KYE+ + Sbjct: 285 GGVKLPNVD--IPADRCLLLVLESSHVEISVLLNDLAYKKYEAPK 327 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,689,043 Number of Sequences: 27288 Number of extensions: 162239 Number of successful extensions: 506 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 11,516,596 effective HSP length: 85 effective length of database: 9,197,116 effective search space used: 220730784 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208173|gb|BQ134262.1|BQ134262 1091014F01.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (636 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49810.1 methionine S-methyltransferase (gb|AAD49574.1) / ... 278 2e-75 >At5g49810.1 methionine S-methyltransferase (gb|AAD49574.1) / ; supported by cDNA: gi_5733428_gb_AF137380.1_AF137380 Length = 1071 Score = 278 bits (712), Expect(2) = 2e-75 Identities = 140/197 (71%), Positives = 169/197 (85%) Frame = +1 Query: 37 MFSPALAIVDEHLTRHLPKQWLTSLAIEGRADCNHADGTVTVIEAPLLSDLLIELIRKLQ 216 +FSP LAIVDEHLTR LP+ WLTSLAIE + + +D +TVIE+P SDL+IELI+KL+ Sbjct: 464 LFSPRLAIVDEHLTRQLPRSWLTSLAIEDTS-MDKSDDQITVIESPHQSDLMIELIKKLK 522 Query: 217 PQVVVTGMAQFEAITSAAFENLLNVTKDVGSRLFLDISEHLELSSLPSSNGVLKYLAGKT 396 PQVVVTGMA FE ITS++F +LL VTK++G RLFLDIS+H ELSSLP+SNGVLKYLA Sbjct: 523 PQVVVTGMAPFEVITSSSFLHLLEVTKEIGCRLFLDISDHFELSSLPASNGVLKYLAENQ 582 Query: 397 LPSHAAILCGLVKNQVYSDLEVAFAISEDAAVYKALSQTIELLEGHTSLISQHYYGCLFH 576 LPSHAAI+CGLVKN+VYSDLEVAF I+E A+ KALS+T+E+LEGHT++ISQ+YYGCLFH Sbjct: 583 LPSHAAIICGLVKNKVYSDLEVAFVITEVDAIAKALSKTVEVLEGHTAIISQYYYGCLFH 642 Query: 577 ELLAFQIADRHPQQERQ 627 ELLAFQ+ADRH ER+ Sbjct: 643 ELLAFQLADRHAPAERE 659 Score = 21.9 bits (45), Expect(2) = 2e-75 Identities = 10/21 (47%), Positives = 15/21 (70%) Frame = +2 Query: 2 PSRSVAIENALQCSHRRLQLL 64 PSR+VAIE+A + RL ++ Sbjct: 452 PSRAVAIESAFRLFSPRLAIV 472 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,129,635 Number of Sequences: 27288 Number of extensions: 297580 Number of successful extensions: 831 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 830 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1035211376 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208162|gb|BQ134251.1|BQ134251 1091014D12.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (624 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58110.1 putative protein / predicted proteins, Homo sapie... 200 6e-52 >At5g58110.1 putative protein / predicted proteins, Homo sapiens and Drosophila melanogaster; supported by cDNA: gi_18087564 Length = 196 Score = 200 bits (508), Expect = 6e-52 Identities = 95/163 (58%), Positives = 124/163 (75%), Gaps = 1/163 (0%) Frame = +1 Query: 136 EKASSYRYWVREASGDAAPLPVPRKL-DTAANGNGNPPPVGSVWNQAGTWEEKNLNSWAN 312 ++ SSYRYWVREA+ DAAP P+P+KL + + N P +GS+WN+AGTWEEK+L WA Sbjct: 9 KEGSSYRYWVREATSDAAPPPLPQKLSNNDVSLNTAPASLGSLWNRAGTWEEKSLTKWAT 68 Query: 313 SRIKDLMGSLGSLAFPTGKASIDEVSKCSGDAFQVIVRNKKRVGYNYELSLRFSGEWLIK 492 R+K+L+GS+GSL F +GKA I +V++C GDAF V VRNKKRVGY YELSL+ GEW + Sbjct: 69 DRLKELLGSVGSLQFSSGKAEIIDVNRCVGDAFLVTVRNKKRVGYTYELSLKVEGEWSFE 128 Query: 493 EENKKIKGHLDIPEFSFGKIDDLEVQVRFGDDKGLASDDRTRI 621 E KK+KG L+IPEFSFG++DDLEV V+ +DK L+ + RI Sbjct: 129 ENMKKVKGSLEIPEFSFGELDDLEVDVKLSEDKELSQQLKQRI 171 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.315 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,929,153 Number of Sequences: 27288 Number of extensions: 447323 Number of successful extensions: 6336 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4988 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 999514432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208139|gb|BQ134228.1|BQ134228 1091014B10.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (598 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g23860.1 putative protein / gene T22C1.1, Caenorhabditis e... 127 6e-30 >At4g23860.1 putative protein / gene T22C1.1, Caenorhabditis elegans, Z75550; supported by cDNA: gi_17064723 Length = 222 Score = 127 bits (318), Expect = 6e-30 Identities = 56/121 (46%), Positives = 81/121 (66%) Frame = +2 Query: 188 QYKSEPFFMSKGWRETLCRCETCFNFYAQRGIAYLIDKEDSIEEYEKIAKQKREMKLEQQ 367 +++ +P F++K WR LCRCE C Y QR ++YL+D ED+I EYEK AK+KR KLE+Q Sbjct: 100 EFEKKPLFLTKNWRNILCRCEKCLEMYKQRKVSYLLDAEDTIVEYEKKAKEKRTEKLEKQ 159 Query: 368 QGAETNFLNSLNHVQKIEMISGINDMKNEFQSFLESFDASKPVTSDDIHSFFENLAKKKK 547 +G + LN+L+HV K+E++ GI D ++ Q +ES SK +TS DI F L K+K Sbjct: 160 EGEALDLLNNLDHVSKVELLHGIKDFQDGLQGLMESAGPSKAITSADIEQMFSKLKNKRK 219 Query: 548 Q 550 + Sbjct: 220 R 220 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,857,240 Number of Sequences: 27288 Number of extensions: 273081 Number of successful extensions: 1000 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 956 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 998 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 930958496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208102|gb|BQ134191.1|BQ134191 1091013F09.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (524 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61040.1 unknown protein / ; supported by cDNA: gi_20147192 226 5e-60 >At1g61040.1 unknown protein / ; supported by cDNA: gi_20147192 Length = 643 Score = 226 bits (576), Expect = 5e-60 Identities = 108/172 (62%), Positives = 139/172 (80%), Gaps = 1/172 (0%) Frame = +1 Query: 10 FDDVKSITLRRSKLVKWFMEPFFDDLISGCFVRLGIGKTKNGTPSYRLCIVRNVDAFDPY 189 F+DVK +T+RRSKL KW MEPFF++LI GCFVR+GIG++K+G P YRLC V+NVDA DP Sbjct: 264 FEDVKEVTIRRSKLAKWLMEPFFEELIVGCFVRVGIGRSKSG-PIYRLCWVKNVDATDPD 322 Query: 190 RNYKLENYSTCKYLNVVWDSEANAARWQMTQVSDSPPNEEEFKEWLQAAEKNGARIPTRQ 369 + YKLEN +T KYLNVVW +E +AARWQM +SD P EEE+++W++ E+ R+PT+Q Sbjct: 323 KTYKLENKTTHKYLNVVWGNETSAARWQMAMISDGHPLEEEYRQWIREVERTNGRMPTKQ 382 Query: 370 EVLDKKEAIQNAYNFVYSAATVQQMLQE-KSAVRRPINIAAEKDRLRSELEM 522 ++ +KKEAIQ +FVYSA TV+QMLQE KSA RP+N+AAEKDRLR ELE+ Sbjct: 383 DISEKKEAIQRTNSFVYSAETVKQMLQEKKSASVRPMNVAAEKDRLRKELEI 434 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,699,402 Number of Sequences: 27288 Number of extensions: 295260 Number of successful extensions: 817 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 815 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 727283772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|20208097|gb|BQ134186.1|BQ134186 1091013E08.y2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (244 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39680.1 hypothetical protein / 99 4e-22 >At4g39680.1 hypothetical protein / Length = 633 Score = 99.0 bits (245), Expect = 4e-22 Identities = 50/78 (64%), Positives = 56/78 (71%) Frame = +3 Query: 9 SQTGPETPKDIFQPAFKRSFGRSDSTASVDSPKERIVPPAEKPATTSLRIDRFVRPFTLK 188 S T TP+ KR F RSDS+ S D PKER+VPP+ K T SLRIDRF+RPFTLK Sbjct: 415 SATPTTTPRST---GLKRDFSRSDSSVSEDGPKERVVPPSPKEPTNSLRIDRFLRPFTLK 471 Query: 189 AVQELLGKTGSVQDFWMD 242 AVQELLGKTG+V FWMD Sbjct: 472 AVQELLGKTGNVTSFWMD 489 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,339,943 Number of Sequences: 27288 Number of extensions: 98944 Number of successful extensions: 324 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 324 length of database: 11,516,596 effective HSP length: 56 effective length of database: 9,988,468 effective search space used: 239723232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822717|gb|BQ048741.1|BQ048741 952023F05.x4 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (596 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g70570.1 expressed protein / ; supported by cDNA: gi_15293... 167 3e-72 >At1g70570.1 expressed protein / ; supported by cDNA: gi_15293216_gb_AY051042.1_ Length = 595 Score = 167 bits (423), Expect(2) = 3e-72 Identities = 80/97 (82%), Positives = 86/97 (88%) Frame = -3 Query: 300 GPPPVADVNSLTHYGEPYDGNTRFFKSTLFVAAVRACYGESCLLHGVEWMPPKGGITEGQ 121 G PPVADV SLTHYGEPYDGNTRFF+STLFVAAVR+C GES LLHGVEWMPPKGG+TE Q Sbjct: 291 GAPPVADVKSLTHYGEPYDGNTRFFRSTLFVAAVRSCCGESSLLHGVEWMPPKGGVTEEQ 350 Query: 120 MLKFMGANIHLSPTQAKILLEDETAGFAYLNLQEACP 10 MLKFMGAN HLS QAK L+EDE AGFAYL+L+EA P Sbjct: 351 MLKFMGANTHLSVQQAKELIEDEKAGFAYLSLREARP 387 Score = 122 bits (305), Expect(2) = 3e-72 Identities = 62/92 (67%), Positives = 75/92 (81%), Gaps = 1/92 (1%) Frame = -1 Query: 596 ILGANGLAEPRYVGQGTGEMRLVGALREVLAGGHLGYEEVQCVLKDILPIGS-SSDSTVV 420 +LG P +VG T EMRLVGALRE+LAGGHLGYEEV+ VL+D+LP+ + S ++ V Sbjct: 198 LLGTGNSVGPTFVGNETREMRLVGALREILAGGHLGYEEVKGVLRDVLPLETEGSLNSGV 257 Query: 419 SQALLAAFLIGQRMNRETDRELKAYCLTFDDE 324 S++LL+AFLIGQRMNRETDRELKAYCL FDDE Sbjct: 258 SESLLSAFLIGQRMNRETDRELKAYCLAFDDE 289 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,929,421 Number of Sequences: 27288 Number of extensions: 312478 Number of successful extensions: 875 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 873 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 930958496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822478|gb|BQ048502.1|BQ048502 952021D02.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (532 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g56090.1 putative protein / contains similarity to cytochr... 280 3e-76 >At5g56090.1 putative protein / contains similarity to cytochrome oxidase assembly factor Length = 457 Score = 280 bits (716), Expect = 3e-76 Identities = 125/173 (72%), Positives = 152/173 (87%) Frame = -3 Query: 530 GIRLSALFALGGAQGLIGWWMVKSGLEEPTSEYVQPRVSPYRLATHLTSAFIIYCGILWT 351 G++LS LFALG QG IGWWMVKSGLEEP SEY QPRVSPYRLA HLTSAF IYCG+ WT Sbjct: 210 GVQLSGLFALGAGQGFIGWWMVKSGLEEPPSEYSQPRVSPYRLAAHLTSAFAIYCGLFWT 269 Query: 350 ALSVVMPDPPTGSMSWVNGAAKIRKLAIPVSAVVGITAISGAFVAGNDAGHAYNSFPKMG 171 ALSVVMP+PP S++WV GAAK++KLA+PVS +VGITAISGAFVAGNDAG A+N+FPKMG Sbjct: 270 ALSVVMPEPPAESLAWVRGAAKVKKLALPVSLIVGITAISGAFVAGNDAGRAFNTFPKMG 329 Query: 170 DSWIPEDVFSMEPFVRNFFENTSTVQLNHRILAATTLLSVGGLWLAARKIDMH 12 D+WIP+++F M+P +RNFFENT+TVQL+HR+LA TTL+++G +W RK+D+H Sbjct: 330 DTWIPDNIFEMKPLLRNFFENTATVQLDHRLLATTTLIAIGTMWWFTRKLDIH 382 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,084,816 Number of Sequences: 27288 Number of extensions: 293235 Number of successful extensions: 855 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 855 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 745241396 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822463|gb|BQ048487.1|BQ048487 952021B02.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (462 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g12550.1 hypothetical protein / predicted by genscan 99 1e-21 >At2g12550.1 hypothetical protein / predicted by genscan Length = 538 Score = 99.0 bits (245), Expect = 1e-21 Identities = 61/127 (48%), Positives = 82/127 (64%), Gaps = 3/127 (2%) Frame = -2 Query: 383 MLRAEVARRVGDGVEPECVGLIFGGRVLKDDPPASLR--EAGLKANAKVLSSL-TSPDRA 213 MLR EVA+R G++PE + LIF G++LKDD A+L + G+K N+K+LS +P+ Sbjct: 1 MLRDEVAKR--SGLDPESIKLIFAGKILKDDGDATLTLSQLGIKENSKILSCRQAAPEEG 58 Query: 212 KEIDAQAAKAKAEEEHAAKLVRLWEAAKALSQRHTDGSYLAEEDYNLDLEDQSGQKVMFG 33 K I AEEE A +L R+ AA ALS+RH DGS L +DYN++LEDQ G KV FG Sbjct: 59 KSI-------MAEEERARRLSRVKAAATALSKRHADGS-LPIQDYNIELEDQGGHKVQFG 110 Query: 32 SVDDKKA 12 + D+ A Sbjct: 111 TETDQSA 117 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,950,640 Number of Sequences: 27288 Number of extensions: 323342 Number of successful extensions: 5449 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2031 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4319 length of database: 11,516,596 effective HSP length: 91 effective length of database: 9,033,388 effective search space used: 560070056 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822413|gb|BQ048437.1|BQ048437 1091008B10.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (576 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g34640.1 expressed protein / ; supported by full-length cD... 105 2e-23 At1g31810.1 unknown protein / 54 6e-08 At1g61080.1 hypothetical protein / predicted by genefinder 52 2e-07 At5g19810.1 proline-rich protein / extensins 51 5e-07 At5g07750.1 putative protein / similar to unknown protein (gb... 50 6e-07 At1g68690.1 protein kinase, putative / similar to protein kin... 50 6e-07 At5g58160.1 strong similarity to unknown protein (gb|AAD23008.1)... 50 8e-07 At5g56330.1 putative protein / contains similarity to carboni... 49 1e-06 At4g13340.1 extensin-like protein / extensin-like protein, Ze... 49 2e-06 At3g24400.1 protein kinase, putative / similar to protein kin... 48 3e-06 At1g20130.1 anter-specific proline-rich protein APG precursor ... 48 3e-06 At4g18670.1 extensin-like protein / extensin-like protein - m... 48 4e-06 At4g30460.1 glycine-rich protein / glycine-rich cell wall str... 48 4e-06 At2g05580.1 unknown protein / predicted by genefinder 48 4e-06 At4g27850.1 putative proline-rich protein / extensin - Volvox... 47 7e-06 At4g22470.1 extensin - like protein / hybrid proline-rich pro... 47 9e-06 At4g39260.1 glycine-rich RNA-binding protein 8 (GRP8) / CCR1 ... 47 9e-06 At4g15160.1 cell wall protein like / 47 9e-06 >At1g34640.1 expressed protein / ; supported by full-length cDNA: Ceres: 10855. Length = 110 Score = 105 bits (262), Expect = 2e-23 Identities = 48/112 (42%), Positives = 72/112 (63%) Frame = +1 Query: 202 MGRDELLRRSLVALAAAVALTGLATASLRKAAATYGFGILAIAGVLLPDWEFFDRDYSQW 381 MG + LR S+V LA + + L T SL+K TY GI I G+LLPDW+FFDR +S+W Sbjct: 1 MGNEAALRSSMVGLAVVMVVVWLWTQSLKKTVVTYAVGISLIGGILLPDWDFFDRSFSRW 60 Query: 382 LTPMPASRRTAAAAAADREHDVWKFKPYPLRVAMLTTIYGFGLHKWWTYVSS 537 P+ A R+AA A R+ +F+ YP+R+ + T+YG+ +++WW +VS+ Sbjct: 61 GYPVTAEERSAALA---RKSHPSRFRVYPMRMVLYGTVYGYAVYRWWMFVSN 109 >At1g31810.1 unknown protein / Length = 1201 Score = 53.9 bits (128), Expect = 6e-08 Identities = 38/103 (36%), Positives = 44/103 (41%), Gaps = 6/103 (5%) Frame = -3 Query: 310 SRTWPPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPL 131 SR+ PPP A P P P P PPP P S + PS A PP PP PS Sbjct: 584 SRSIPPPLAQPPPPRP--PPPPPPPPSSRSIPSPS-----APPPPP----PPPPSFG--- 629 Query: 130 GWGVGTRNEKRVRPAPPPPP------ASVSPPPGPWAPGGRDG 20 G + + + P PPPPP A +PPP P P G Sbjct: 630 --STGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSG 670 Score = 53.9 bits (128), Expect = 6e-08 Identities = 51/168 (30%), Positives = 64/168 (37%), Gaps = 10/168 (5%) Frame = -3 Query: 478 PPSEDRA*ISRRRAPGRRPRPRPCVGRRAWG*ATGSSLGRRTPSPEAARQRWRGCRSRTW 299 PP R+ I AP P P P G +TG+ + P P R ++ Sbjct: 605 PPPSSRS-IPSPSAPPPPPPPPPSFG------STGNKRQAQPPPPPPPPPPTRIPAAKCA 657 Query: 298 PPPCAATPW----------PSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVP 149 PPP P PS P PPP P+ + + A P P PP+S+ P P Sbjct: 658 PPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNA-PKPPAPPPLPPSSTRLGAPPP 716 Query: 148 SLQLPLGWGVGTRNEKRVRPAPPPPPASVSPPPGPWAPGGRDG*AGAP 5 PL PAPPPPP S +P P P GR +G P Sbjct: 717 PPPPPLS----------KTPAPPPPPLSKTPVPPPPPGLGRGTSSGPP 754 >At1g61080.1 hypothetical protein / predicted by genefinder Length = 907 Score = 52.0 bits (123), Expect = 2e-07 Identities = 42/112 (37%), Positives = 48/112 (42%), Gaps = 14/112 (12%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAA--ARPSPCHTDARPPASSLKLPPVPSLQ----- 140 PPP AA AP PPP P G+AAA P P T A PP PP P +Q Sbjct: 528 PPPRAAV------APPPPPPPPGTAAAPPPPPPPPGTQAAPPP-----PPPPPMQNRAPS 576 Query: 139 ---LPLGWGVGTRNEKRVRPAPPPPPA----SVSPPPGPWAPGGRDG*AGAP 5 +P+G N P PPPPP +PPP P +G AG P Sbjct: 577 PPPMPMG------NSGSGGPPPPPPPMPLANGATPPPPPPPMAMANGAAGPP 622 Score = 50.1 bits (118), Expect = 8e-07 Identities = 35/98 (35%), Positives = 38/98 (38%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPP P P+ A PPP P AA A P P PP + PP P P G Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPP-----PPPPGTAAAPPPP--PPPPG--- 557 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGPWAPGGRDG*AGAP 5 + P PPPPP P P P G G G P Sbjct: 558 ----TQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPP 591 Score = 50.1 bits (118), Expect = 8e-07 Identities = 38/116 (32%), Positives = 46/116 (38%), Gaps = 13/116 (11%) Frame = -3 Query: 313 RSRTWPPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPA--------SSLKLP 158 R+ PPP P + P PPP P AA P P R P+ S P Sbjct: 531 RAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGP 590 Query: 157 PVPSLQLPLGWGVGTRNEKRVRPAPPPPPASVS-----PPPGPWAPGGRDG*AGAP 5 P P +PL G P PPPPP +++ PPP P G +G AG P Sbjct: 591 PPPPPPMPLANG--------ATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPP 638 >At5g19810.1 proline-rich protein / extensins Length = 249 Score = 50.8 bits (120), Expect = 5e-07 Identities = 31/85 (36%), Positives = 38/85 (44%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPP +P P P PPP P + P P + PP +L PP P L P Sbjct: 73 PPPVNLSPPPPPVNLSPPPPP--VLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSP----- 125 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGP 44 V +PPPPP ++SPPP P Sbjct: 126 ---PPPPVLLSPPPPPVNLSPPPPP 147 Score = 49.7 bits (117), Expect = 1e-06 Identities = 31/85 (36%), Positives = 36/85 (41%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPP +P P P PPP P + P P + PP L PP P L P Sbjct: 82 PPPVNLSPPPPPVLLSPPPPPVNLSPP--PPPVNLSPPPPPVLLSPPPPPVLLSP----- 134 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGP 44 V +PPPPP +SPPP P Sbjct: 135 ---PPPPVNLSPPPPPVLLSPPPPP 156 Score = 48.5 bits (114), Expect = 2e-06 Identities = 30/85 (35%), Positives = 37/85 (43%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPP + P P PPP P + P P + PP +L PP P L P Sbjct: 46 PPPVNISSPPPPVNLSPPPPPVNLSPP--PPPVNLSPPPPPVNLSPPPPPVLLSP----- 98 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGP 44 V +PPPPP ++SPPP P Sbjct: 99 ---PPPPVNLSPPPPPVNLSPPPPP 120 >At5g07750.1 putative protein / similar to unknown protein (gb|AAD23008.1) Length = 1289 Score = 50.4 bits (119), Expect = 6e-07 Identities = 43/108 (39%), Positives = 43/108 (39%), Gaps = 18/108 (16%) Frame = -3 Query: 298 PPPC--AATPWPSP*----APRPPPAP-RGSAAAARPSPCHTDARPPA-----SSLKLPP 155 PPP A P P P AP PPP P RG A P P H A PP PP Sbjct: 1078 PPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGAPPPP 1137 Query: 154 VPSLQLPLGWGVGTRNEKRVRPAPPPPP------ASVSPPPGPWAPGG 29 P P G G G APPPPP PPPGP PGG Sbjct: 1138 PP----PGGRGPG---------APPPPPPPGGRAPGPPPPPGPRPPGG 1172 Score = 47.8 bits (112), Expect = 4e-06 Identities = 39/104 (37%), Positives = 40/104 (37%), Gaps = 6/104 (5%) Frame = -3 Query: 298 PPPC--AATPWPSP*----APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQL 137 PPP A P P P AP PPP P A P P PP PP P Sbjct: 1066 PPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPP------PPPP---- 1115 Query: 136 PLGWGVGTRNEKRVRPAPPPPPASVSPPPGPWAPGGRDG*AGAP 5 P+ G P PPPPP PP P PGGR GAP Sbjct: 1116 PMHGGA---------PPPPPPPMRGGAPPPPPPPGGRG--PGAP 1148 Score = 47.8 bits (112), Expect = 4e-06 Identities = 35/94 (37%), Positives = 41/94 (43%), Gaps = 6/94 (6%) Frame = -3 Query: 298 PPPCA------ATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQL 137 PPP + + P PS +P PPP P S + P P PP S PP P Sbjct: 923 PPPFSNAHSVLSPPPPSYGSPPPPPPPPPSYGSPPPPP------PPPPSYGSPPPPPPPP 976 Query: 136 PLGWGVGTRNEKRVRPAPPPPPASVSPPPGPWAP 35 P G+G P PPPPP+ SPPP P P Sbjct: 977 P-GYGSPP-------PPPPPPPSYGSPPPPPPPP 1002 Score = 47.8 bits (112), Expect = 4e-06 Identities = 35/108 (32%), Positives = 39/108 (35%) Frame = -3 Query: 352 PSPEAARQRWRGCRSRTWPPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPAS 173 PSP G S PP A P P PPP + + P P + PP Sbjct: 894 PSPSVKILPLHGISSAPSPPVKTAPP-----PPPPPPFSNAHSVLSPPPPSYGSPPPPP- 947 Query: 172 SLKLPPVPSLQLPLGWGVGTRNEKRVRPAPPPPPASVSPPPGPWAPGG 29 PP PS P P PPPPP+ SPPP P P G Sbjct: 948 ----PPPPSYGSP-------------PPPPPPPPSYGSPPPPPPPPPG 978 >At1g68690.1 protein kinase, putative / similar to protein kinase 1 GB:BAA94509 GI:7573596 from [Populus nigra]; supported by cDNA: gi_14334805_gb_AY035076.1_ Length = 708 Score = 50.4 bits (119), Expect = 6e-07 Identities = 34/96 (35%), Positives = 40/96 (41%), Gaps = 8/96 (8%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLP-----PVPSLQLP 134 PPP A P P P PPP G+ P P + + PP + P P P +P Sbjct: 44 PPPNRAPPPPPPVTTSPPPVANGAPPPPLPKPPESSSPPPQPVIPSPPPSTSPPPQPVIP 103 Query: 133 LGWGVGTRNEKRVRPAP--PPPPASVSPP-PGPWAP 35 + V P P PPPPASV PP P P P Sbjct: 104 SPPPSASPPPALVPPLPSSPPPPASVPPPRPSPSPP 139 >At5g58160.1 strong similarity to unknown protein (gb|AAD23008.1) / Length = 1307 Score = 50.1 bits (118), Expect = 8e-07 Identities = 53/160 (33%), Positives = 61/160 (38%), Gaps = 20/160 (12%) Frame = -3 Query: 454 ISRRRAPGRRPRPRPCVGRRAWG*ATGSSLGRRTPSPEAARQRWRGCRSRTWPPPCA--- 284 +S + +P P V +G AT LG S A + RS PPP + Sbjct: 628 LSPQASPATPTNPSKTVSVDFFGAATSPHLGA---SDNVASNLGQPARS---PPPISNSD 681 Query: 283 ---ATPWPSP*APRPP---------PAPRGSAAAARPSPC-HTDARPPASSLKLPPVPSL 143 A P P P P PP P P A A P+P HT + PP PP P Sbjct: 682 KKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAP-- 739 Query: 142 QLPLGWGVGTRNEKRVRPAPPPPPA----SVSPPPGPWAP 35 P G K PAPP PP S SPPP P AP Sbjct: 740 --PTPQSNGISAMKSSPPAPPAPPRLPTHSASPPP-PTAP 776 >At5g56330.1 putative protein / contains similarity to carbonic anhydrase Length = 350 Score = 49.3 bits (116), Expect = 1e-06 Identities = 30/90 (33%), Positives = 39/90 (43%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 P P P P+P P+P PAP + +P+P T +P K P P+ P Sbjct: 48 PTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKP-----KPKPAPTPPNPKPTPA 102 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGPWAPGG 29 T + + PAP P PA P APGG Sbjct: 103 PTPPKPKPAPAPAPTPAPKPKPAPKPAPGG 132 Score = 48.1 bits (113), Expect = 3e-06 Identities = 27/98 (27%), Positives = 37/98 (37%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 P P P P+P P+P P P + +P P T +P + PP P Sbjct: 26 PKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPK-------PA 78 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGPWAPGGRDG*AGAP 5 + +P P P P + P P P P + A AP Sbjct: 79 PAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAP 116 >At4g13340.1 extensin-like protein / extensin-like protein, Zea mays, PIR2:S49915 Length = 760 Score = 48.5 bits (114), Expect = 2e-06 Identities = 34/95 (35%), Positives = 35/95 (36%), Gaps = 1/95 (1%) Frame = -3 Query: 316 CRSRTWPPPCAATPWPSP*APRPPP-APRGSAAAARPSPCHTDARPPASSLKLPPVPSLQ 140 C P P TP P P P PPP AP S SP PP S PP P Sbjct: 388 CGRSVSPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPP 447 Query: 139 LPLGWGVGTRNEKRVRPAPPPPPASVSPPPGPWAP 35 + P PPPPP SPPP P P Sbjct: 448 V---------YSPPPPPPPPPPPPVYSPPPPPPPP 473 Score = 47.4 bits (111), Expect = 5e-06 Identities = 30/85 (35%), Positives = 31/85 (36%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPP +P P P P PPP P P PP S PP P P Sbjct: 444 PPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPP----- 498 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGP 44 P PPPPP SPPP P Sbjct: 499 -------PPPPPPPPPPVYSPPPPP 516 Score = 46.6 bits (109), Expect = 9e-06 Identities = 27/85 (31%), Positives = 32/85 (36%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPP ++ P SP P PP P + P P + PP PP P Sbjct: 564 PPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPC-------- 615 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGP 44 + P PPPP SPPP P Sbjct: 616 -------IEPPPPPPCIEYSPPPPP 633 >At3g24400.1 protein kinase, putative / similar to protein kinase GB:BAA24694 from [Arabidopsis thaliana] Length = 694 Score = 48.1 bits (113), Expect = 3e-06 Identities = 43/122 (35%), Positives = 50/122 (40%), Gaps = 12/122 (9%) Frame = -3 Query: 355 TPSPEAARQRWRGCRSRTWPPPCAATPWP---------SP*APRPPPAPRGSAAAARPSP 203 TPSP T PP A TP P SP P PPP + + PSP Sbjct: 89 TPSPPLTPSPTTPSPPLTPSPPPAITPSPPLTPSPLPPSPTTPSPPPP-----SPSIPSP 143 Query: 202 CHTDARPPASSLK--LPPVPSLQLPLGWGVGTRNEKRVR-PAPPPPPASVSPPPGPWAPG 32 T + PP+S L+ PP PS P R+ P PPP S+SPPP G Sbjct: 144 PLTPSPPPSSPLRPSSPPPPSPATP---STPPRSPPPPSTPTPPPRVGSLSPPPPASPSG 200 Query: 31 GR 26 GR Sbjct: 201 GR 202 >At1g20130.1 anter-specific proline-rich protein APG precursor / identical to SP:P40602 from [Arabidopsis thaliana] Length = 1006 Score = 48.1 bits (113), Expect = 3e-06 Identities = 33/89 (37%), Positives = 40/89 (44%), Gaps = 1/89 (1%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAA-RPSPCHTDARPPASSLKLPPVPSLQLPLGWG 122 PP C TP P PPP P+ + A +P PC + +PPA + K PVP P Sbjct: 65 PPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPK--PVPPHGPP---- 118 Query: 121 VGTRNEKRVRPAPPPPPASVSPPPGPWAP 35 +PAP P PA SP P P P Sbjct: 119 --------PKPAPAPTPAP-SPKPAPSPP 138 >At4g18670.1 extensin-like protein / extensin-like protein - maize, PIR2:S49915 Length = 839 Score = 47.8 bits (112), Expect = 4e-06 Identities = 31/94 (32%), Positives = 39/94 (40%), Gaps = 3/94 (3%) Frame = -3 Query: 316 CRSR---TWPPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPS 146 CR R PPP A + SP +PPP P S P+ + PP + + PP S Sbjct: 693 CRHRLNLASPPPPAPYYYSSP---QPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQS 749 Query: 145 LQLPLGWGVGTRNEKRVRPAPPPPPASVSPPPGP 44 + + P PPP PA SPPP P Sbjct: 750 HPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSP 783 >At4g30460.1 glycine-rich protein / glycine-rich cell wall structural protein - garden petunia,Pir2:A26099; supported by cDNA: gi_20260351 Length = 162 Score = 47.8 bits (112), Expect = 4e-06 Identities = 32/88 (36%), Positives = 39/88 (43%), Gaps = 3/88 (3%) Frame = +3 Query: 45 GPGGGETEAGGGGGAGRTRFSFRVPTPQPRGSWREGTGGSFKEEAGGRASVWHGEG---R 215 G GG + AG G G+G S + S G GG EAG A G G R Sbjct: 51 GGGGSGSGAGAGSGSGGGGSSSSSSSSSSSSSSSGGGGGDAGSEAGSYAGSHAGSGSGGR 110 Query: 216 AAAAEPRGAGGGRGAHGLGHGVAAQGGG 299 + + RG+GGG G G G G +GGG Sbjct: 111 SGSGRGRGSGGGGGHGGGGGGGGGRGGG 138 >At2g05580.1 unknown protein / predicted by genefinder Length = 302 Score = 47.8 bits (112), Expect = 4e-06 Identities = 31/88 (35%), Positives = 34/88 (38%) Frame = +3 Query: 36 GAQGPGGGETEAGGGGGAGRTRFSFRVPTPQPRGSWREGTGGSFKEEAGGRASVWHGEGR 215 G G GG GGGGG G+ Q G + G GG + GG G GR Sbjct: 213 GGGGGGGQGGHKGGGGGGGQGGHKGGGGGGQGGGGHKGGGGGQGGHKGGGGGGHVGGGGR 272 Query: 216 AAAAEPRGAGGGRGAHGLGHGVAAQGGG 299 RG GG G G G G GGG Sbjct: 273 GGGGGGRGGGGSGGGGGGGSGRGGGGGG 300 >At4g27850.1 putative proline-rich protein / extensin - Volvox carteri (fragment), Pir2:S22697 Length = 577 Score = 47.0 bits (110), Expect = 7e-06 Identities = 33/94 (35%), Positives = 38/94 (40%), Gaps = 6/94 (6%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPP + +P P P +P P P P P P + P S L P P LPL Sbjct: 175 PPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLP-SPGPDSPLPL---P 230 Query: 118 GTRNEKRVRPAP------PPPPASVSPPPGPWAP 35 G P P P PP S SP PGP +P Sbjct: 231 GPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSP 264 >At4g22470.1 extensin - like protein / hybrid proline-rich protein, Zea mays, PIR2:JQ1663 Length = 379 Score = 46.6 bits (109), Expect = 9e-06 Identities = 28/88 (31%), Positives = 32/88 (35%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPPC P P P+P P P P + PP S PPV + L Sbjct: 37 PPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKP 96 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGPWAP 35 + PPPPPA PPP P Sbjct: 97 LPPPLSPPQTTPPPPPAITPPPPPAITP 124 Score = 46.6 bits (109), Expect = 9e-06 Identities = 33/92 (35%), Positives = 36/92 (38%), Gaps = 2/92 (2%) Frame = -3 Query: 304 TWPPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGW 125 T PPP A TP P P PPP P P T PPA + L P P P Sbjct: 80 TSPPPVATTPPALPPKPLPPPLSPPQTTPP-PPPAITPPPPPAITPPLSPPPPAITPPPP 138 Query: 124 GVGTRNEKRVRPAPPP--PPASVSPPPGPWAP 35 T +P PPP PP + PPP P Sbjct: 139 LATTPPALPPKPLPPPLSPPQTTPPPPPAITP 170 >At4g39260.1 glycine-rich RNA-binding protein 8 (GRP8) / CCR1 protein; supported by cDNA: gi_166838_gb_L00649.1_ATHRBPB Length = 169 Score = 46.6 bits (109), Expect = 9e-06 Identities = 30/88 (34%), Positives = 39/88 (44%) Frame = +3 Query: 39 AQGPGGGETEAGGGGGAGRTRFSFRVPTPQPRGSWREGTGGSFKEEAGGRASVWHGEGRA 218 ++G GGG GG GG+G G +R G GG + GG S G G Sbjct: 84 SRGSGGG---GGGRGGSG--------------GGYRSGGGGGYSGGGGGGYSGGGGGGYE 126 Query: 219 AAAEPRGAGGGRGAHGLGHGVAAQGGGH 302 + G+GGG G G G G +GGG+ Sbjct: 127 RRSGGYGSGGGGGGRGYGGGGRREGGGY 154 >At4g15160.1 cell wall protein like / Length = 428 Score = 46.6 bits (109), Expect = 9e-06 Identities = 29/85 (34%), Positives = 32/85 (37%) Frame = -3 Query: 298 PPPCAATPWPSP*APRPPPAPRGSAAAARPSPCHTDARPPASSLKLPPVPSLQLPLGWGV 119 PPP P P P PPP P P T PP ++K PP P + P Sbjct: 107 PPPYVKPPPPPTVKPPPPPTP-------YTPPPPTPYTPPPPTVKPPPPPVVTPP----- 154 Query: 118 GTRNEKRVRPAPPPPPASVSPPPGP 44 P PPPPP PPP P Sbjct: 155 -PPTPTPEAPCPPPPPTPYPPPPKP 178 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,212,159 Number of Sequences: 27288 Number of extensions: 614465 Number of successful extensions: 16319 Number of sequences better than 1.0e-05: 36 Number of HSP's better than 0.0 without gapping: 3259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8770 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 868297828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822319|gb|BQ048343.1|BQ048343 1091006G06.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (628 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21150.1 putative protein / ribophorin II precursor, Homo ... 282 1e-77 >At4g21150.1 putative protein / ribophorin II precursor, Homo sapiens, PIR2:B26168; supported by cDNA: gi_16604453 Length = 691 Score = 282 bits (722), Expect(2) = 1e-77 Identities = 133/193 (68%), Positives = 162/193 (83%) Frame = +1 Query: 49 KLCLSFQLTTPLGHTFKPHQVFLKLRHESKVEHLFVVPGSARQFKIVLDFLGLVEKFYYL 228 KL LSFQLTTPLG+ FKPHQ F KL+HES+VEH+F+V S ++ ++VLDFLGLVEK YYL Sbjct: 463 KLRLSFQLTTPLGNAFKPHQAFFKLKHESQVEHIFLVKTSGKKSELVLDFLGLVEKLYYL 522 Query: 229 SGRYDLELTVGDAVMENSFLRPLGHLELDLPDAPEKAPRPPAQAVDPFSKFGPKAEISHI 408 SG+Y+++LT+GDA MENS L +GH+ELDLP+ PEKA RPP Q+ +P+S++GPKAEISHI Sbjct: 523 SGKYEIQLTIGDASMENSLLSNIGHIELDLPERPEKATRPPLQSTEPYSRYGPKAEISHI 582 Query: 409 FRAPEKRPPKELSLAFTGLTLLPFIGFLIGLVRLGVNLKNFPSLPGPAAFASLFHAGIGA 588 FR PEK P K+LSL F G+ +LPFIGFLIGL RLGVN+K+FPS G A A LFH GIGA Sbjct: 583 FRIPEKLPAKQLSLVFLGVIVLPFIGFLIGLTRLGVNIKSFPSSTGSAISALLFHCGIGA 642 Query: 589 VLMLYVLFWIKLD 627 VL+LYVLFW+KLD Sbjct: 643 VLLLYVLFWLKLD 655 Score = 25.4 bits (54), Expect(2) = 1e-77 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +3 Query: 3 LLKDTKVSLSANHLQ 47 L KD VSLSANHLQ Sbjct: 448 LTKDGAVSLSANHLQ 462 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,088,518 Number of Sequences: 27288 Number of extensions: 352432 Number of successful extensions: 1229 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1228 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 1008438668 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822297|gb|BQ048321.1|BQ048321 1091006D01.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (617 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39580.1 unknown protein / 110 6e-25 >At2g39580.1 unknown protein / Length = 1567 Score = 110 bits (275), Expect = 6e-25 Identities = 67/184 (36%), Positives = 106/184 (57%), Gaps = 4/184 (2%) Frame = +1 Query: 58 EWYEHCIREHAAIHAL-ELEKSSS-STDAQTRATFSLIIGYLADHCNLPTRELLSRRFCQ 231 E + HC+REHA + EL+ + S + Q R L+ YL +LP +E LS +F Sbjct: 1334 EHFMHCLREHAVFQLINELQATGEFSINLQMR----LLNSYLDRASSLPVKEPLSWKFIS 1389 Query: 232 N-IKKHRLRQLIDDTIGSVPADSSLINSVLEVCFGPSLLPKSISDVKYLVDFVETVMEAL 408 N +K R+R+L+ + + V ++ ++N VLE GPSL+P+ +S K LVDFVET++ + Sbjct: 1390 NSAEKPRVRKLVTNLLAPVSSELFVVNVVLEAWHGPSLVPEKLSKQKELVDFVETILGLV 1449 Query: 409 PANYRLGLAVGGFVAK-HFTGYGAASTGTRFWASSVLINAIFRAVPVAPESVWLEGAGLL 585 P+NY L L+V + K +S+G FWA L + I A+PVAPE +W+E ++ Sbjct: 1450 PSNYPLALSVSKLLRKEEKQSDSGSSSGIHFWAGLNLASTISCAIPVAPEYIWVEAGEIV 1509 Query: 586 EKLH 597 ++ Sbjct: 1510 SDIN 1513 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,912,956 Number of Sequences: 27288 Number of extensions: 332544 Number of successful extensions: 908 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 906 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 981665960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822280|gb|BQ048304.1|BQ048304 1091005H05.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (559 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02310.1 eceriferum3 (CER3) / 231 2e-61 >At5g02310.1 eceriferum3 (CER3) / Length = 795 Score = 231 bits (588), Expect = 2e-61 Identities = 109/182 (59%), Positives = 134/182 (72%) Frame = +1 Query: 4 LDLILQDESVHMLALKWSQHFCEEYNPRKYRGTLFSTPAVPFRLMQLPDVYQVLLERYIK 183 +D+IL DE + W QHF EY + + +L TP VPF+LM+LP++YQ LL+R IK Sbjct: 610 IDIILNDELLRSSTQIWLQHFQREYRVNRVKRSLCITPVVPFQLMKLPNLYQDLLQRCIK 669 Query: 184 MQCPDCGSVPDEPALCLLCGKLCSPSWKPCCRTGKCQNHALQCGAGIGIFLLVRKTTILL 363 +C +C V +EP LCLLCG LCSP W PCCR C NHA+ CGAG G+FLL+R+TTILL Sbjct: 670 KRCVNCTKVIEEPVLCLLCGSLCSPIWSPCCRESGCPNHAITCGAGTGVFLLIRRTTILL 729 Query: 364 QRSARLTFWPSLYLDAFGEEDNEMHRGKPLYLSQERYTSLTYLVASHSLDRTSEVLRQTT 543 QR AR + WPS YLD FGEED +M RGK LYL++ERY +LTYLV SH LDR+S+VL QTT Sbjct: 730 QRFARQSPWPSPYLDTFGEEDIDMIRGKRLYLNEERYAALTYLVGSHGLDRSSKVLGQTT 789 Query: 544 IG 549 IG Sbjct: 790 IG 791 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,027,176 Number of Sequences: 27288 Number of extensions: 295919 Number of successful extensions: 765 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 765 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 826050704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822270|gb|BQ048294.1|BQ048294 1091005G06.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (596 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g47570.1 expressed protein / ;supported by full-length cD... 196 8e-51 >At5g47570.1 expressed protein / ;supported by full-length cDNA: Ceres:12344. Length = 125 Score = 196 bits (498), Expect = 8e-51 Identities = 91/125 (72%), Positives = 104/125 (82%), Gaps = 2/125 (1%) Frame = +2 Query: 26 MAGRLTAAGSRILGGGG--ARAAASALRHRAGMGLPVGRHIVPDKPLPVNDELVWDNGTP 199 MAGRL+ SRI+GG G AR+ S+LR RAGMGLPVG+HIVPDKPL VNDEL+WDNGT Sbjct: 1 MAGRLSGVASRIMGGNGVVARSVGSSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA 60 Query: 200 FPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGMAAVVNDKASNIPYTPKVYPYDNLRAE 379 FPEPCIDR+A +GKYEALAWL GGLGFF LG+ AV+NDKAS +P+TP+VYPYDNLR E Sbjct: 61 FPEPCIDRIADTVGKYEALAWLSGGLGFFVGLGLLAVLNDKASKVPFTPRVYPYDNLRVE 120 Query: 380 LGDRP 394 LG P Sbjct: 121 LGGEP 125 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,867,491 Number of Sequences: 27288 Number of extensions: 433391 Number of successful extensions: 3066 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1863 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2824 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 930958496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822251|gb|BQ048275.1|BQ048275 1091005E09.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (557 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63440.1 expressed protein / ; supported by cDNA: gi_1622... 300 3e-82 >At5g63440.1 expressed protein / ; supported by cDNA: gi_16226477_gb_AF428410.1_AF428410 Length = 205 Score = 300 bits (769), Expect = 3e-82 Identities = 139/168 (82%), Positives = 159/168 (93%) Frame = +3 Query: 54 MPKRTTHTYSSEDALPEGPESDLFVYYCKHCASHVLITDTQLQKMPKRKTDRAHVLDKAK 233 MPKRTTHTYSSEDA P+GP+SDLFVYYCKHC SHVLITDTQLQKMPKRKTDR++VLDK Sbjct: 1 MPKRTTHTYSSEDAAPDGPDSDLFVYYCKHCGSHVLITDTQLQKMPKRKTDRSNVLDKKT 60 Query: 234 HLSRLNVKEAGKVMLKRGEGKLEKQFRMSCVGCDLFVCYRSEEDLEVAPFIYVIDGALSS 413 HL+RLNV E GKV+LKRGEGK+E+QFRM+C+GC+LFVCYR+EE+LE A FIY++DGALS+ Sbjct: 61 HLARLNVSEGGKVLLKRGEGKMERQFRMNCIGCELFVCYRAEENLETASFIYIVDGALSA 120 Query: 414 VAAETNPHDAPVPPCITQLEGGVVQVAIEVEDRAQRSAVTRVNADDVR 557 VAAETNP DAPVPPCI+QL+GG+VQVAIEVEDRAQRSA+TRVNADDVR Sbjct: 121 VAAETNPQDAPVPPCISQLDGGLVQVAIEVEDRAQRSAITRVNADDVR 168 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,391,207 Number of Sequences: 27288 Number of extensions: 309371 Number of successful extensions: 2949 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2608 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 826050704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822138|gb|BQ048162.1|BQ048162 1091003G01.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (522 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02100.1 hypothetical protein / predicted by genscan; supp... 203 4e-53 >At1g02100.1 hypothetical protein / predicted by genscan; supported by cDNA: gi_18377693 Length = 332 Score = 203 bits (517), Expect = 4e-53 Identities = 100/150 (66%), Positives = 124/150 (82%) Frame = +1 Query: 73 AATRSSPAAVQATNDDAAVSKLSCVNKGYMKDDYVRXFVRRPTRRAPIINRGYYARWSVL 252 A +RS+ AAVQATNDDA+ SKLSCV KGYMKDDYV FV+RP RR+PIINRGY++RW+ Sbjct: 2 AESRSNRAAVQATNDDASASKLSCVKKGYMKDDYVHLFVKRPVRRSPIINRGYFSRWAAF 61 Query: 253 RTLLHQFLNAGKNSNNDKPKQILSLGAGFDTTFFQLQDEGMAPHCYVELDFKEVTSKKAA 432 R L+ QFL +G +S KQILSLGAGFDTT+FQL DEG P+ YVELDFKEVTSKKAA Sbjct: 62 RKLMSQFLLSGTSSK----KQILSLGAGFDTTYFQLLDEGNGPNLYVELDFKEVTSKKAA 117 Query: 433 IINHYSEMKEKLGSEASISIEKGEVISTHY 522 +I + S++++KLG+ ASISI++G+V+S HY Sbjct: 118 VIQNSSQLRDKLGANASISIDEGQVLSDHY 147 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.316 0.131 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,500,313 Number of Sequences: 27288 Number of extensions: 286813 Number of successful extensions: 1027 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1021 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 729494100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822099|gb|BQ048123.1|BQ048123 1091003B11.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (501 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g45360.1 F-box protein family / ;supported by full-length... 219 6e-58 >At5g45360.1 F-box protein family / ;supported by full-length cDNA: Ceres:36901. Length = 316 Score = 219 bits (558), Expect = 6e-58 Identities = 101/155 (65%), Positives = 124/155 (79%), Gaps = 1/155 (0%) Frame = +3 Query: 39 GLFSNVPPELFLQIFKFLSSEDLISCALVCRFMNAAASDETLWRRLYCMRWGLA-SNAKF 215 G+F+NVP ELF I KFLSSEDL+SC+LVC+F+N AA+DE+LWRRLYC+RWGL + K Sbjct: 69 GVFTNVPTELFRHILKFLSSEDLVSCSLVCKFLNFAAADESLWRRLYCIRWGLTLPSRKL 128 Query: 216 RECAWKNLYIQRDREDMVEFVRNTPTEFKEYYIQMQAAKRSQAPRPSEVNDDKVMLDKTV 395 RE AWK LYI RD +DM+E VR P++FKEYY+ MQAAKRSQAP PS++ DD+++LD TV Sbjct: 129 RESAWKKLYIDRDEQDMIELVRTCPSDFKEYYVHMQAAKRSQAPLPSQMVDDRIILDNTV 188 Query: 396 ADQVSSWKNSRGLTDEAVKGHSCSGNTCSYTQIGD 500 +QVS WK S+GLTD+AV GH C G CSY QI D Sbjct: 189 LEQVSLWKKSKGLTDKAVTGHICLGTKCSYHQIDD 223 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,913,085 Number of Sequences: 27288 Number of extensions: 273986 Number of successful extensions: 1106 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1062 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1099 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 666451400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19822033|gb|BQ048057.1|BQ048057 1091002A11.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (582 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g17370.1 putative protein / 292 7e-80 >At4g17370.1 putative protein / Length = 364 Score = 292 bits (748), Expect = 7e-80 Identities = 145/194 (74%), Positives = 164/194 (83%) Frame = +1 Query: 1 LCDAIIVSSPNMTHYEILMDIICHREPQHILVEKPLCTTVQDCKKVIEAAKQRPEIVVQV 180 LCD I+VSSPNMTH++ILMDII + +P H+LVEKPLCTTV DCK+V+EAAK+R ++VVQV Sbjct: 77 LCDVIVVSSPNMTHHQILMDIINYSKPHHVLVEKPLCTTVADCKQVLEAAKKRSDMVVQV 136 Query: 181 GLEYRYMPPVAKLIDIVKSGTLGQVRMVAIREHRFPFLVKVNNWNRFNCNSGGTLVEKCC 360 GLEYRYMPPVAKLI+ VK G V+MVAIREHRFPFLVKV N TLVEKCC Sbjct: 137 GLEYRYMPPVAKLIEQVKGRDFGNVKMVAIREHRFPFLVKVG----LNKMGLWTLVEKCC 192 Query: 361 HFFDLMILFAAANPVRVMASGAIDVNHKNEVYDGQVPDIIDNAYVIVEFDNGSRGMLDLC 540 HFFDLM LFA ANPV VMASG +DVNHK+EVY G+VPDIIDNAYVI+EFDNG RGMLDLC Sbjct: 193 HFFDLMRLFAGANPVCVMASGGMDVNHKDEVYGGKVPDIIDNAYVIIEFDNGCRGMLDLC 252 Query: 541 MFAEGSRNKQEICV 582 MFAEGS+N+QEI V Sbjct: 253 MFAEGSKNEQEISV 266 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,339,135 Number of Sequences: 27288 Number of extensions: 288264 Number of successful extensions: 885 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 858 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 884 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 886200876 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19821883|gb|BQ047907.1|BQ047907 952045H02.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (678 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30990.1 putative protein / probable membrane protein YBL0... 108 3e-24 >At4g30990.1 putative protein / probable membrane protein YBL004w, yeast, PIR2:S45734 Length = 2138 Score = 108 bits (270), Expect = 3e-24 Identities = 72/180 (40%), Positives = 112/180 (62%), Gaps = 11/180 (6%) Frame = +3 Query: 12 NLVPAIFSILTVKTASGSITTYALEFIENLLRLDIDLQQQDEHLVKKVVLQHMDVLIHSL 191 +LVP IFSILTV TAS +I + AL+FIENLL LD ++ +DE++++ V +++ LI+SL Sbjct: 1159 SLVPDIFSILTVTTASEAIKSSALKFIENLLCLD-NVLGEDENMIRGFVDPYIEALINSL 1217 Query: 192 HD-FVNHRKELNRRSGTWLGQRELRLFKLLLNYITDPSTADKFIDLILPFFSK--KD--- 353 H F+ L R+S + G+RE+++ KLL + D S K++D++L F +K KD Sbjct: 1218 HSLFIG--DILKRKSVKYHGEREIKILKLLSKRMQDRSHVMKYLDVLLSFLNKSVKDPGM 1275 Query: 354 -----LNSDDCLEALCVVRGIIQNLRCKVSEKVLNALNPLLAIVGLEPRLCICDIYAGLS 518 L +D EAL ++ II L + + K++N ++PLL L+ RLCICD+ L+ Sbjct: 1276 VSLLLLLNDIRREALLAIQDIIAYLGMESTSKIINTVSPLLVDAELDVRLCICDLLESLA 1335 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,193,064 Number of Sequences: 27288 Number of extensions: 291987 Number of successful extensions: 743 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 740 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1147706292 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19821870|gb|BQ047894.1|BQ047894 952045F11.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (531 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27930.1 expressed protein / ;supported by full-length cDN... 220 4e-58 >At3g27930.1 expressed protein / ;supported by full-length cDNA: Ceres:103959. Length = 425 Score = 220 bits (560), Expect = 4e-58 Identities = 102/169 (60%), Positives = 134/169 (78%), Gaps = 2/169 (1%) Frame = -2 Query: 530 HLVVQRRVKNPFEDDQVVGITNYIDFGLELAAKVDKDKV--SGDGNSFQLAASWQANKNF 357 H+VVQRRV+NPFE++QVVGITNYIDFG EL ++VD K + + Q+AASWQANKNF Sbjct: 256 HVVVQRRVQNPFEENQVVGITNYIDFGFELQSRVDDSKTPPNAPDSLLQVAASWQANKNF 315 Query: 356 LLKGKLGPSTSSVALAFKSWWRPSFTFSVTAVNDHSKGTTSYGFGLRVEDLRRASYQRAD 177 LLKGK+G +S+++LAFKSWW+PSF F+++A +H G GFGLRV++LR ASYQRAD Sbjct: 316 LLKGKVGAHSSTLSLAFKSWWKPSFAFNISATTNHRTGNVQCGFGLRVDNLREASYQRAD 375 Query: 176 PNYVMLTPSKEHLAPGVLREYGKRPMFQTQIDSGNYDHLPTELKPLGRI 30 PN+VMLTP+KEHLA G++ + GKRPM+Q +D+ N+ LP EL+P +I Sbjct: 376 PNFVMLTPNKEHLAEGIVWKMGKRPMYQADVDAENFSELPKELRPSQKI 424 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,576,346 Number of Sequences: 27288 Number of extensions: 274254 Number of successful extensions: 662 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 661 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 745241396 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19821832|gb|BQ047856.1|BQ047856 952045B09.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (621 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g08960.1 hypothetical protein / similar to hypothetical pr... 228 3e-60 >At3g08960.1 hypothetical protein / similar to hypothetical proteins: GB:S61997, [Saccharomyces cerevisiae], GB:CAA22859 [Schizosaccharomyces pombe] Length = 754 Score = 228 bits (580), Expect = 3e-60 Identities = 106/198 (53%), Positives = 139/198 (69%) Frame = +3 Query: 27 SLEQRKKNFAAVASDMLKVILSGDRVVLLCNILVRRYFIFTAKDLEEWSENPESFHHEQN 206 + EQRKKN + ++ +L +R+VLLCN+LVRRYF+ TA DLEEW +NPESFHHEQ+ Sbjct: 297 TFEQRKKNASNTVGGIVSSLLPNERIVLLCNVLVRRYFVLTASDLEEWYQNPESFHHEQD 356 Query: 207 LVQWTEKKRPCAEALFIVIFEKYREV*TFKFSLWL*VYSML*CSHDHVSLQLLAPVVVSV 386 ++QWTEK RPCAEAL++V+FE Y QLL P+VVS+ Sbjct: 357 MIQWTEKLRPCAEALYMVLFENYS--------------------------QLLGPIVVSI 390 Query: 387 LREAMAISPPQETEVTAGMLLKDASYTAAGHVYYELSNYLSFNEWLHGSLSIEISNHHPN 566 L+EAM PP TE+T +LLKDA+Y A +VYYELSNYL+F +W +G+LS+E+SN HPN Sbjct: 391 LQEAMNNCPPSVTEITPALLLKDAAYAATAYVYYELSNYLNFRDWFNGALSLELSNDHPN 450 Query: 567 MRIIRRKIALLLGHWISE 620 RII RK+A++LGHW+SE Sbjct: 451 RRIIHRKVAMILGHWVSE 468 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,632,196 Number of Sequences: 27288 Number of extensions: 286259 Number of successful extensions: 810 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 809 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 990590196 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19821810|gb|BQ047834.1|BQ047834 952016H01.x2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (441 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g68900.1 hypothetical protein / predicted by genscan 155 6e-39 >At1g68900.1 hypothetical protein / predicted by genscan Length = 656 Score = 155 bits (393), Expect = 6e-39 Identities = 79/146 (54%), Positives = 106/146 (72%) Frame = +3 Query: 3 DANQKWTYEQAVEFGSRVQSLHLEYIEEPVSSVYDLIKFCEKNVLPVALDETIDNLRGDV 182 DAN +WT+E+A EFG V S +L+YIEEPV + DLI+F E+ LPVALDET+D+ Sbjct: 151 DANCRWTFEEAREFGLLVNSCNLKYIEEPVQNKDDLIRFHEETGLPVALDETLDDFEECP 210 Query: 183 ICKLHQFVHPGIIALVIKPSVVGGFENAAHIAKWAQLHDKMAVISSTYESSIGLASYIQX 362 + L ++ HPGI+A+VIKPSVVGGFENAA IA+WAQ H KMAVIS+ YES +GL++YI Sbjct: 211 LRMLTKYTHPGIVAVVIKPSVVGGFENAALIARWAQQHGKMAVISAAYESGLGLSAYILF 270 Query: 363 AHYVDQQSSIVSRIRNKDTCRATAHG 440 A Y++ ++ S + + T + AHG Sbjct: 271 ASYLEMENVKASTEQKQGTPPSVAHG 296 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,554,856 Number of Sequences: 27288 Number of extensions: 191064 Number of successful extensions: 536 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 534 length of database: 11,516,596 effective HSP length: 90 effective length of database: 9,060,676 effective search space used: 507397856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770567|gb|BQ035288.1|BQ035288 952078H09.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (588 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60640.1 hypothetical protein / predicted by genemark.hmm 72 3e-13 >At1g60640.1 hypothetical protein / predicted by genemark.hmm Length = 325 Score = 71.6 bits (174), Expect = 3e-13 Identities = 52/203 (25%), Positives = 94/203 (45%), Gaps = 35/203 (17%) Frame = +2 Query: 41 EDNSWNDVDGASIDDDEHSSPRDEERHEISLPIMKSSGANADSAKS--------ADNTDD 196 + +S +D S D D + ++ E S+ + G ++ +S D+ DD Sbjct: 13 DKDSGSDSSCFSSDSDPETEESEQSEEEDSVAEVSEDGDDSGDDESPAAGEDADVDDGDD 72 Query: 197 AVDAD--------------------------FPNCILKCKSVFKCKLCPRIMCLNVEMVK 298 DAD C+++ KSV+KC+ CP ++CLN ++ Sbjct: 73 NSDADDYGGTLEKMSMNRFLEEPPEEEEENYILGCMIQSKSVYKCRYCPTVVCLNENTMQ 132 Query: 299 IHLKSKRHARSEKLLGEGRLKLMLNSDGELEEEQETHAERHARTIALSQQVQKQKKDSGR 478 H+ SK+HAR EKL+ EG+++ +D E ++ ET ++ +K+KK + R Sbjct: 133 AHVSSKKHARMEKLVKEGKIR----TDDEEVDDLETASQ------------EKEKKGNRR 176 Query: 479 -QRQNRRKKKRSRVNLEEAQNNK 544 QRQ +R +K+ + +L + N+ Sbjct: 177 SQRQGKRSQKQEKDSLTKNGENE 199 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,066,331 Number of Sequences: 27288 Number of extensions: 297871 Number of successful extensions: 1664 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1633 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 904103924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770516|gb|BQ035237.1|BQ035237 952078C09.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (620 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22590.1 unknown protein / ; supported by cDNA: gi_17529301 252 1e-67 >At3g22590.1 unknown protein / ; supported by cDNA: gi_17529301 Length = 415 Score = 252 bits (644), Expect = 1e-67 Identities = 123/172 (71%), Positives = 148/172 (85%), Gaps = 1/172 (0%) Frame = +3 Query: 75 LGDGVVPIILVPSASQTLITIYNVKEFLEDGVFVPSEERMRATKGGKPESVTVQKKLIRT 254 +G+GV PIILVPSA QTLITIYNVKEFLEDGV++P++ + + KG KP+ +TVQKK R Sbjct: 248 IGEGV-PIILVPSAFQTLITIYNVKEFLEDGVYIPNDVKAKEMKGLKPDCITVQKKFSRD 306 Query: 255 -ERAGGAGGAVSFEVRDKPASLKSDDWGRVVAVFVLGKEWQFKDWPFKDHVEIFNRVIGF 431 ER ++EVRDKP++LK DDW RVVAVFVLGK+WQFKDWPFKDHVEIFN++IGF Sbjct: 307 RERV-----VTAYEVRDKPSALKPDDWDRVVAVFVLGKDWQFKDWPFKDHVEIFNKIIGF 361 Query: 432 YVRFEDDSVEAAKVVKQWNVKIISISKNKRHQDRTAALEVWERLEEFMRART 587 ++RFEDDS+E+AK VKQWNVKIISISKNKRHQDR AALEVWE+LEEF+R+R+ Sbjct: 362 FLRFEDDSIESAKTVKQWNVKIISISKNKRHQDRAAALEVWEKLEEFVRSRS 413 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,152,579 Number of Sequences: 27288 Number of extensions: 416638 Number of successful extensions: 1881 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1597 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1832 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 990590196 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770512|gb|BQ035233.1|BQ035233 952078C01.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (514 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g45150.1 hypothetical protein / predicted by genemark.hmm 198 2e-51 >At1g45150.1 hypothetical protein / predicted by genemark.hmm Length = 687 Score = 198 bits (503), Expect = 2e-51 Identities = 88/113 (77%), Positives = 102/113 (89%) Frame = -2 Query: 513 TGFLYWGSNCYEKAMIPSAEICFRRGLPPGDGVLFYPGEVFSSSHEPVASTRLERILSGM 334 TGFLYWG+NCYEKA +PSAE+ FRRGLPPGDGVL+YPGEVFSSS EPVAS RLER+LSG+ Sbjct: 573 TGFLYWGANCYEKATVPSAEVKFRRGLPPGDGVLYYPGEVFSSSSEPVASLRLERLLSGL 632 Query: 333 QDIEYLKLYSSRYGREEGLALIEKTGMYLGPDRYTLDHGPVDVMRGEVYRTCR 175 QD EYLKLY S+YGREE + L+EKTG+Y GP+RYTL+H P+DV+RGEVY TCR Sbjct: 633 QDYEYLKLYESKYGREEAMGLLEKTGVYTGPERYTLEHRPIDVLRGEVYNTCR 685 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,431,141 Number of Sequences: 27288 Number of extensions: 291012 Number of successful extensions: 702 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 702 length of database: 11,516,596 effective HSP length: 92 effective length of database: 9,006,100 effective search space used: 702475800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770508|gb|BQ035229.1|BQ035229 952078B08.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (525 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g15352.1 Expressed protein / ; supported by cDNA: gi_14794... 107 3e-24 At1g53030.1 cytochrome C oxidase assembly protein, putative / ... 95 2e-20 >At3g15352.1 Expressed protein / ; supported by cDNA: gi_14794881_gb_AF349684.1_AF349684 Length = 74 Score = 107 bits (268), Expect = 3e-24 Identities = 50/74 (67%), Positives = 58/74 (77%), Gaps = 3/74 (4%) Frame = -1 Query: 381 LPETPAVNG---EGSSAATAAAPGAGSKPKKKICCACPDTKRLRDECVVEHGEPACTKWI 211 + + PA NG +S + AA A +KPKK+ICCACPDTK+LRDEC+VEHGE ACTKWI Sbjct: 1 MTDQPAQNGLIPPPTSEPSKAAASAETKPKKRICCACPDTKKLRDECIVEHGESACTKWI 60 Query: 210 EAHKRCLRAEGFNV 169 EAHK CLRAEGFNV Sbjct: 61 EAHKICLRAEGFNV 74 >At1g53030.1 cytochrome C oxidase assembly protein, putative / similar to GB:5851903 from [Rattus norvegicus];supported by full-length cDNA: Ceres:11496. Length = 72 Score = 94.7 bits (234), Expect = 2e-20 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -1 Query: 312 SKPKKKICCACPDTKRLRDECVVEHGEPACTKWIEAHKRCLRAEGFNV 169 +KPKK+ICCACPDTK+LRDEC+VEHGE ACTKWIEAH CLR+EGF V Sbjct: 25 TKPKKRICCACPDTKKLRDECIVEHGESACTKWIEAHILCLRSEGFKV 72 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,294,655 Number of Sequences: 27288 Number of extensions: 280845 Number of successful extensions: 1207 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1090 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1201 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 727283772 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770494|gb|BQ035215.1|BQ035215 952078A05.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (556 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g12530.1 unknown protein / 213 5e-56 >At3g12530.1 unknown protein / Length = 191 Score = 213 bits (542), Expect = 5e-56 Identities = 104/146 (71%), Positives = 120/146 (81%) Frame = +3 Query: 117 VAEDEIVEIVPNIRMDALNMICGDFGPFFPQIPTKVPLWLAVALKKRSKCTIRTPDWMTV 296 +AEDE+VEIVPN+ M+ LN I GDFG F PQIPTKVPLWLAVALK+R KCT R P WM+V Sbjct: 1 MAEDELVEIVPNMNMEQLNFISGDFGRFIPQIPTKVPLWLAVALKRRGKCTFRPPGWMSV 60 Query: 297 DRLTQVLEAERESPREFQPLPFHYIEISKLLFDHARDDISDAYLVRSLIEDIRDVRFHKV 476 D LTQ+LEAERES FQ LPF Y+EI++LLFDHARDDI D Y+VRSL+EDIRDVR HK+ Sbjct: 61 DNLTQILEAERESQSTFQALPFSYVEIARLLFDHARDDIPDMYMVRSLVEDIRDVRLHKL 120 Query: 477 ETGLETISGRTHAVKLKNLSAMEVNI 554 ET L + G T AVK+ N+SAMEVNI Sbjct: 121 ETNLGSFQG-TSAVKISNVSAMEVNI 145 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,182,307 Number of Sequences: 27288 Number of extensions: 364201 Number of successful extensions: 1519 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1506 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 817071892 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770448|gb|BQ035169.1|BQ035169 952077C05.y2 952 - BMS tissue from Walbot Lab (reduced rRNA) Zea mays cDNA, mRNA sequence (669 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g04690.1 unknown protein / ; supported by cDNA: gi_19715625 230 4e-61 >At2g04690.1 unknown protein / ; supported by cDNA: gi_19715625 Length = 210 Score = 230 bits (587), Expect = 4e-61 Identities = 111/186 (59%), Positives = 144/186 (76%) Frame = +1 Query: 1 FLLVVRSSAPGAAAARPIFDGKPSPSEATATARWLAAQNTWGVLSTISSDLSGAPFGNVV 180 FL +++ S+ +AR + KP + A+ARWL +QN+WGVLST+S D GAPFGNVV Sbjct: 19 FLTILQQSS----SARVLTITKPDRHDYAASARWLVSQNSWGVLSTLSVDHKGAPFGNVV 74 Query: 181 SYSDGVPGEGRGIPYFYLTTLDPSARDALEDERTSFTLSEFPLGTCGEIDPENPTCAKLT 360 S+SDG+P +G GIPYFYLTTLDP+AR+AL+D+R S +SE PLGTC DP NPTC+KLT Sbjct: 75 SFSDGLPEKGNGIPYFYLTTLDPTARNALKDQRASLAISESPLGTCTR-DPMNPTCSKLT 133 Query: 361 LNGKLKMVDLQSSEADLAKSALFTKHPEMKDWPKNHHFKIFKMEIENIFLIDWFGGPKPI 540 L GKL +++ S EA++AK ALFTKHPEM DWPK+H F+ FK+EI +IFLI+W+GG KPI Sbjct: 134 LTGKLLILEGGSEEAEVAKKALFTKHPEMMDWPKDHDFRFFKLEIIDIFLINWYGGAKPI 193 Query: 541 SPSQYL 558 + +YL Sbjct: 194 TVDEYL 199 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,818,657 Number of Sequences: 27288 Number of extensions: 467393 Number of successful extensions: 2939 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2673 length of database: 11,516,596 effective HSP length: 96 effective length of database: 8,896,948 effective search space used: 1121015448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770364|gb|BQ035085.1|BQ035085 1091012C12.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (602 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77550.1 hypothetical protein / similar to GB:CAB55886 [Ho... 202 8e-53 >At1g77550.1 hypothetical protein / similar to GB:CAB55886 [Homo sapiens], GB:BAA09774 [Homo sapiens], GB:CAA87778 [Caenorhabditis elegans] Length = 883 Score = 202 bits (515), Expect = 8e-53 Identities = 110/204 (53%), Positives = 140/204 (67%), Gaps = 4/204 (1%) Frame = +3 Query: 3 LNLWGNKLRDPEKVMQEIRKCTKLKALWLNENPVLGKS---IDKAVLDGLSGLEIYNSHF 173 L+L GNK+ + V+QEI K LKALWLN+NPVL KS + +L G LEIYNS F Sbjct: 186 LSLIGNKIESADVVIQEIVKFKNLKALWLNDNPVLQKSERQMADEILQGCPSLEIYNSCF 245 Query: 174 TSKAGEWALGFCADIVGADNPCSSVESTLFGSIGTIDLSDRCIHKLP-EVFSPSKLPSLS 350 T G WALGFC DI G DNP + ++ ++DLS+R IH L + FS ++P LS Sbjct: 246 TPNYGLWALGFCGDIFGKDNPGCVQQDQPLCNVTSLDLSNRSIHNLVNKAFSVHEMPLLS 305 Query: 351 KLNVRGNPLDQISGDDLLKLFGGFTQLQELEVDIPGPLGNSAISILESLPNLSLLNGVDS 530 LN+RGN LDQ S +LL++ F L LEVDIPGPLG +A+ ILESL NLSLLNGVD+ Sbjct: 306 HLNIRGNSLDQNSVGELLEVLKLFPSLSSLEVDIPGPLGINALEILESLSNLSLLNGVDT 365 Query: 531 SSIIESGKHIVDSALEPRLPEWSP 602 + I+E+GKH+VDS L+PR+PE +P Sbjct: 366 AKILETGKHVVDSMLQPRIPELNP 389 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,490,847 Number of Sequences: 27288 Number of extensions: 327007 Number of successful extensions: 1045 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 999 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1040 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 948861544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770263|gb|BQ034984.1|BQ034984 1091011C12.x1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (533 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20835.1 hypothetical protein / 92 1e-19 >At2g20835.1 hypothetical protein / Length = 68 Score = 92.4 bits (228), Expect = 1e-19 Identities = 42/68 (61%), Positives = 52/68 (75%) Frame = -3 Query: 486 MVFFCFLVEQRRTVRSSKPAAGICSRCGGCASVADMETATRVCYLLTVHRRTWRAIICTF 307 M FCFLV+QR+ VR KPAAG+CSRCGG A VADM T+TR C + +R+ W+AI+C Sbjct: 1 MAIFCFLVDQRKKVRGRKPAAGLCSRCGGGAVVADMRTSTRFCG-VPFYRKAWKAIVCHI 59 Query: 306 CGAMLKSY 283 CGA+LKSY Sbjct: 60 CGAVLKSY 67 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,463,744 Number of Sequences: 27288 Number of extensions: 333929 Number of successful extensions: 2459 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1632 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2314 length of database: 11,516,596 effective HSP length: 93 effective length of database: 8,978,812 effective search space used: 754220208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770156|gb|BQ034877.1|BQ034877 1091010B08.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (580 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g45830.1 DNA-binding protein - like / DNA-binding protein... 283 6e-77 >At3g45830.1 DNA-binding protein - like / DNA-binding protein R kappa B, Homo sapiens, PIR:S52863 Length = 1298 Score = 283 bits (723), Expect = 6e-77 Identities = 133/187 (71%), Positives = 163/187 (87%) Frame = +1 Query: 10 KVQELKAQKSLNTISPSSDEARTYFQREEFLRYSIPDRAFCYTAADGEKSIVAPLRRGGG 189 + ++L+AQKSL+TI+ SS+EAR YF++EEFLRYSIPDRAF YTAADG+KSIVAPLRRGGG Sbjct: 1016 RFKDLRAQKSLSTITQSSEEARAYFRKEEFLRYSIPDRAFVYTAADGKKSIVAPLRRGGG 1075 Query: 190 KPTANARGHPMLLPDRPPHVTILCLVRDAASRLPARTGTRADVCTLLRDSQYLNHEEANK 369 KPT+ AR H ML +RPPHVTILCLVRDAA+RLP GTRADVCTL+RDSQY+ + ++ Sbjct: 1076 KPTSKARDHFMLKRERPPHVTILCLVRDAAARLPGSIGTRADVCTLIRDSQYIVEDVSDS 1135 Query: 370 EAAINQVVSGALDRLHYERDPCVLYDNDKKLWTYLHRGREEEDFEDDGTSSTKKWKRPRR 549 + +NQVVSGALDRLHYERDPCV +D+++KLW YLHR RE+EDFEDDGTSSTKKWKRP++ Sbjct: 1136 Q--VNQVVSGALDRLHYERDPCVQFDSERKLWVYLHRDREQEDFEDDGTSSTKKWKRPKK 1193 Query: 550 DVSDAAE 570 + ++ E Sbjct: 1194 EAAEQTE 1200 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.315 0.133 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,984,431 Number of Sequences: 27288 Number of extensions: 322817 Number of successful extensions: 1172 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 1100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1168 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 877249352 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770131|gb|BQ034852.1|BQ034852 1091009H04.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (568 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g15200.1 expressed protein / EST gb|H77143 comes from this... 193 4e-50 >At1g15200.1 expressed protein / EST gb|H77143 comes from this gene; supported by cDNA: gi_15293206_gb_AY051037.1_ Length = 423 Score = 193 bits (491), Expect = 4e-50 Identities = 98/162 (60%), Positives = 127/162 (77%), Gaps = 6/162 (3%) Frame = +3 Query: 3 ARVAAKAEEKRLELLYIQWTEHHKRLSNFLRTKAEPPIYYMPTKPIIDDPAIVEQNKEKV 182 ARVAAKAE+K+LELL++QW+EH K+LSNF+RTKAEP IYY P KP+ +D + VEQ KE+ Sbjct: 231 ARVAAKAEQKKLELLFLQWSEHQKKLSNFIRTKAEPRIYYAPVKPLEEDTSEVEQQKERT 290 Query: 183 FEEWKSMRRAELTQFQKQVEEQYLSNVERQLERIQNARNARKANGPG-NMQE-MDKELDT 356 F EWK+ RR E++++QK++EEQ L NVE++LER QNAR ARKAN G N+QE MDKEL+T Sbjct: 291 FLEWKAARRQEVSEYQKEIEEQCLGNVEKELERWQNARKARKANNEGMNLQETMDKELET 350 Query: 357 HRAEHGPKPRRVPEEGGNDDDED---ADDMAAEDE-LMDEVL 470 HR EHGPK R++P G D+DE+ D EDE +MD++L Sbjct: 351 HRMEHGPKKRKIPGGGVGDEDEEDEVEDINGGEDEMIMDDLL 392 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,127,132 Number of Sequences: 27288 Number of extensions: 363572 Number of successful extensions: 3117 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2759 length of database: 11,516,596 effective HSP length: 94 effective length of database: 8,951,524 effective search space used: 841443256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19770114|gb|BQ034835.1|BQ034835 1091009F04.y1 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (622 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49970.1 putative protein / contains similarity to pyridox... 177 5e-45 >At5g49970.1 putative protein / contains similarity to pyridoxamine 5-phosphate oxidase;supported by full-length cDNA: Ceres:6244. Length = 466 Score = 177 bits (448), Expect = 5e-45 Identities = 77/119 (64%), Positives = 100/119 (83%) Frame = +1 Query: 1 WNEMNRQVRVEGSAEKVPEAESDKYFHSRPRGSQLGAIVSKQSTVIAGREVLQQDYKKLE 180 W +NRQVR+EG E++PE+ES+ YFHSRPRGSQ+GAIVSKQS+V+ GR VL +Y++L Sbjct: 348 WEILNRQVRIEGPVERIPESESENYFHSRPRGSQIGAIVSKQSSVVPGRHVLYDEYEELT 407 Query: 181 QKYSDGSLIPKPEYWGGYKLTPTLFEFWQGQQSRLHDRLQYSQREVDGSTVWHIERLSP 357 ++YSDGS+IPKP+ WGG++L P LFEFWQGQ SRLHDRLQYS ++V+G+ W I RL+P Sbjct: 408 KQYSDGSVIPKPKNWGGFRLKPNLFEFWQGQPSRLHDRLQYSLQDVNGNPAWKIHRLAP 466 Database: ../ATH1_TIGR.pep Posted date: Aug 20, 2002 9:10 AM Number of letters in database: 11,516,596 Number of sequences in database: 27,288 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,444,680 Number of Sequences: 27288 Number of extensions: 319261 Number of successful extensions: 959 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 959 length of database: 11,516,596 effective HSP length: 95 effective length of database: 8,924,236 effective search space used: 990590196 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) BLASTX 2.2.3 [Apr-24-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|19769779|gb|BQ034500.1|BQ034500 1091003A07.x2 1091 - Immature ear with common ESTs screened by Schmidt lab Zea mays cDNA, mRNA sequence (573 letters) Database: ../ATH1_TIGR.pep 27,288 sequences; 11,516,596 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g23090.1 Expressed protein / ; supported by full-length cD... 135 2e-32 >At2g23090.1 Expressed protein / ; supported by full-length cDNA: Ceres: 14468. Length = 78 Score = 135 bits (339), Expect = 2e-32 Identities = 65/78 (83%), Positives = 68/78 (86%), Gaps = 1/78 (1%) Frame = -3 Query: 445 MG